F365829

General Info

Members Datasets Scaffolds Average Seq Length
255 185 510 137

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100625074|Ga0307415_1006250741
Length 157
Sequence LSEPTEPNAALAASAAPEAAVPRPRKLVVAGLIIGGDGRVLITQRRADQSLPLQWEFPGGKVEPGEAPVAALARELREELGVAAEVGRIWDVLFHAYPAFDLVMLVYACRLGAGEEPRAIEVADLAWVSSGELPAWDILPADRPLVHRLVAEGPPVN

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
131 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
132 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
147 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
148 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
149 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
150 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
151 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
152 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
153 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
154 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
155 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
165 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
168 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
169 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
170 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
171 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
172 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
173 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
174 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
175 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
176 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
177 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
178 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
179 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
180 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
181 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
182 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
183 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
184 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.2
Nodule 0
Rhizoplane 1.18
Rhizosphere 85.49
Stem 0
Stem Tuber 0
Unclassified 5.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100625074 3300032126 Bacteria 962
2 Ga0070658_11170411 3300005327 Bacteria 669
3 Ga0070683_100136278 3300005329 Bacteria 2325
4 Ga0070683_100366986 3300005329 Bacteria 1371
5 Ga0070690_100030672 3300005330 Bacteria 3343
6 Ga0070690_100558096 3300005330 Bacteria 864
7 Ga0068869_100285512 3300005334 Bacteria 1328
8 Ga0068869_100309412 3300005334 Bacteria 1278
9 Ga0068869_100725961 3300005334 Bacteria 849
10 Ga0070666_10516693 3300005335 Bacteria 867
11 Ga0070689_100064580 3300005340 Bacteria 2849
12 Ga0070689_100556847 3300005340 Bacteria 989
13 Ga0070687_100216643 3300005343 Bacteria 1170
14 Ga0070687_100371914 3300005343 Bacteria 929
15 Ga0070674_100339437 3300005356 Bacteria 1210
16 Ga0070673_101153716 3300005364 Bacteria 725
17 Ga0070688_100125306 3300005365 Bacteria 1726
18 Ga0070688_100697123 3300005365 Bacteria 786
19 Ga0070667_100550750 3300005367 Unclassified 1060
20 Ga0070701_10081090 3300005438 Bacteria 1756
21 Ga0070705_101158067 3300005440 Bacteria 635
22 Ga0070700_101148026 3300005441 Bacteria 646
23 Ga0070708_100208297 3300005445 Bacteria 1832
24 Ga0070708_102132029 3300005445 Bacteria 518
25 Ga0070678_100989754 3300005456 Bacteria 772
