F364548

General Info

Members Datasets Scaffolds Average Seq Length
254 105 508 74

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10001942|JGI25406J46586_100019428
Length 74
Sequence MAPMVHGLEAKYFGKIKFTYLDADDPNTVDFQRTLGFYYQPEIYLLDADGNLLQKWVGYTTEDEFETVFAQYVQ

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
76 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
77 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
78 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
79 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
80 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
81 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
82 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
86 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
89 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
90 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
91 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
92 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
93 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
96 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
102 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
103 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
104 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
105 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.39
Rhizosphere 99.61
Stem 0
Stem Tuber 0
Unclassified 35.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001942 3300003203 Bacteria 9765
2 SwRhRL3b_contig_2512913 2162886006 Unclassified 4527
3 SwRhRL2b_contig_2474596 2162886007 Bacteria 5119
4 Ga0065704_10000758 3300005289 Bacteria 19872
5 Ga0065704_10220054 3300005289 Bacteria 1077
6 Ga0065707_10000645 3300005295 Bacteria 23027
7 Ga0065707_10085031 3300005295 Bacteria 6518
8 Ga0065707_10096479 3300005295 Bacteria 3264
9 Ga0065707_10118268 3300005295 Bacteria 2190
10 Ga0065707_10511714 3300005295 Bacteria 749
11 Ga0065707_10526892 3300005295 Bacteria 738
12 Ga0065707_11013808 3300005295 Unclassified 536
13 Ga0070692_11001592 3300005345 Bacteria 584
14 Ga0070692_11337434 3300005345 Bacteria 515
15 Ga0070692_11384006 3300005345 Bacteria 507
16 Ga0070669_100402074 3300005353 Bacteria 1121
17 Ga0070688_101204675 3300005365 Unclassified 608
18 Ga0070701_10610772 3300005438 Unclassified 723
19 Ga0070705_100063574 3300005440 Bacteria 2202
20 Ga0070705_100126327 3300005440 Bacteria 1661
21 Ga0070705_100346154 3300005440 Bacteria 1082
22 Ga0070700_100092847 3300005441 Bacteria 1973
23 Ga0070700_100966328 3300005441 Bacteria 698
24 Ga0070694_100108971 3300005444 Bacteria 1971
25 Ga0070694_100969099 3300005444 Bacteria 705
26 Ga0070694_101003778 3300005444 Bacteria 693
27 Ga0070708_102275942 3300005445 Bacteria 500
28 Ga0068867_100851046 3300005459 Bacteria 817
29 Ga0070706_100055568 3300005467 Bacteria 3655
30 Ga0070706_100371209 3300005467 Bacteria 1333
31 Ga0070706_100503082 3300005467 Bacteria 1127
32 Ga0070706_100988575 3300005467 Unclassified 776
33 Ga0070706_101909087 3300005467 Unclassified 539
34 Ga0070707_100146945 3300005468 Unclassified 2295
35 Ga0070707_100435960 3300005468 Bacteria 1271
36 Ga0070707_101123197 3300005468 Bacteria 752
37 Ga0070707_101427044 3300005468 Bacteria 659
38 Ga0070698_100039499 3300005471 Unclassified 4857
39 Ga0070698_100117678 3300005471 Bacteria 2619
40 Ga0070698_100130404 3300005471 Unclassified 2470
41 Ga0070698_100235660 3300005471 Bacteria 1763
42 Ga0070698_101042584 3300005471 Bacteria 765
43 Ga0070699_100004736 3300005518 Bacteria 12025
44 Ga0070699_100291544 3300005518 Bacteria 1463
45 Ga0070699_100387975 3300005518 Bacteria 1262
46 Ga0070697_101001243 3300005536 Bacteria 743
47 Ga0070695_100090708 3300005545 Bacteria 2040
48 Ga0070695_100621311 3300005545 Bacteria 850
49 Ga0070695_101785379 3300005545 Unclassified 516
50 Ga0070704_100120454 3300005549 Bacteria 2015
51 Ga0070704_100857366 3300005549 Bacteria 815
52 Ga0070704_100927940 3300005549 Bacteria 784
53 Ga0068857_101129848 3300005577 Unclassified 757
54 Ga0068857_101967783 3300005577 Unclassified 573
55 Ga0068859_100046995 3300005617 Bacteria 4335
56 Ga0068859_101045035 3300005617 Unclassified 898
57 Ga0068864_100218999 3300005618 Bacteria 1755
58 Ga0068864_102252656 3300005618 Bacteria 551
59 Ga0068861_100555863 3300005719 Bacteria 1047
60 Ga0068861_101675161 3300005719 Unclassified 628
61 Ga0068870_10078866 3300005840 Unclassified 1815
62 Ga0068870_10158107 3300005840 Bacteria 1341
63 Ga0068870_10954996 3300005840 Bacteria 609
64 Ga0068863_100751421 3300005841 Bacteria 971
65 Ga0068860_102436842 3300005843 Bacteria 543
66 Ga0068862_100042034 3300005844 Bacteria 3891
