F365080

General Info

Members Datasets Scaffolds Average Seq Length
254 186 508 122

Family's Representative Sequence

Representative Sequence 3300042005|Ga0439448_0131533|Ga0439448_0131533_318_740
Length 140
Sequence MPGAHGLAPRERIRRRPEFERAYAEGIRLHARFMTVIVVPNSCRHPRLGVAASRKLGAATSRNRAKRLARELFRCHKVGPVFEAQPGLDVVIVPRREMLDAPFAALEADYTRALEQCREGRVRAAARSGRRRNSHAPKGL

Samples

Sample ID Description Type Environment
1 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
113 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
181 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
182 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
183 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
184 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.97
Nodule 0
Rhizoplane 1.57
Rhizosphere 95.28
Stem 0
Stem Tuber 0
Unclassified 33.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439448_0131533 3300042005 Unclassified 863
2 JGI24751J29686_10024384 3300002459 Eukaryota 1255
3 Ga0058859_11796247 3300004798 Unclassified 752
4 Ga0065707_10192811 3300005295 Bacteria 1352
5 Ga0065707_10949471 3300005295 Unclassified 553
6 Ga0070676_10700083 3300005328 Bacteria 740
7 Ga0070676_10738396 3300005328 Unclassified 722
8 Ga0070670_102187564 3300005331 Unclassified 510
9 Ga0070666_10164486 3300005335 Bacteria 1551
10 Ga0070689_100293794 3300005340 Bacteria 1351
11 Ga0070691_10406151 3300005341 Unclassified 768
12 Ga0070687_100552194 3300005343 Unclassified 784
13 Ga0070692_10164794 3300005345 Archaea 1273
14 Ga0070668_100669566 3300005347 Bacteria 913
15 Ga0070675_100451811 3300005354 Bacteria 1152
16 Ga0070674_100000729 3300005356 Bacteria 16759
17 Ga0070674_100504505 3300005356 Bacteria 1008
18 Ga0070673_100068929 3300005364 Bacteria 2833
19 Ga0070673_100085972 3300005364 Bacteria 2562
20 Ga0070673_100763626 3300005364 Bacteria 891
21 Ga0070659_100815835 3300005366 Unclassified 812
22 Ga0070667_100346689 3300005367 Bacteria 1344
23 Ga0070709_10238371 3300005434 Unclassified 1305
24 Ga0070714_100052299 3300005435 Bacteria 3483
25 Ga0070701_10314681 3300005438 Unclassified 967
26 Ga0070700_100471315 3300005441 Unclassified 960
27 Ga0070694_100616508 3300005444 Unclassified 875
28 Ga0070663_101653619 3300005455 Unclassified 572
29 Ga0070678_100059767 3300005456 Bacteria 2802
30 Ga0070662_100141857 3300005457 Bacteria 1863
31 Ga0070662_100393936 3300005457 Unclassified 1142
32 Ga0070685_10259933 3300005466 Bacteria 1154
33 Ga0070672_100807322 3300005543 Unclassified 826
34 Ga0070686_100165310 3300005544 Unclassified 1561
35 Ga0070695_100742301 3300005545 Bacteria 782
36 Ga0070693_100468362 3300005547 Unclassified 888
37 Ga0070693_100595832 3300005547 Bacteria 797
38 Ga0070704_100351163 3300005549 Unclassified 1245
39 Ga0070664_100282193 3300005564 Bacteria 1498
40 Ga0070664_100993177 3300005564 Unclassified 789
41 Ga0068857_100229724 3300005577 Bacteria 1697
42 Ga0068857_100476964 3300005577 Bacteria 1169
43 Ga0068854_100169951 3300005578 Bacteria 1696