26 Ga0070678_100992362 3300005456 Bacteria 771
27 Ga0070681_10337448 3300005458 Bacteria 1417
28 Ga0070681_10668102 3300005458 Bacteria 954
29 Ga0070685_10357861 3300005466 Bacteria 1000
30 Ga0070706_100323529 3300005467 Bacteria 1438
31 Ga0070706_101085481 3300005467 Bacteria 737
32 Ga0070707_100216765 3300005468 Bacteria 1865
33 Ga0070707_100721066 3300005468 Unclassified 960
34 Ga0070698_100020856 3300005471 Bacteria 6867
35 Ga0070698_100750475 3300005471 Bacteria 919
36 Ga0070699_100155340 3300005518 Bacteria 2025
37 Ga0070699_101111939 3300005518 Bacteria 725
38 Ga0070679_100002586 3300005530 Bacteria 16447
39 Ga0070679_100551137 3300005530 Bacteria 1097
40 Ga0070684_100225158 3300005535 Bacteria 1711
41 Ga0070684_101312159 3300005535 Bacteria 681
42 Ga0070697_100328052 3300005536 Bacteria 1319
43 Ga0070695_100414461 3300005545 Bacteria 1024
44 Ga0070665_100005092 3300005548 Bacteria 13634
45 Ga0068855_100249320 3300005563 Bacteria 1981
46 Ga0068857_101756242 3300005577 Bacteria 607
47 Ga0068857_102081320 3300005577 Bacteria 557
48 Ga0068856_100099460 3300005614 Bacteria 2900
49 Ga0068859_100722408 3300005617 Bacteria 1086
50 Ga0068864_100540565 3300005618 Bacteria 1125
51 Ga0068861_100047232 3300005719 Bacteria 3249
52 Ga0068861_100100904 3300005719 Bacteria 2295
53 Ga0068861_101717138 3300005719 Bacteria 621
54 Ga0068863_100159755 3300005841 Bacteria 2159
55 Ga0068863_101455155 3300005841 Bacteria 693
56 Ga0068858_100828697 3300005842 Bacteria 903
57 Ga0068860_100248432 3300005843 Bacteria 1732
58 Ga0068862_100547093 3300005844 Bacteria 1105
59 Ga0068862_102580217 3300005844 Bacteria 520
60 Ga0081455_10057468 3300005937 Bacteria 3296
61 Ga0070717_10044568 3300006028 Bacteria 3623
62 Ga0070717_10168137 3300006028 Bacteria 1906
63 Ga0075430_100069851 3300006846 Bacteria 2946
64 Ga0075434_100218837 3300006871 Bacteria 1924
65 Ga0075429_100002168 3300006880 Bacteria 16391
66 Ga0075429_100053377 3300006880 Bacteria 3517
67 Ga0075429_100165910 3300006880 Bacteria 1935
68 Ga0075429_101162677 3300006880 Bacteria 674
69 Ga0097620_100722322 3300006931 Bacteria 1086
70 Ga0075435_100152616 3300007076 Bacteria 1943
71 Ga0111539_11117579 3300009094 Bacteria 916
72 Ga0105245_10000072 3300009098 Bacteria 105617
73 Ga0105243_10867996 3300009148 Bacteria 895
74 Ga0105241_10103964 3300009174 Bacteria 2262
75 Ga0105242_10258556 3300009176 Bacteria 1572
76 Ga0105242_10301089 3300009176 Bacteria 1464
77 Ga0105248_13468500 3300009177 Bacteria 501
78 Ga0105249_10192196 3300009553 Bacteria 1993
79 Ga0105249_10260673 3300009553 Bacteria 1722
80 Ga0105239_10103727 3300010375 Bacteria 3148
81 Ga0157374_10044255 3300013296 Bacteria 4115
82 Ga0157374_10398757 3300013296 Bacteria 1372
83 Ga0157378_10914842 3300013297 Bacteria 908
84 Ga0163163_10552324 3300014325 Bacteria 1214
85 Ga0157376_10147944 3300014969 Bacteria 2115
86 Ga0157376_10223177 3300014969 Bacteria 1746
87 Ga0157376_10311909 3300014969 Bacteria 1493
88 Ga0157376_12205098 3300014969 Bacteria 590
89 Ga0163161_10520254 3300017792 Bacteria 971
90 Ga0207680_10515382 3300025903 Bacteria 852
91 Ga0207705_10401843 3300025909 Bacteria 1060
92 Ga0207684_10104619 3300025910 Unclassified 2421
93 Ga0207684_11041279 3300025910 Bacteria 683
94 Ga0207654_10461886 3300025911 Bacteria 892
95 Ga0207707_10318571 3300025912 Bacteria 1343
96 Ga0207707_10751008 3300025912 Bacteria 816
