F364802

General Info

Members Datasets Scaffolds Average Seq Length
254 168 508 98

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10042296|Ga0105244_100422962
Length 108
Sequence VEEETEMSRITHMVTFTLYAGKDTAESEVFLNESKEALAEIPGVEHFQVLRQVSAKNEFDYGFSMEFADQAAYDAYNDHPVHRQYVAERWEKEVSRFQEIDFMKHNGE

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
45 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
48 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
67 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
82 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
83 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
84 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
85 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
86 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
87 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
88 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
89 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
90 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
91 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
92 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
93 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
96 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
97 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
103 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
104 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
105 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
135 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
140 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
141 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
142 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
143 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
144 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
145 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
146 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
147 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
148 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
149 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
150 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
151 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
152 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
153 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
157 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
158 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
159 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
160 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
161 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
162 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
163 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
164 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
165 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
166 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
167 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
168 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.88
Metatranscriptomes 0
Isolates 5.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.17
Nodule 0
Rhizoplane 3.15
Rhizosphere 68.9
Stem 0
Stem Tuber 0
Unclassified 6.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10042296 3300009036 Bacteria 2356
2 JGI25162J39368_1007158 3300002737 Bacteria 1783
3 JGI25406J46586_10012845 3300003203 Bacteria 3617
4 JGI25165J46597_1003937 3300003214 Bacteria 3412