44 Ga0068854_101060700 3300005578 Bacteria 720
45 Ga0070702_100275348 3300005615 Unclassified 1153
46 Ga0068859_100550906 3300005617 Bacteria 1248
47 Ga0068864_100163760 3300005618 Bacteria 2023
48 Ga0068864_100316786 3300005618 Bacteria 1464
49 Ga0068866_10694221 3300005718 Unclassified 697
50 Ga0068861_101182250 3300005719 Archaea 739
51 Ga0068863_100267336 3300005841 Bacteria 1654
52 Ga0068858_100143537 3300005842 Unclassified 2242
53 Ga0068862_100114776 3300005844 Bacteria 2368
54 Ga0075368_10050904 3300006042 Bacteria 1646
55 Ga0070715_10051500 3300006163 Bacteria 1772
56 Ga0097621_100000125 3300006237 Bacteria 44370
57 Ga0097621_100013042 3300006237 Bacteria 6179
58 Ga0097621_100014247 3300006237 Bacteria 5947
59 Ga0097621_100638469 3300006237 Unclassified 976
60 Ga0068871_100000134 3300006358 Bacteria 47412
61 Ga0068871_100060654 3300006358 Unclassified 3086
62 Ga0068871_100088270 3300006358 Bacteria 2580
63 Ga0068871_100469128 3300006358 Bacteria 1131
64 Ga0068871_101138689 3300006358 Unclassified 730
65 Ga0075428_100045058 3300006844 Bacteria 4847
66 Ga0075428_100383358 3300006844 Bacteria 1507
67 Ga0075430_100000247 3300006846 Bacteria 37440
68 Ga0075430_100172728 3300006846 Bacteria 1798
69 Ga0075431_100066284 3300006847 Bacteria 3728
70 Ga0075433_10510741 3300006852 Unclassified 1057
71 Ga0075429_100105456 3300006880 Unclassified 2462
72 Ga0075429_100753842 3300006880 Unclassified 853
73 Ga0068865_100365712 3300006881 Bacteria 1172
74 Ga0068865_100412367 3300006881 Bacteria 1109
75 Ga0068865_100701391 3300006881 Unclassified 865
76 Ga0075436_100068409 3300006914 Bacteria 2453
77 Ga0097620_100550909 3300006931 Bacteria 1248
78 Ga0075435_100162619 3300007076 Bacteria 1881
79 Ga0075435_100320050 3300007076 Bacteria 1328
80 Ga0105244_10397710 3300009036 Unclassified 634
81 Ga0105240_10450470 3300009093 Unclassified 1440
82 Ga0111539_10019101 3300009094 Bacteria 8469
83 Ga0111539_10029457 3300009094 Bacteria 6686
84 Ga0111539_10137509 3300009094 Bacteria 2861
85 Ga0105245_13122471 3300009098 Unclassified 513
86 Ga0114129_10004361 3300009147 Bacteria 19964
87 Ga0114129_10008094 3300009147 Bacteria 14980
88 Ga0114129_12147877 3300009147 Bacteria 673
89 Ga0105243_11243075 3300009148 Bacteria 760
90 Ga0105237_10701028 3300009545 Bacteria 1019
91 Ga0105238_10526212 3300009551 Bacteria 1185
92 Ga0105238_11652451 3300009551 Bacteria 671
93 Ga0105249_10124599 3300009553 Bacteria 2452
94 Ga0105249_10164297 3300009553 Bacteria 2148
95 Ga0105249_10450592 3300009553 Unclassified 1326
96 Ga0105246_10918365 3300011119 Bacteria 786
97 Ga0157369_11430177 3300013105 Bacteria 704
98 Ga0157378_10005743 3300013297 Bacteria 10865
99 Ga0157378_10088827 3300013297 Bacteria 2805
100 Ga0157378_11111708 3300013297 Unclassified 828
101 Ga0157375_10134346 3300013308 Bacteria 2596
102 Ga0157375_10607735 3300013308 Bacteria 1252
103 Ga0163163_10671450 3300014325 Bacteria 1100
104 Ga0163163_11321004 3300014325 Unclassified 783
105 Ga0157380_10005597 3300014326 Bacteria 8776