97 Ga0207662_10046301 3300025918 Unclassified 2573
98 Ga0207662_10099524 3300025918 Bacteria 1800
99 Ga0207652_10034049 3300025921 Bacteria 4292
100 Ga0207652_10783326 3300025921 Bacteria 847
101 Ga0207646_10179878 3300025922 Bacteria 1910
102 Ga0207646_10561212 3300025922 Bacteria 1026
103 Ga0207687_10002588 3300025927 Bacteria 12277
104 Ga0207686_10622354 3300025934 Bacteria 852
105 Ga0207709_11121296 3300025935 Bacteria 646
106 Ga0207670_10008355 3300025936 Bacteria 5838
107 Ga0207670_10045655 3300025936 Bacteria 2905
108 Ga0207670_10133210 3300025936 Bacteria 1824
109 Ga0207704_10739213 3300025938 Archaea 817
110 Ga0207689_10405651 3300025942 Bacteria 1136
111 Ga0207661_10369910 3300025944 Bacteria 1296
112 Ga0207661_10456219 3300025944 Unclassified 1165
113 Ga0207667_10594263 3300025949 Bacteria 1116
114 Ga0207712_10318834 3300025961 Bacteria 1282
115 Ga0207703_10193552 3300026035 Bacteria 1803
116 Ga0207708_10086238 3300026075 Bacteria 2416
117 Ga0207702_10096229 3300026078 Bacteria 2603
118 Ga0207641_10145702 3300026088 Bacteria 2141
119 Ga0207641_11111528 3300026088 Bacteria 789
120 Ga0207676_10448424 3300026095 Bacteria 1216
121 Ga0207674_10315457 3300026116 Bacteria 1512
122 Ga0207674_10706782 3300026116 Bacteria 973
123 Ga0207675_100037626 3300026118 Bacteria 4513
124 Ga0207675_100405044 3300026118 Bacteria 1345
125 Ga0207683_10069665 3300026121 Bacteria 3106
126 Ga0268266_10002761 3300028379 Bacteria 18352
127 Ga0268265_12459024 3300028380 Bacteria 527
128 Ga0268264_10227750 3300028381 Bacteria 1719
129 Ga0265337_1004774 3300028556 Bacteria 5552
130 Ga0265338_10018541 3300028800 Bacteria 7445
131 Ga0265338_10359745 3300028800 Bacteria 1044
132 Ga0265330_10007006 3300031235 Bacteria 5532
133 Ga0265325_10003903 3300031241 Bacteria 9558
134 Ga0265329_10053918 3300031242 Bacteria 1277
135 Ga0265340_10000572 3300031247 Bacteria 20433
136 Ga0265331_10012866 3300031250 Bacteria 4514
137 Ga0265331_10213984 3300031250 Bacteria 867
138 Ga0265316_10023649 3300031344 Bacteria 5159
139 Ga0265316_10325357 3300031344 Bacteria 1116
140 Ga0307513_10038554 3300031456 Bacteria 5304
141 Ga0307509_10000164 3300031507 Bacteria 104223
142 Ga0307509_10027240 3300031507 Bacteria 6362
143 Ga0307509_10051200 3300031507 Bacteria 4418
144 Ga0265313_10088353 3300031595 Bacteria 1396
145 Ga0307508_10249247 3300031616 Bacteria 1372
146 Ga0307508_10505103 3300031616 Unclassified 804
147 Ga0265314_10000163 3300031711 Bacteria 101795
148 Ga0265314_10263250 3300031711 Bacteria 984
149 Ga0265342_10004909 3300031712 Bacteria 10347
150 Ga0307516_10172647 3300031730 Bacteria 1901
151 Ga0307516_10267127 3300031730 Bacteria 1399
152 Ga0307406_10461980 3300031901 Bacteria 1021
153 Ga0307412_10350059 3300031911 Bacteria 1186
154 Ga0307411_11706100 3300032005 Bacteria 583
155 Ga0373936_0000009 3300035113 Bacteria 263478
156 Ga0373941_0231259 3300035115 Bacteria 714
157 Ga0373961_0000132 3300035241 Bacteria 38247
158 Ga0373947_1228214 3300035725 Bacteria 510
159 Ga0395899_0050892 3300037312 Bacteria 3074
160 Ga0395900_0167514 3300037418 Bacteria 2238
161 Ga0395898_0190908 3300037466 Bacteria 1957
162 Ga0395905_0763721 3300037471 Unclassified 869
163 Ga0395905_1279475 3300037471 Bacteria 637
164 Ga0395901_0029915 3300038443 Bacteria 5609
165 Ga0395901_0272226 3300038443 Bacteria 1761
166 Ga0451577_1648252 3300042876 Bacteria 565