5 Ga0055530_10091398 3300003791 Bacteria 623
6 Ga0055531_10008576 3300003794 Bacteria 5364
7 Ga0055541_1008638 3300003841 Bacteria 1614
8 Ga0065704_10033247 3300005289 Bacteria 1159
9 Ga0065704_10241233 3300005289 Bacteria 1014
10 Ga0065707_10031785 3300005295 Bacteria 1284
11 Ga0065707_10812814 3300005295 Unclassified 595
12 Ga0070676_10974095 3300005328 Unclassified 635
13 Ga0070682_100865180 3300005337 Bacteria 740
14 Ga0068868_100451379 3300005338 Bacteria 1118
15 Ga0070668_100146814 3300005347 Bacteria 1904
16 Ga0070669_100057572 3300005353 Bacteria 2852
17 Ga0070674_100007201 3300005356 Bacteria 6547
18 Ga0070667_100264129 3300005367 Bacteria 1542
19 Ga0070663_100484686 3300005455 Unclassified 1024
20 Ga0070678_101093413 3300005456 Bacteria 736
21 Ga0070698_101612581 3300005471 Bacteria 601
22 Ga0070686_100985368 3300005544 Bacteria 690
23 Ga0070695_101199992 3300005545 Bacteria 624
24 Ga0070665_100010479 3300005548 Bacteria 9378
25 Ga0070665_100064907 3300005548 Bacteria 3662
26 Ga0070665_101113324 3300005548 Bacteria 801
27 Ga0070665_101529729 3300005548 Bacteria 675
28 Ga0068866_10218693 3300005718 Bacteria 1148
29 Ga0068861_100029720 3300005719 Bacteria 4000
30 Ga0068862_100105172 3300005844 Bacteria 2474
31 Ga0068862_102754824 3300005844 Unclassified 503
32 Ga0081455_10358803 3300005937 Bacteria 1025
33 Ga0081455_10987153 3300005937 Bacteria 521
34 Ga0081538_10016947 3300005981 Bacteria 5558
35 Ga0081540_1041326 3300005983 Bacteria 2392
36 Ga0081539_10000410 3300005985 Bacteria 91484
37 Ga0075365_10018442 3300006038 Bacteria 4290
38 Ga0075365_10881214 3300006038 Bacteria 631
39 Ga0075364_10332063 3300006051 Bacteria 1036
40 Ga0075433_11041682 3300006852 Bacteria 712
41 Ga0105244_10031163 3300009036 Bacteria 2830
42 Ga0111539_10000331 3300009094 Bacteria 57983
43 Ga0111539_10456627 3300009094 Bacteria 1488
44 Ga0114129_10706740 3300009147 Unclassified 1295
45 Ga0105248_12450953 3300009177 Bacteria 594
46 Ga0105237_10001177 3300009545 Bacteria 34962
47 Ga0105237_10383986 3300009545 Bacteria 1409
48 Ga0105249_10518705 3300009553 Bacteria 1239
49 Ga0105249_12257785 3300009553 Bacteria 617
50 Ga0105035_118060 3300009988 Bacteria 661
51 Ga0105239_10002739 3300010375 Bacteria 22132
52 Ga0157373_11270794 3300013100 Unclassified 556
53 Ga0157373_11482404 3300013100 Bacteria 517
54 Ga0163162_10613283 3300013306 Bacteria 1214
55 Ga0157375_10364008 3300013308 Unclassified 1612
56 Ga0157380_10395974 3300014326 Bacteria 1309
57 Ga0157380_10495775 3300014326 Bacteria 1185
58 Ga0182005_1065148 3300015265 Bacteria 997
59 Ga0209566_100839 3300025225 Bacteria 15366
60 Ga0209437_100657 3300025233 Bacteria 19555
61 Ga0209233_1004244 3300025261 Bacteria 4906
62 Ga0209025_1071764 3300025294 Bacteria 1225
63 Ga0209025_1073669 3300025294 Bacteria 1197
64 Ga0209025_1083763 3300025294 Bacteria 1071
65 Ga0209050_1006630 3300025298 Bacteria 6785
66 Ga0209050_1052347 3300025298 Bacteria 1023
67 Ga0209257_1000239 3300025304 Bacteria 128383
68 Ga0207655_1024488 3300025728 Bacteria 2956
69 Ga0207655_1069065 3300025728 Bacteria 1322
70 Ga0207682_10486859 3300025893 Bacteria 584
71 Ga0207671_10000820 3300025914 Bacteria 39374
72 Ga0207681_10047795 3300025923 Bacteria 2885
73 Ga0207686_11814599 3300025934 Unclassified 505
74 Ga0207704_10049710 3300025938 Bacteria 2525
75 Ga0207711_11405934 3300025941 Bacteria 640
76 Ga0207712_10354741 3300025961 Bacteria 1220
77 Ga0207668_10201887 3300025972 Bacteria 1584
78 Ga0207668_10991597 3300025972 Bacteria 750