106 Ga0157380_10267610 3300014326 Bacteria 1556
107 Ga0157380_11473964 3300014326 Unclassified 733
108 Ga0157377_11387002 3300014745 Unclassified 553
109 Ga0157379_10289163 3300014968 Bacteria 1492
110 Ga0157379_10962806 3300014968 Unclassified 812
111 Ga0157376_10011019 3300014969 Bacteria 6644
112 Ga0157376_10034588 3300014969 Bacteria 4081
113 Ga0157376_10280428 3300014969 Bacteria 1569
114 Ga0157376_10416635 3300014969 Bacteria 1302
115 Ga0163161_10111653 3300017792 Bacteria 2044
116 Ga0213876_10115038 3300021384 Unclassified 1428
117 Ga0207697_10083985 3300025315 Bacteria 1344
118 Ga0207642_10567501 3300025899 Unclassified 703
119 Ga0207688_10471748 3300025901 Unclassified 784
120 Ga0207680_10007431 3300025903 Bacteria 5341
121 Ga0207680_10426834 3300025903 Unclassified 939
122 Ga0207643_10009170 3300025908 Bacteria 5314
123 Ga0207707_10297019 3300025912 Bacteria 1397
124 Ga0207660_10777317 3300025917 Bacteria 781
125 Ga0207660_11073402 3300025917 Unclassified 656
126 Ga0207649_10270747 3300025920 Bacteria 1231
127 Ga0207652_10135387 3300025921 Bacteria 2200
128 Ga0207681_10010014 3300025923 Bacteria 5803
129 Ga0207681_10108923 3300025923 Bacteria 2012
130 Ga0207681_10576229 3300025923 Unclassified 928
131 Ga0207694_10377922 3300025924 Bacteria 1176
132 Ga0207650_10252366 3300025925 Bacteria 1428
133 Ga0207659_10586076 3300025926 Bacteria 950
134 Ga0207687_10355085 3300025927 Unclassified 1195
135 Ga0207706_10565210 3300025933 Unclassified 978
136 Ga0207709_10726883 3300025935 Unclassified 796
137 Ga0207669_10004028 3300025937 Bacteria 6430
138 Ga0207704_10062686 3300025938 Bacteria 2313
139 Ga0207704_10481298 3300025938 Bacteria 997
140 Ga0207665_10829772 3300025939 Unclassified 731
141 Ga0207691_10088062 3300025940 Bacteria 2785
142 Ga0207711_10062119 3300025941 Unclassified 3222
143 Ga0207689_10062648 3300025942 Bacteria 3059
144 Ga0207689_10443017 3300025942 Unclassified 1085
145 Ga0207651_10018094 3300025960 Bacteria 4184
146 Ga0207651_10603686 3300025960 Bacteria 959
147 Ga0207712_10869495 3300025961 Unclassified 795
148 Ga0207640_10321945 3300025981 Bacteria 1231
149 Ga0207640_11016847 3300025981 Bacteria 730
150 Ga0207658_10538636 3300025986 Bacteria 1044
151 Ga0207703_10149972 3300026035 Bacteria 2032
152 Ga0207708_10212831 3300026075 Bacteria 1546
153 Ga0207708_10408167 3300026075 Bacteria 1125
154 Ga0207708_11079865 3300026075 Unclassified 699
155 Ga0207641_10717394 3300026088 Bacteria 985
156 Ga0207641_11603278 3300026088 Unclassified 653
157 Ga0207648_10065935 3300026089 Bacteria 3157
158 Ga0207648_10362396 3300026089 Unclassified 1308
159 Ga0207676_10073070 3300026095 Bacteria 2759
160 Ga0207675_100078676 3300026118 Bacteria 3090
161 Ga0207675_100179651 3300026118 Bacteria 2026
162 Ga0207683_10025971 3300026121 Bacteria 5056
163 Ga0207698_10719898 3300026142 Bacteria 994
164 Ga0207428_10037856 3300027907 Bacteria 3923
165 Ga0207428_10422725 3300027907 Unclassified 974
166 Ga0268265_10205396 3300028380 Bacteria 1712