167 Ga0451576_1295295 3300045051 Bacteria 760
168 Ga0466967_0733039 3300045976 Bacteria 980
169 Ga0495603_0331296 3300046455 Bacteria 874
170 Ga0495650_0038860 3300046471 Unclassified 2058
171 Ga0495618_0177379 3300046514 Bacteria 1355
172 Ga0495628_0177470 3300046516 Bacteria 1613
173 Ga0495634_0556426 3300046642 Bacteria 668
174 Ga0495649_0149099 3300046694 Bacteria 1229
175 Ga0495674_0932245 3300047319 Bacteria 669
176 Ga0495680_0678649 3300047322 Bacteria 682
177 Ga0495686_0039813 3300047472 Bacteria 3000
178 Ga0495602_0276474 3300048088 Bacteria 1239
179 Ga0496103_0047845 3300048906 Bacteria 2643
180 Ga0496104_0757357 3300048907 Bacteria 878
181 Ga0496115_0387005 3300048918 Bacteria 1136
182 Ga0501292_011931 3300049515 Bacteria 1321
183 Ga0501298_066147 3300049521 Bacteria 773
184 Ga0501299_006404 3300049522 Bacteria 1845
185 Ga0501031_0692064 3300049568 Bacteria 655
186 Ga0501034_0303467 3300049571 Bacteria 1533
187 Ga0501034_0998687 3300049571 Bacteria 721
188 Ga0501042_0587376 3300049578 Unclassified 810
189 Ga0501043_0055012 3300049579 Unclassified 3126
190 Ga0501047_0109014 3300049581 Archaea 2651
191 Ga0501047_0157118 3300049581 Bacteria 2147
192 Ga0501048_0063453 3300049582 Archaea 2613
193 Ga0501067_0470213 3300049583 Bacteria 702
194 Ga0501068_0321814 3300049584 Bacteria 991
195 Ga0501069_0003625 3300049585 Bacteria 7949
196 Ga0501070_0034368 3300049586 Bacteria 4239
197 Ga0501070_0205890 3300049586 Unclassified 1615
198 Ga0501070_0323476 3300049586 Bacteria 1254
199 Ga0501070_0534773 3300049586 Bacteria 939
200 Ga0501070_0579996 3300049586 Bacteria 895
201 Ga0501071_0303390 3300049587 Bacteria 1211
202 Ga0501071_0413063 3300049587 Bacteria 1031
203 Ga0501073_0242614 3300049589 Bacteria 1244
204 Ga0501073_0638736 3300049589 Bacteria 735
205 Ga0501074_0044737 3300049590 Bacteria 3204
206 Ga0501209_049094 3300049656 Bacteria 1146
207 Ga0501216_001541 3300049660 Bacteria 3129
208 Ga0501217_055963 3300049661 Bacteria 1042
209 Ga0501223_015449 3300049663 Bacteria 1512
210 Ga0501227_000349 3300049665 Bacteria 9774
211 Ga0501227_002080 3300049665 Bacteria 4435
212 Ga0501230_000461 3300049667 Bacteria 4023
213 Ga0501233_004596 3300049668 Bacteria 2537
214 Ga0501221_256211 3300049704 Bacteria 504
215 Ga0501225_0216541 3300049705 Bacteria 615
216 Ga0501229_013886 3300049706 Bacteria 1035
217 Ga0501081_0064363 3300049743 Bacteria 2547
218 Ga0501083_0195067 3300049744 Bacteria 1321
219 Ga0501035_0042339 3300049822 Bacteria 4108
220 Ga0501044_0049920 3300049823 Bacteria 4318
221 nmdc:mga09592_256585_c1 3300050508 Bacteria 1516
222 nmdc:mga09592_3157_c1 3300050508 Bacteria 13383
223 nmdc:mga09592_96549_c1 3300050508 Bacteria 2528
224 nmdc:mga0qj67_104384_c1 3300050509 Bacteria 2286
225 nmdc:mga06r32_613576_c1 3300050510 Bacteria 1058
226 nmdc:mga0rr50_72072_c1 3300050513 Bacteria 2637
227 Ga0495612_0590551 3300053078 Bacteria 513
228 Ga0500635_0079679 3300053080 Bacteria 1175
229 Ga0495619_0146937 3300053085 Bacteria 1626
230 Ga0500578_0164002 3300053086 Bacteria 1377
231 Ga0500578_0277848 3300053086 Bacteria 1000
232 Ga0500566_0000983 3300053094 Bacteria 16425
233 Ga0500566_0011880 3300053094 Bacteria 5128
234 Ga0500566_0115188 3300053094 Bacteria 1456
235 Ga0500566_0184167 3300053094 Bacteria 1068
236 Ga0500640_001204 3300053095 Bacteria 7593
237 Ga0500553_214266 3300053101 Bacteria 638