79 Ga0207658_10593846 3300025986 Bacteria 994
80 Ga0207675_100021210 3300026118 Bacteria 6051
81 Ga0207683_10650869 3300026121 Bacteria 976
82 Ga0207428_10000208 3300027907 Bacteria 81781
83 Ga0268266_10002043 3300028379 Bacteria 22400
84 Ga0268266_10035412 3300028379 Bacteria 4246
85 Ga0268266_10979205 3300028379 Bacteria 818
86 Ga0268266_11286297 3300028379 Unclassified 707
87 Ga0268265_10111618 3300028380 Bacteria 2233
88 Ga0307517_10402637 3300028786 Bacteria 724
89 Ga0307512_10467511 3300030522 Unclassified 503
90 Ga0265327_10066610 3300031251 Bacteria 1817
91 Ga0307513_10053101 3300031456 Bacteria 4359
92 Ga0307513_10734067 3300031456 Unclassified 693
93 Ga0307408_100587900 3300031548 Bacteria 987
94 Ga0307516_10446930 3300031730 Bacteria 949
95 Ga0307405_11339292 3300031731 Bacteria 624
96 Ga0307413_10708775 3300031824 Bacteria 837
97 Ga0307406_11224672 3300031901 Bacteria 653
98 Ga0307407_10242707 3300031903 Bacteria 1230
99 Ga0307412_10635298 3300031911 Bacteria 909
100 Ga0307416_103644096 3300032002 Bacteria 516
101 Ga0307416_103878892 3300032002 Bacteria 501
102 Ga0307414_10053513 3300032004 Bacteria 2816
103 Ga0307414_10158640 3300032004 Bacteria 1794
104 Ga0307414_10498766 3300032004 Bacteria 1077
105 Ga0307414_11130657 3300032004 Bacteria 724
106 Ga0307415_100195599 3300032126 Bacteria 1600
107 Ga0373927_0856356 3300035695 Bacteria 600
108 Ga0439465_0025310 3300041413 Bacteria 1872
109 Ga0439465_0045728 3300041413 Bacteria 1424
110 Ga0451789_0623562 3300041443 Bacteria 1077
111 Ga0451791_0648444 3300041451 Bacteria 759
112 Ga0451791_1250620 3300041451 Bacteria 675
113 Ga0451791_1556269 3300041451 Bacteria 561
114 Ga0451797_0088944 3300041453 Bacteria 1238
115 Ga0451797_0134469 3300041453 Unclassified 1040
116 Ga0451807_1469395 3300041486 Bacteria 993
117 Ga0451833_0962979 3300041491 Bacteria 533
118 Ga0451835_0834198 3300041492 Bacteria 649
119 Ga0451837_0085865 3300041494 Unclassified 509
120 Ga0451837_0235003 3300041494 Bacteria 570
121 Ga0451845_0837069 3300041501 Bacteria 500
122 Ga0451849_0378056 3300041505 Bacteria 816
123 Ga0451853_3366021 3300041512 Bacteria 587
124 Ga0439434_0061469 3300042435 Bacteria 1175
125 Ga0450901_036044 3300042533 Bacteria 552
126 Ga0466972_0025807 3300044658 Bacteria 2911
127 Ga0495638_0037557 3300046460 Bacteria 3080
128 Ga0495598_0265128 3300046537 Unclassified 640
129 Ga0495656_0179037 3300046615 Bacteria 1041
130 Ga0496111_0073240 3300048914 Bacteria 2494
131 Ga0496116_0009011 3300048919 Bacteria 8574
132 Ga0496116_0457941 3300048919 Bacteria 544
133 Ga0496117_0411639 3300048920 Bacteria 679
134 Ga0496121_0106300 3300048924 Bacteria 2151
135 Ga0496121_0134517 3300048924 Bacteria 1844
136 Ga0496121_0431045 3300048924 Unclassified 855
137 Ga0496122_0145621 3300048925 Bacteria 1472
138 Ga0496123_0374582 3300048926 Bacteria 655
139 Ga0496124_0009582 3300048927 Bacteria 9937
140 Ga0496124_0144211 3300048927 Bacteria 1876
141 Ga0496124_0151031 3300048927 Bacteria 1822
142 Ga0496124_0966031 3300048927 Bacteria 511
143 Ga0496125_0000989 3300048928 Bacteria 44313
144 Ga0496125_0009006 3300048928 Bacteria 10344
145 Ga0496125_0393282 3300048928 Bacteria 813
146 Ga0496125_0627841 3300048928 Bacteria 582
147 Ga0496126_0015909 3300048929 Bacteria 7553
148 Ga0496126_0250119 3300048929 Bacteria 1477
149 Ga0496126_1199286 3300048929 Unclassified 558
150 Ga0501031_0024571 3300049568 Bacteria 3927
151 Ga0501031_0037797 3300049568 Bacteria 3151
152 Ga0501032_0001730 3300049569 Bacteria 17269