167 Ga0265336_10046711 3300028666 Bacteria 1315
168 Ga0265328_10124152 3300031239 Bacteria 964
169 Ga0265314_10032705 3300031711 Bacteria 3822
170 Ga0265342_10230147 3300031712 Bacteria 996
171 Ga0307405_10256853 3300031731 Unclassified 1303
172 Ga0307405_10838272 3300031731 Bacteria 773
173 Ga0307413_10877043 3300031824 Viruses 760
174 Ga0307407_10121783 3300031903 Bacteria 1655
175 Ga0307409_102398091 3300031995 Unclassified 557
176 Ga0307416_100115536 3300032002 Bacteria 2377
177 Ga0307416_100790742 3300032002 Unclassified 1044
178 Ga0307414_10282324 3300032004 Bacteria 1396
179 Ga0307411_10354423 3300032005 Bacteria 1197
180 Ga0307411_10394181 3300032005 Bacteria 1143
181 Ga0373923_0538107 3300035111 Unclassified 572
182 Ga0373932_0051934 3300035112 Unclassified 1219
183 Ga0373955_0656425 3300035172 Bacteria 643
184 Ga0373962_0388689 3300035242 Unclassified 511
185 Ga0373935_0460350 3300035692 Unclassified 920
186 Ga0373937_0358550 3300036401 Bacteria 1382
187 Ga0436365_1476908 3300039437 Bacteria 4860
188 Ga0451576_0384442 3300045051 Unclassified 1471
189 Ga0495592_0184116 3300046454 Bacteria 1420
190 Ga0495603_0588911 3300046455 Unclassified 637
191 Ga0495638_0002550 3300046460 Bacteria 14772
192 Ga0495580_0105895 3300046472 Bacteria 1954
193 Ga0495585_0425819 3300046492 Unclassified 637
194 Ga0495608_0013327 3300046511 Bacteria 5704
195 Ga0495628_0059948 3300046516 Unclassified 2987
196 Ga0495630_0018154 3300046517 Bacteria 5165
197 Ga0495663_0202584 3300046525 Unclassified 693
198 Ga0495587_0023908 3300046536 Unclassified 3751
199 Ga0495598_0005062 3300046537 Bacteria 2897
200 Ga0495598_0011440 3300046537 Bacteria 2152
201 Ga0495645_0026067 3300046543 Bacteria 4242
202 Ga0495622_0326898 3300046557 Unclassified 666
203 Ga0495667_0689011 3300046559 Unclassified 634
204 Ga0495656_0034912 3300046615 Bacteria 2063
205 Ga0495634_0107765 3300046642 Bacteria 1794
206 Ga0495657_0059911 3300046675 Bacteria 2524
207 Ga0495647_0467665 3300046681 Unclassified 585
208 Ga0495669_0017467 3300046684 Bacteria 3080
209 Ga0495669_0181043 3300046684 Bacteria 1005
210 Ga0495669_0186747 3300046684 Unclassified 989
211 Ga0495613_0019397 3300046689 Bacteria 5068
212 Ga0495670_0347319 3300046691 Unclassified 798
213 Ga0495604_0132397 3300047317 Bacteria 1791
214 Ga0495674_0017759 3300047319 Bacteria 6623
215 Ga0495680_0830478 3300047322 Unclassified 602
216 Ga0495681_0325898 3300047470 Unclassified 589
217 Ga0495684_0016032 3300047471 Bacteria 5769
218 Ga0496107_0451828 3300048910 Bacteria 954
219 Ga0496109_0557990 3300048912 Bacteria 1080
220 Ga0496110_0608466 3300048913 Bacteria 991
221 Ga0496114_0323891 3300048917 Bacteria 1362
222 Ga0501034_1188533 3300049571 Bacteria 642
223 Ga0501037_0630530 3300049573 Unclassified 718
224 Ga0501039_0358961 3300049575 Bacteria 1145
225 Ga0501042_0267176 3300049578 Unclassified 1235
226 Ga0501047_0853473 3300049581 Bacteria 724
227 Ga0501075_0558389 3300049591 Unclassified 874
228 Ga0501079_1064328 3300049741 Unclassified 637