238 Ga0500554_000512 3300053102 Bacteria 8072
239 Ga0500572_111687 3300053111 Unclassified 880
240 Ga0500591_131682 3300053115 Bacteria 1007
241 Ga0500595_000017 3300053119 Bacteria 206032
242 Ga0500597_016761 3300053120 Bacteria 2802
243 Ga0500597_170346 3300053120 Bacteria 928
244 Ga0500614_005032 3300053123 Bacteria 2778
245 Ga0500614_062833 3300053123 Unclassified 1002
246 Ga0500642_0045016 3300053130 Bacteria 1924
247 Ga0500658_0268172 3300053134 Bacteria 785
248 Ga0500559_0006312 3300053136 Bacteria 5357
249 Ga0500568_0014154 3300053139 Bacteria 3612
250 Ga0500585_128765 3300053144 Bacteria 898
251 Ga0500585_241840 3300053144 Bacteria 578
252 Ga0500603_026983 3300053150 Bacteria 1456
253 Ga0500636_0087596 3300053177 Bacteria 1787
254 Ga0500637_0161619 3300053178 Unclassified 1291
255 Ga0501084_0769242 3300054114 Bacteria 811
256 Ga0307415_100625074
257 Ga0070658_11170411
258 Ga0070683_100136278
259 Ga0070683_100366986
260 Ga0070690_100030672
261 Ga0070690_100558096
262 Ga0068869_100285512
263 Ga0068869_100309412
264 Ga0068869_100725961
265 Ga0070666_10516693
266 Ga0070689_100064580
267 Ga0070689_100556847
268 Ga0070687_100216643
269 Ga0070687_100371914
270 Ga0070674_100339437
271 Ga0070673_101153716
272 Ga0070688_100125306
273 Ga0070688_100697123
274 Ga0070667_100550750
275 Ga0070701_10081090
276 Ga0070705_101158067
277 Ga0070700_101148026
278 Ga0070708_100208297
279 Ga0070708_102132029
280 Ga0070678_100989754
281 Ga0070678_100992362
282 Ga0070681_10337448
283 Ga0070681_10668102
284 Ga0070685_10357861
285 Ga0070706_100323529
286 Ga0070706_101085481
287 Ga0070707_100216765
288 Ga0070707_100721066
289 Ga0070698_100020856
290 Ga0070698_100750475
291 Ga0070699_100155340
292 Ga0070699_101111939
293 Ga0070679_100002586
294 Ga0070679_100551137
295 Ga0070684_100225158
296 Ga0070684_101312159
297 Ga0070697_100328052
298 Ga0070695_100414461
299 Ga0070665_100005092
300 Ga0068855_100249320
301 Ga0068857_101756242
302 Ga0068857_102081320
303 Ga0068856_100099460
304 Ga0068859_100722408
305 Ga0068864_100540565
306 Ga0068861_100047232
307 Ga0068861_100100904
308 Ga0068861_101717138
309 Ga0068863_100159755
310 Ga0068863_101455155
311 Ga0068858_100828697
312 Ga0068860_100248432
313 Ga0068862_100547093
314 Ga0068862_102580217
315 Ga0081455_10057468
316 Ga0070717_10044568
317 Ga0070717_10168137
318 Ga0075430_100069851
319 Ga0075434_100218837
320 Ga0075429_100002168
321 Ga0075429_100053377
322 Ga0075429_100165910
323 Ga0075429_101162677
324 Ga0097620_100722322
325 Ga0075435_100152616
326 Ga0111539_11117579
327 Ga0105245_10000072
328 Ga0105243_10867996
329 Ga0105241_10103964
330 Ga0105242_10258556
331 Ga0105242_10301089
332 Ga0105248_13468500
333 Ga0105249_10192196
334 Ga0105249_10260673
335 Ga0105239_10103727
336 Ga0157374_10044255
337 Ga0157374_10398757
338 Ga0157378_10914842
339 Ga0163163_10552324
340 Ga0157376_10147944
341 Ga0157376_10223177
342 Ga0157376_10311909
343 Ga0157376_12205098
344 Ga0163161_10520254
345 Ga0207680_10515382
346 Ga0207705_10401843
347 Ga0207684_10104619
348 Ga0207684_11041279
349 Ga0207654_10461886
350 Ga0207707_10318571
351 Ga0207707_10751008
352 Ga0207662_10046301
353 Ga0207662_10099524
354 Ga0207652_10034049
355 Ga0207652_10783326
356 Ga0207646_10179878
357 Ga0207646_10561212
358 Ga0207687_10002588
359 Ga0207686_10622354
360 Ga0207709_11121296
361 Ga0207670_10008355
362 Ga0207670_10045655