153 Ga0501033_0018009 3300049570 Bacteria 5333
154 Ga0501033_0065273 3300049570 Bacteria 2678
155 Ga0501034_0001979 3300049571 Bacteria 25958
156 Ga0501034_0088465 3300049571 Bacteria 3095
157 Ga0501034_0257223 3300049571 Bacteria 1689
158 Ga0501034_0333960 3300049571 Bacteria 1447
159 Ga0501034_0744445 3300049571 Bacteria 876
160 Ga0501034_1478158 3300049571 Bacteria 553
161 Ga0501034_1482170 3300049571 Bacteria 552
162 Ga0501036_0022807 3300049572 Bacteria 5270
163 Ga0501036_0275009 3300049572 Bacteria 1410
164 Ga0501037_0068945 3300049573 Bacteria 2575
165 Ga0501037_0213319 3300049573 Bacteria 1360
166 Ga0501038_0036829 3300049574 Bacteria 4293
167 Ga0501038_0049366 3300049574 Bacteria 3638
168 Ga0501038_1212249 3300049574 Bacteria 548
169 Ga0501039_0264572 3300049575 Bacteria 1351
170 Ga0501042_0002671 3300049578 Bacteria 10979
171 Ga0501043_0035572 3300049579 Bacteria 3917
172 Ga0501046_0119674 3300049580 Bacteria 2004
173 Ga0501046_0236599 3300049580 Bacteria 1348
174 Ga0501047_0017303 3300049581 Bacteria 6903
175 Ga0501047_0072254 3300049581 Bacteria 3321
176 Ga0501047_0197274 3300049581 Bacteria 1874
177 Ga0501047_0783704 3300049581 Bacteria 768
178 Ga0501047_0925522 3300049581 Bacteria 685
179 Ga0501047_1180632 3300049581 Bacteria 579
180 Ga0501048_0006355 3300049582 Bacteria 8982
181 Ga0501067_0042690 3300049583 Bacteria 2518
182 Ga0501067_0080323 3300049583 Bacteria 1808
183 Ga0501067_0383666 3300049583 Bacteria 783
184 Ga0501067_0634587 3300049583 Bacteria 599
185 Ga0501068_0071240 3300049584 Bacteria 2122
186 Ga0501068_0159794 3300049584 Bacteria 1420
187 Ga0501069_0005987 3300049585 Bacteria 6345
188 Ga0501069_0006900 3300049585 Bacteria 5935
189 Ga0501069_0070215 3300049585 Bacteria 1962
190 Ga0501070_0009102 3300049586 Bacteria 8397
191 Ga0501070_0053645 3300049586 Bacteria 3343
192 Ga0501070_0194431 3300049586 Bacteria 1666
193 Ga0501070_0544623 3300049586 Bacteria 929
194 Ga0501071_0021753 3300049587 Bacteria 4470
195 Ga0501072_0162910 3300049588 Bacteria 1779
196 Ga0501073_0015905 3300049589 Bacteria 5452
197 Ga0501073_0036359 3300049589 Bacteria 3499
198 Ga0501073_0193480 3300049589 Bacteria 1407
199 Ga0501074_0001006 3300049590 Bacteria 18306
200 Ga0501074_0022436 3300049590 Bacteria 4586
201 Ga0501079_0074809 3300049741 Bacteria 2619
202 Ga0501080_0055686 3300049742 Bacteria 3683
203 Ga0501080_0305023 3300049742 Bacteria 1443
204 Ga0501080_0967349 3300049742 Bacteria 739
205 Ga0501083_0001543 3300049744 Bacteria 15751
206 Ga0501083_0038807 3300049744 Bacteria 3236
207 Ga0501083_0300211 3300049744 Bacteria 1044
208 Ga0501083_0995742 3300049744 Bacteria 545
209 Ga0501035_0014973 3300049822 Bacteria 7156
210 Ga0501035_0123430 3300049822 Bacteria 2262
211 Ga0501035_0739463 3300049822 Bacteria 790
212 Ga0501044_0037294 3300049823 Bacteria 5081
213 Ga0501044_0346715 3300049823 Bacteria 1405
214 Ga0501045_0005304 3300049824 Bacteria 8932
215 nmdc:mga00v17_223422_c1 3300050491 Bacteria 1219
216 nmdc:mga0yw44_11553_c1 3300050492 Bacteria 4565
217 nmdc:mga0yw44_150999_c1 3300050492 Bacteria 1515
218 nmdc:mga05p37_697009_c1 3300050507 Bacteria 1129
219 nmdc:mga08y16_35_c1 3300050511 Bacteria 157578
220 nmdc:mga08y16_559385_c1 3300050511 Bacteria 1157
221 nmdc:mga0a205_678105_c1 3300050515 Bacteria 881
222 Ga0500644_0391675 3300053088 Unclassified 605
223 Ga0500555_003348 3300053103 Bacteria 4568
224 Ga0500556_0088994 3300053104 Bacteria 1177
225 Ga0500595_008905 3300053119 Bacteria 4077
226 Ga0500597_422298 3300053120 Bacteria 502