229 nmdc:mga04h51_161102_c1 3300050495 Unclassified 863
230 nmdc:mga05p37_251627_c1 3300050507 Bacteria 2119
231 nmdc:mga05p37_70171_c1 3300050507 Bacteria 4310
232 nmdc:mga05p37_8679_c1 3300050507 Bacteria 12009
233 nmdc:mga09592_198727_c1 3300050508 Bacteria 1736
234 nmdc:mga09592_790274_c1 3300050508 Unclassified 803
235 nmdc:mga06r32_91119_c1 3300050510 Bacteria 2979
236 nmdc:mga08y16_18326_c1 3300050511 Bacteria 7377
237 nmdc:mga08y16_397077_c1 3300050511 Bacteria 1412
238 nmdc:mga0n895_116761_c1 3300050512 Bacteria 2687
239 nmdc:mga0rr50_320086_c1 3300050513 Bacteria 1300
240 nmdc:mga0rr50_456112_c1 3300050513 Bacteria 1084
241 nmdc:mga0rr50_9174_c1 3300050513 Bacteria 6202
242 nmdc:mga0a205_316978_c1 3300050515 Unclassified 1431
243 Ga0495601_0003358 3300053077 Bacteria 9163
244 Ga0495612_0151628 3300053078 Bacteria 1009
245 Ga0495595_0036316 3300053084 Bacteria 2236
246 Ga0495619_0003172 3300053085 Bacteria 10651
247 Ga0500646_0185786 3300053090 Unclassified 707
248 Ga0500592_028035 3300053116 Bacteria 908
249 Ga0500658_0469331 3300053134 Unclassified 572
250 Ga0590071_000480 3300059421 Bacteria 11665
251 Ga0590074_000418 3300059423 Bacteria 6134
252 Ga0590075_000728 3300059424 Bacteria 8744
253 Ga0590077_000341 3300059426 Bacteria 13241
254 Ga0590077_013103 3300059426 Bacteria 1723
255 Ga0439448_0131533
256 JGI24751J29686_10024384
257 Ga0058859_11796247
258 Ga0065707_10192811
259 Ga0065707_10949471
260 Ga0070676_10700083
261 Ga0070676_10738396
262 Ga0070670_102187564
263 Ga0070666_10164486
264 Ga0070689_100293794
265 Ga0070691_10406151
266 Ga0070687_100552194
267 Ga0070692_10164794
268 Ga0070668_100669566
269 Ga0070675_100451811
270 Ga0070674_100000729
271 Ga0070674_100504505
272 Ga0070673_100068929
273 Ga0070673_100085972
274 Ga0070673_100763626
275 Ga0070659_100815835
276 Ga0070667_100346689
277 Ga0070709_10238371
278 Ga0070714_100052299
279 Ga0070701_10314681
280 Ga0070700_100471315
281 Ga0070694_100616508
282 Ga0070663_101653619
283 Ga0070678_100059767
284 Ga0070662_100141857
285 Ga0070662_100393936
286 Ga0070685_10259933
287 Ga0070672_100807322
288 Ga0070686_100165310
289 Ga0070695_100742301
290 Ga0070693_100468362
291 Ga0070693_100595832
292 Ga0070704_100351163
293 Ga0070664_100282193
294 Ga0070664_100993177
295 Ga0068857_100229724
296 Ga0068857_100476964
297 Ga0068854_100169951
298 Ga0068854_101060700
299 Ga0070702_100275348
300 Ga0068859_100550906
301 Ga0068864_100163760
302 Ga0068864_100316786
303 Ga0068866_10694221
304 Ga0068861_101182250
305 Ga0068863_100267336
306 Ga0068858_100143537
307 Ga0068862_100114776
308 Ga0075368_10050904
309 Ga0070715_10051500
310 Ga0097621_100000125
311 Ga0097621_100013042
312 Ga0097621_100014247
313 Ga0097621_100638469
314 Ga0068871_100000134
315 Ga0068871_100060654
316 Ga0068871_100088270
317 Ga0068871_100469128
318 Ga0068871_101138689
319 Ga0075428_100045058
320 Ga0075428_100383358
321 Ga0075430_100000247
322 Ga0075430_100172728
323 Ga0075431_100066284
324 Ga0075433_10510741
325 Ga0075429_100105456