363 Ga0207670_10133210
364 Ga0207704_10739213
365 Ga0207689_10405651
366 Ga0207661_10369910
367 Ga0207661_10456219
368 Ga0207667_10594263
369 Ga0207712_10318834
370 Ga0207703_10193552
371 Ga0207708_10086238
372 Ga0207702_10096229
373 Ga0207641_10145702
374 Ga0207641_11111528
375 Ga0207676_10448424
376 Ga0207674_10315457
377 Ga0207674_10706782
378 Ga0207675_100037626
379 Ga0207675_100405044
380 Ga0207683_10069665
381 Ga0268266_10002761
382 Ga0268265_12459024
383 Ga0268264_10227750
384 Ga0265337_1004774
385 Ga0265338_10018541
386 Ga0265338_10359745
387 Ga0265330_10007006
388 Ga0265325_10003903
389 Ga0265329_10053918
390 Ga0265340_10000572
391 Ga0265331_10012866
392 Ga0265331_10213984
393 Ga0265316_10023649
394 Ga0265316_10325357
395 Ga0307513_10038554
396 Ga0307509_10000164
397 Ga0307509_10027240
398 Ga0307509_10051200
399 Ga0265313_10088353
400 Ga0307508_10249247
401 Ga0307508_10505103
402 Ga0265314_10000163
403 Ga0265314_10263250
404 Ga0265342_10004909
405 Ga0307516_10172647
406 Ga0307516_10267127
407 Ga0307406_10461980
408 Ga0307412_10350059
409 Ga0307411_11706100
410 Ga0373936_0000009
411 Ga0373941_0231259
412 Ga0373961_0000132
413 Ga0373947_1228214
414 Ga0395899_0050892
415 Ga0395900_0167514
416 Ga0395898_0190908
417 Ga0395905_0763721
418 Ga0395905_1279475
419 Ga0395901_0029915
420 Ga0395901_0272226
421 Ga0451577_1648252
422 Ga0451576_1295295
423 Ga0466967_0733039
424 Ga0495603_0331296
425 Ga0495650_0038860
426 Ga0495618_0177379
427 Ga0495628_0177470
428 Ga0495634_0556426
429 Ga0495649_0149099
430 Ga0495674_0932245
431 Ga0495680_0678649
432 Ga0495686_0039813
433 Ga0495602_0276474
434 Ga0496103_0047845
435 Ga0496104_0757357
436 Ga0496115_0387005
437 Ga0501292_011931
438 Ga0501298_066147
439 Ga0501299_006404
440 Ga0501031_0692064
441 Ga0501034_0303467
442 Ga0501034_0998687
443 Ga0501042_0587376
444 Ga0501043_0055012
445 Ga0501047_0109014
446 Ga0501047_0157118
447 Ga0501048_0063453
448 Ga0501067_0470213
449 Ga0501068_0321814
450 Ga0501069_0003625
451 Ga0501070_0034368
452 Ga0501070_0205890
453 Ga0501070_0323476
454 Ga0501070_0534773
455 Ga0501070_0579996
456 Ga0501071_0303390
457 Ga0501071_0413063
458 Ga0501073_0242614
459 Ga0501073_0638736
460 Ga0501074_0044737
461 Ga0501209_049094
462 Ga0501216_001541
463 Ga0501217_055963
464 Ga0501223_015449
465 Ga0501227_000349
466 Ga0501227_002080
467 Ga0501230_000461
468 Ga0501233_004596
469 Ga0501221_256211
470 Ga0501225_0216541
471 Ga0501229_013886
472 Ga0501081_0064363
473 Ga0501083_0195067
474 Ga0501035_0042339
475 Ga0501044_0049920
476 nmdc:mga09592_256585_c1
477 nmdc:mga09592_3157_c1
478 nmdc:mga09592_96549_c1
479 nmdc:mga0qj67_104384_c1
480 nmdc:mga06r32_613576_c1
481 nmdc:mga0rr50_72072_c1
482 Ga0495612_0590551
483 Ga0500635_0079679
484 Ga0495619_0146937
485 Ga0500578_0164002
486 Ga0500578_0277848
487 Ga0500566_0000983
488 Ga0500566_0011880
489 Ga0500566_0115188
490 Ga0500566_0184167
491 Ga0500640_001204
492 Ga0500553_214266
493 Ga0500554_000512
494 Ga0500572_111687
495 Ga0500591_131682
496 Ga0500595_000017
497 Ga0500597_016761
498 Ga0500597_170346
499 Ga0500614_005032
500 Ga0500614_062833
501 Ga0500642_0045016
502 Ga0500658_0268172
503 Ga0500559_0006312
504 Ga0500568_0014154
505 Ga0500585_128765
506 Ga0500585_241840
507 Ga0500603_026983
508 Ga0500636_0087596
509 Ga0500637_0161619
510 Ga0501084_0769242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14815