227 Ga0500655_074042 3300053133 Bacteria 696
228 Ga0500658_0007535 3300053134 Bacteria 4023
229 Ga0500568_0000052 3300053139 Bacteria 112079
230 Ga0500568_0238384 3300053139 Bacteria 663
231 Ga0500577_0335849 3300053142 Bacteria 660
232 Ga0500588_0082554 3300053146 Bacteria 1078
233 Ga0500604_0002739 3300053151 Bacteria 4787
234 Ga0500616_0078673 3300053153 Bacteria 1662
235 Ga0500622_0263560 3300053156 Bacteria 750
236 Ga0500634_0000006 3300053161 Bacteria 171639
237 Ga0500645_070128 3300053730 Bacteria 1007
238 Ga0501084_0015463 3300054114 Bacteria 6328
239 Ga0501084_0480237 3300054114 Bacteria 1050
240 Ga0501084_1114418 3300054114 Bacteria 663
241 Ga0501082_0438069 3300060353 Bacteria 1141
242 2643736088 2643221543 Bacteria 6628015
243 2821112730 2821111986 Bacteria 6894338
244 2864736685 2864733723 Bacteria 6770668
245 2885529191 2885526491 Bacteria 7164189
246 2889045980 2889042446 Bacteria 7618936
247 2904164477 2904162308 Bacteria 7086713
248 2904492873 2904490793 Bacteria 7046938
249 2919162154 2919160200 Bacteria 6929020
250 2931389422 2931384279 Bacteria 7299545
251 2939669823 2939669807 Bacteria 5028511
252 2939681228 2939679117 Bacteria 6921672
253 2945991902 2945991243 Bacteria 7008369
254 2946054689 2946053406 Bacteria 6978655
255 Ga0105244_10042296
256 JGI25162J39368_1007158
257 JGI25406J46586_10012845
258 JGI25165J46597_1003937
259 Ga0055530_10091398
260 Ga0055531_10008576
261 Ga0055541_1008638
262 Ga0065704_10033247
263 Ga0065704_10241233
264 Ga0065707_10031785
265 Ga0065707_10812814
266 Ga0070676_10974095
267 Ga0070682_100865180
268 Ga0068868_100451379
269 Ga0070668_100146814
270 Ga0070669_100057572
271 Ga0070674_100007201
272 Ga0070667_100264129
273 Ga0070663_100484686
274 Ga0070678_101093413
275 Ga0070698_101612581
276 Ga0070686_100985368
277 Ga0070695_101199992
278 Ga0070665_100010479
279 Ga0070665_100064907
280 Ga0070665_101113324
281 Ga0070665_101529729
282 Ga0068866_10218693
283 Ga0068861_100029720
284 Ga0068862_100105172
285 Ga0068862_102754824
286 Ga0081455_10358803
287 Ga0081455_10987153
288 Ga0081538_10016947
289 Ga0081540_1041326
290 Ga0081539_10000410
291 Ga0075365_10018442
292 Ga0075365_10881214
293 Ga0075364_10332063
294 Ga0075433_11041682
295 Ga0105244_10031163
296 Ga0111539_10000331
297 Ga0111539_10456627
298 Ga0114129_10706740
299 Ga0105248_12450953
300 Ga0105237_10001177
301 Ga0105237_10383986
302 Ga0105249_10518705
303 Ga0105249_12257785
304 Ga0105035_118060
305 Ga0105239_10002739
306 Ga0157373_11270794
307 Ga0157373_11482404
308 Ga0163162_10613283
309 Ga0157375_10364008
310 Ga0157380_10395974
311 Ga0157380_10495775
312 Ga0182005_1065148
313 Ga0209566_100839
314 Ga0209437_100657
315 Ga0209233_1004244
316 Ga0209025_1071764
317 Ga0209025_1073669
318 Ga0209025_1083763
319 Ga0209050_1006630
320 Ga0209050_1052347
321 Ga0209257_1000239
322 Ga0207655_1024488
323 Ga0207655_1069065
324 Ga0207682_10486859
325 Ga0207671_10000820
326 Ga0207681_10047795
327 Ga0207686_11814599
328 Ga0207704_10049710
329 Ga0207711_11405934
330 Ga0207712_10354741
331 Ga0207668_10201887
332 Ga0207668_10991597
333 Ga0207658_10593846
334 Ga0207675_100021210
335 Ga0207683_10650869
336 Ga0207428_10000208
337 Ga0268266_10002043
338 Ga0268266_10035412
339 Ga0268266_10979205
340 Ga0268266_11286297
341 Ga0268265_10111618
342 Ga0307517_10402637
343 Ga0307512_10467511
344 Ga0265327_10066610
345 Ga0307513_10053101
346 Ga0307513_10734067
347 Ga0307408_100587900
348 Ga0307516_10446930
349 Ga0307405_11339292
350 Ga0307413_10708775