326 Ga0075429_100753842
327 Ga0068865_100365712
328 Ga0068865_100412367
329 Ga0068865_100701391
330 Ga0075436_100068409
331 Ga0097620_100550909
332 Ga0075435_100162619
333 Ga0075435_100320050
334 Ga0105244_10397710
335 Ga0105240_10450470
336 Ga0111539_10019101
337 Ga0111539_10029457
338 Ga0111539_10137509
339 Ga0105245_13122471
340 Ga0114129_10004361
341 Ga0114129_10008094
342 Ga0114129_12147877
343 Ga0105243_11243075
344 Ga0105237_10701028
345 Ga0105238_10526212
346 Ga0105238_11652451
347 Ga0105249_10124599
348 Ga0105249_10164297
349 Ga0105249_10450592
350 Ga0105246_10918365
351 Ga0157369_11430177
352 Ga0157378_10005743
353 Ga0157378_10088827
354 Ga0157378_11111708
355 Ga0157375_10134346
356 Ga0157375_10607735
357 Ga0163163_10671450
358 Ga0163163_11321004
359 Ga0157380_10005597
360 Ga0157380_10267610
361 Ga0157380_11473964
362 Ga0157377_11387002
363 Ga0157379_10289163
364 Ga0157379_10962806
365 Ga0157376_10011019
366 Ga0157376_10034588
367 Ga0157376_10280428
368 Ga0157376_10416635
369 Ga0163161_10111653
370 Ga0213876_10115038
371 Ga0207697_10083985
372 Ga0207642_10567501
373 Ga0207688_10471748
374 Ga0207680_10007431
375 Ga0207680_10426834
376 Ga0207643_10009170
377 Ga0207707_10297019
378 Ga0207660_10777317
379 Ga0207660_11073402
380 Ga0207649_10270747
381 Ga0207652_10135387
382 Ga0207681_10010014
383 Ga0207681_10108923
384 Ga0207681_10576229
385 Ga0207694_10377922
386 Ga0207650_10252366
387 Ga0207659_10586076
388 Ga0207687_10355085
389 Ga0207706_10565210
390 Ga0207709_10726883
391 Ga0207669_10004028
392 Ga0207704_10062686
393 Ga0207704_10481298
394 Ga0207665_10829772
395 Ga0207691_10088062
396 Ga0207711_10062119
397 Ga0207689_10062648
398 Ga0207689_10443017
399 Ga0207651_10018094
400 Ga0207651_10603686
401 Ga0207712_10869495
402 Ga0207640_10321945
403 Ga0207640_11016847
404 Ga0207658_10538636
405 Ga0207703_10149972
406 Ga0207708_10212831
407 Ga0207708_10408167
408 Ga0207708_11079865
409 Ga0207641_10717394
410 Ga0207641_11603278
411 Ga0207648_10065935
412 Ga0207648_10362396
413 Ga0207676_10073070
414 Ga0207675_100078676
415 Ga0207675_100179651
416 Ga0207683_10025971
417 Ga0207698_10719898
418 Ga0207428_10037856
419 Ga0207428_10422725
420 Ga0268265_10205396
421 Ga0265336_10046711
422 Ga0265328_10124152
423 Ga0265314_10032705
424 Ga0265342_10230147
425 Ga0307405_10256853
426 Ga0307405_10838272
427 Ga0307413_10877043
428 Ga0307407_10121783
429 Ga0307409_102398091
430 Ga0307416_100115536
431 Ga0307416_100790742
432 Ga0307414_10282324
433 Ga0307411_10354423
434 Ga0307411_10394181
435 Ga0373923_0538107
436 Ga0373932_0051934
437 Ga0373955_0656425
438 Ga0373962_0388689
439 Ga0373935_0460350
440 Ga0373937_0358550
441 Ga0436365_1476908
442 Ga0451576_0384442
443 Ga0495592_0184116
444 Ga0495603_0588911
445 Ga0495638_0002550
446 Ga0495580_0105895
447 Ga0495585_0425819
448 Ga0495608_0013327
449 Ga0495628_0059948
450 Ga0495630_0018154
451 Ga0495663_0202584
452 Ga0495587_0023908
453 Ga0495598_0005062
454 Ga0495598_0011440
455 Ga0495645_0026067