NUDIX_4

NUDIX domain

29

148

0.89

PF00293

NUDIX

NUDIX domain

24

149

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ffu-assembly1.cif.gz_B structure of the rna pyrophosphohydrolase bdrpph in complex with gtp and magnesium 0.9484 7 131
3ees-assembly1.cif.gz_B structure of the rna pyrophosphohydrolase bdrpph 0.9439 6 131
3ef5-assembly1.cif.gz_B structure of the rna pyrophosphohydrolase bdrpph in complex with dgtp 0.9389 7 131
3r03-assembly1.cif.gz_A the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.9364 7 131
3eeu-assembly1.cif.gz_B structure of the rna pyrophosphohydrolase bdrpph in complex with holmium 0.9159 6 136
ID Description Score Start End Superfamily
3eesB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9439 6 131 3.90.79.10
af_Q54BB8_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.908 2 132 3.90.79.10
4dywB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9016 7 129 3.90.79.10
3gwyA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.895 6 130 3.90.79.10
3grnB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8874 5 135 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A7Y6PV56-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) 0.9913 1 135 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
GO:0046872
AF-A0A2M7JM66-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) 0.9897 9 132 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-A0A150P9L4-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) 0.9884 4 124 GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-L0F7R7-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) 0.9875 8 131 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-A0A316S0D5-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) 0.9862 8 131 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716

Map