351 Ga0307406_11224672
352 Ga0307407_10242707
353 Ga0307412_10635298
354 Ga0307416_103644096
355 Ga0307416_103878892
356 Ga0307414_10053513
357 Ga0307414_10158640
358 Ga0307414_10498766
359 Ga0307414_11130657
360 Ga0307415_100195599
361 Ga0373927_0856356
362 Ga0439465_0025310
363 Ga0439465_0045728
364 Ga0451789_0623562
365 Ga0451791_0648444
366 Ga0451791_1250620
367 Ga0451791_1556269
368 Ga0451797_0088944
369 Ga0451797_0134469
370 Ga0451807_1469395
371 Ga0451833_0962979
372 Ga0451835_0834198
373 Ga0451837_0085865
374 Ga0451837_0235003
375 Ga0451845_0837069
376 Ga0451849_0378056
377 Ga0451853_3366021
378 Ga0439434_0061469
379 Ga0450901_036044
380 Ga0466972_0025807
381 Ga0495638_0037557
382 Ga0495598_0265128
383 Ga0495656_0179037
384 Ga0496111_0073240
385 Ga0496116_0009011
386 Ga0496116_0457941
387 Ga0496117_0411639
388 Ga0496121_0106300
389 Ga0496121_0134517
390 Ga0496121_0431045
391 Ga0496122_0145621
392 Ga0496123_0374582
393 Ga0496124_0009582
394 Ga0496124_0144211
395 Ga0496124_0151031
396 Ga0496124_0966031
397 Ga0496125_0000989
398 Ga0496125_0009006
399 Ga0496125_0393282
400 Ga0496125_0627841
401 Ga0496126_0015909
402 Ga0496126_0250119
403 Ga0496126_1199286
404 Ga0501031_0024571
405 Ga0501031_0037797
406 Ga0501032_0001730
407 Ga0501033_0018009
408 Ga0501033_0065273
409 Ga0501034_0001979
410 Ga0501034_0088465
411 Ga0501034_0257223
412 Ga0501034_0333960
413 Ga0501034_0744445
414 Ga0501034_1478158
415 Ga0501034_1482170
416 Ga0501036_0022807
417 Ga0501036_0275009
418 Ga0501037_0068945
419 Ga0501037_0213319
420 Ga0501038_0036829
421 Ga0501038_0049366
422 Ga0501038_1212249
423 Ga0501039_0264572
424 Ga0501042_0002671
425 Ga0501043_0035572
426 Ga0501046_0119674
427 Ga0501046_0236599
428 Ga0501047_0017303
429 Ga0501047_0072254
430 Ga0501047_0197274
431 Ga0501047_0783704
432 Ga0501047_0925522
433 Ga0501047_1180632
434 Ga0501048_0006355
435 Ga0501067_0042690
436 Ga0501067_0080323
437 Ga0501067_0383666
438 Ga0501067_0634587
439 Ga0501068_0071240
440 Ga0501068_0159794
441 Ga0501069_0005987
442 Ga0501069_0006900
443 Ga0501069_0070215
444 Ga0501070_0009102
445 Ga0501070_0053645
446 Ga0501070_0194431
447 Ga0501070_0544623
448 Ga0501071_0021753
449 Ga0501072_0162910
450 Ga0501073_0015905
451 Ga0501073_0036359
452 Ga0501073_0193480
453 Ga0501074_0001006
454 Ga0501074_0022436
455 Ga0501079_0074809
456 Ga0501080_0055686
457 Ga0501080_0305023
458 Ga0501080_0967349
459 Ga0501083_0001543
460 Ga0501083_0038807
461 Ga0501083_0300211
462 Ga0501083_0995742
463 Ga0501035_0014973
464 Ga0501035_0123430
465 Ga0501035_0739463
466 Ga0501044_0037294
467 Ga0501044_0346715
468 Ga0501045_0005304
469 nmdc:mga00v17_223422_c1
470 nmdc:mga0yw44_11553_c1
471 nmdc:mga0yw44_150999_c1
472 nmdc:mga05p37_697009_c1
473 nmdc:mga08y16_35_c1
474 nmdc:mga08y16_559385_c1
475 nmdc:mga0a205_678105_c1
476 Ga0500644_0391675
477 Ga0500555_003348
478 Ga0500556_0088994
479 Ga0500595_008905
480 Ga0500597_422298
481 Ga0500655_074042
482 Ga0500658_0007535
483 Ga0500568_0000052
484 Ga0500568_0238384
485 Ga0500577_0335849
486 Ga0500588_0082554
487 Ga0500604_0002739
488 Ga0500616_0078673
489 Ga0500622_0263560
490 Ga0500634_0000006
491 Ga0500645_070128
492 Ga0501084_0015463
493 Ga0501084_0480237
494 Ga0501084_1114418
495 Ga0501082_0438069
496 2643736088
497 2821112730
498 2864736685
499 2885529191
500 2889045980
501 2904164477
502 2904492873
503 2919162154
504 2931389422
505 2939669823
506 2939681228
507 2945991902
508 2946054689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07876