456 Ga0495622_0326898
457 Ga0495667_0689011
458 Ga0495656_0034912
459 Ga0495634_0107765
460 Ga0495657_0059911
461 Ga0495647_0467665
462 Ga0495669_0017467
463 Ga0495669_0181043
464 Ga0495669_0186747
465 Ga0495613_0019397
466 Ga0495670_0347319
467 Ga0495604_0132397
468 Ga0495674_0017759
469 Ga0495680_0830478
470 Ga0495681_0325898
471 Ga0495684_0016032
472 Ga0496107_0451828
473 Ga0496109_0557990
474 Ga0496110_0608466
475 Ga0496114_0323891
476 Ga0501034_1188533
477 Ga0501037_0630530
478 Ga0501039_0358961
479 Ga0501042_0267176
480 Ga0501047_0853473
481 Ga0501075_0558389
482 Ga0501079_1064328
483 nmdc:mga04h51_161102_c1
484 nmdc:mga05p37_251627_c1
485 nmdc:mga05p37_70171_c1
486 nmdc:mga05p37_8679_c1
487 nmdc:mga09592_198727_c1
488 nmdc:mga09592_790274_c1
489 nmdc:mga06r32_91119_c1
490 nmdc:mga08y16_18326_c1
491 nmdc:mga08y16_397077_c1
492 nmdc:mga0n895_116761_c1
493 nmdc:mga0rr50_320086_c1
494 nmdc:mga0rr50_456112_c1
495 nmdc:mga0rr50_9174_c1
496 nmdc:mga0a205_316978_c1
497 Ga0495601_0003358
498 Ga0495612_0151628
499 Ga0495595_0036316
500 Ga0495619_0003172
501 Ga0500646_0185786
502 Ga0500592_028035
503 Ga0500658_0469331
504 Ga0590071_000480
505 Ga0590074_000418
506 Ga0590075_000728
507 Ga0590077_000341
508 Ga0590077_013103

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00825

Ribonuclease_P

Ribonuclease P

7

118

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a6f-assembly1.cif.gz_A rnase p protein from bacillus subtilis 0.8757 6 122
6d1r-assembly1.cif.gz_A structure of staphylococcus aureus rnase p protein at 2.0 angstrom 0.859 11 117
6ov1-assembly1.cif.gz_A structure of staphylococcus aureus rnase p protein mutant with defective mrna degradation activity 0.8546 10 122
1a6f-assembly1.cif.gz_A rnase p protein from bacillus subtilis 0.8469 6 122
7uo5-assembly1.cif.gz_A e.coli rnasep holoenzyme with mg2+ 0.8424 4 116
ID Description Score Start End Superfamily
1a6fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8757 6 122 3.30.230.10
6d1rA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.859 11 117 3.30.230.10
1a6fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8469 6 122 3.30.230.10
af_P9WGZ3_1_112_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8453 7 115 3.30.230.10
1nz0C00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8179 13 116 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A6N7AYH7-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9564 7 117 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-A0A3N5PSJ1-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9515 12 119 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-A0A356IH82-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9495 7 120 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-A0A523DFZ1-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9393 1 121 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-R6H467-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9374 7 114 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781

Map