Dabb

Stress responsive A/B Barrel Domain

10

104

0.96

PF03992

ABM

Antibiotic biosynthesis monooxygenase

9

88

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bde-assembly1.cif.gz_A crystal structure of a dabb family protein with a ferredoxin-like fold (mll5499) from mesorhizobium loti maff303099 at 1.79 a resolution 0.9622 1 100
3bde-assembly1.cif.gz_A crystal structure of a dabb family protein with a ferredoxin-like fold (mll5499) from mesorhizobium loti maff303099 at 1.79 a resolution 0.9529 1 100
5b0f-assembly1.cif.gz_B polyketide cyclase oac from cannabis sativa, y72f mutant 0.8709 4 100
5b0g-assembly1.cif.gz_A-2 polyketide cyclase oac from cannabis sativa, h78s mutant 0.8685 4 100
5b09-assembly1.cif.gz_A-2 polyketide cyclase oac from cannabis sativa bound with olivetolic acid 0.8658 5 100
ID Description Score Start End Superfamily
3bdeB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9493 4 100 3.30.70.100
3bdeB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9307 4 100 3.30.70.100
5b0bD00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8637 4 100 3.30.70.100
5b0bD00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8473 4 100 3.30.70.100
5y02I00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8381 2 100 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A268B8S2-F1-model_v4 deleted 0.9926 1 99
AF-A0A2W0CCD4-F1-model_v4 Stress responsive alpha-beta barrel domain-containing protein (EC 4.1.2.13) 0.992 1 99 GO:0004332
AF-A0A6G3ZYF7-F1-model_v4 Dabb family protein 0.9903 2 97
AF-A0A268SKN7-F1-model_v4 deleted 0.9892 1 101
AF-A0A848MBQ7-F1-model_v4 Dabb family protein 0.9871 2 99

Map