67 Ga0068862_100351970 3300005844 Bacteria 1367
68 Ga0068862_100399514 3300005844 Bacteria 1285
69 Ga0081539_10006107 3300005985 Bacteria 11747
70 Ga0081539_10019380 3300005985 Bacteria 4660
71 Ga0075428_100056903 3300006844 Bacteria 4281
72 Ga0075428_100375826 3300006844 Unclassified 1523
73 Ga0075428_100546942 3300006844 Unclassified 1238
74 Ga0075428_101224881 3300006844 Unclassified 791
75 Ga0075428_102381178 3300006844 Bacteria 544
76 Ga0075430_100292734 3300006846 Bacteria 1347
77 Ga0075430_100511898 3300006846 Unclassified 990
78 Ga0075431_100047804 3300006847 Bacteria 4412
79 Ga0075431_100070222 3300006847 Bacteria 3613
80 Ga0075431_100568534 3300006847 Bacteria 1120
81 Ga0075431_100665403 3300006847 Unclassified 1021
82 Ga0075431_101456995 3300006847 Unclassified 644
83 Ga0075433_10284463 3300006852 Bacteria 1465
84 Ga0075434_100794463 3300006871 Unclassified 963
85 Ga0075429_100018720 3300006880 Bacteria 5996
86 Ga0075429_100086370 3300006880 Unclassified 2734
87 Ga0075429_100156854 3300006880 Bacteria 1993
88 Ga0075429_100226492 3300006880 Bacteria 1637
89 Ga0075429_100240575 3300006880 Unclassified 1585
90 Ga0075429_100383283 3300006880 Unclassified 1231
91 Ga0075429_100499894 3300006880 Unclassified 1065
92 Ga0075429_101388835 3300006880 Unclassified 612
93 Ga0097620_100046996 3300006931 Bacteria 4335
94 Ga0097620_101045072 3300006931 Unclassified 898
95 Ga0111539_10836371 3300009094 Bacteria 1071
96 Ga0111539_11472288 3300009094 Unclassified 790
97 Ga0105247_11052288 3300009101 Unclassified 639
98 Ga0114129_10019056 3300009147 Bacteria 9775
99 Ga0114129_10024559 3300009147 Bacteria 8539
100 Ga0114129_10066511 3300009147 Bacteria 5028
101 Ga0114129_10114413 3300009147 Bacteria 3720
102 Ga0114129_10151600 3300009147 Bacteria 3172
103 Ga0114129_10823771 3300009147 Bacteria 1182
104 Ga0114129_11445855 3300009147 Unclassified 847
105 Ga0105243_10008165 3300009148 Bacteria 8039
106 Ga0105243_10067740 3300009148 Unclassified 2875
107 Ga0105243_10149089 3300009148 Bacteria 2004
108 Ga0105243_10905363 3300009148 Bacteria 878
109 Ga0105243_11061157 3300009148 Bacteria 816
110 Ga0105242_10885451 3300009176 Bacteria 891
111 Ga0105249_10177284 3300009553 Bacteria 2071
112 Ga0105249_10266513 3300009553 Bacteria 1704
113 Ga0105249_10332654 3300009553 Unclassified 1533
114 Ga0105249_10502777 3300009553 Bacteria 1257
115 Ga0105249_10596968 3300009553 Bacteria 1158
116 Ga0105246_10672718 3300011119 Unclassified 904
117 Ga0105246_10730636 3300011119 Bacteria 871
118 Ga0163163_10346440 3300014325 Bacteria 1541
119 Ga0157380_11092641 3300014326 Bacteria 836
120 Ga0157380_11849526 3300014326 Bacteria 664
121 Ga0207684_10224730 3300025910 Unclassified 1620
122 Ga0207684_10401574 3300025910 Bacteria 1178
123 Ga0207660_10288323 3300025917 Bacteria 1305
124 Ga0207646_10216650 3300025922 Bacteria 1729
125 Ga0207646_11011716 3300025922 Bacteria 734
126 Ga0207687_10576335 3300025927 Bacteria 946
127 Ga0207709_10070234 3300025935 Bacteria 2220
128 Ga0207709_10082113 3300025935 Unclassified 2080
129 Ga0207709_11712771 3300025935 Unclassified 523
130 Ga0207670_11821923 3300025936 Bacteria 517
131 Ga0207712_10374263 3300025961 Bacteria 1190
132 Ga0207712_10472616 3300025961 Bacteria 1067
133 Ga0207712_10506209 3300025961 Unclassified 1033
134 Ga0207712_10669568 3300025961 Bacteria 903
135 Ga0207712_11802596 3300025961 Bacteria 548
136 Ga0207703_10712223 3300026035 Bacteria 955
137 Ga0207708_10077195 3300026075 Bacteria 2556
138 Ga0207708_11402626 3300026075 Unclassified 613
139 Ga0207674_10448907 3300026116 Bacteria 1246
140 Ga0207674_11002192 3300026116 Unclassified 804
141 Ga0207674_11118873 3300026116 Unclassified 757
142 Ga0207675_100989699 3300026118 Bacteria 859
143 Ga0207675_101162114 3300026118 Unclassified 792
144 Ga0209968_1022155 3300027526 Unclassified 1035
145 Ga0207428_11227784 3300027907 Unclassified 521
146 Ga0268265_10279438 3300028380 Bacteria 1493
147 Ga0268265_10323319 3300028380 Unclassified 1398
148 Ga0307408_100202166 3300031548 Bacteria 1609
149 Ga0307408_100383068 3300031548 Bacteria 1203
150 Ga0316579_10074793 3300031691 Bacteria 1609
151 Ga0307405_10121078 3300031731 Bacteria 1791
152 Ga0307413_10114994 3300031824 Bacteria 1810
153 Ga0307413_10260129 3300031824 Bacteria 1293
154 Ga0307410_10076157 3300031852 Bacteria 2341
155 Ga0307406_10044735 3300031901 Bacteria 2776
156 Ga0307406_12127825 3300031901 Bacteria 503
157 Ga0307407_10340225 3300031903 Bacteria 1059
158 Ga0307407_11122964 3300031903 Unclassified 612
159 Ga0307412_10066262 3300031911 Bacteria 2447
160 Ga0307409_100024615 3300031995 Bacteria 4203
161 Ga0307409_100530719 3300031995 Bacteria 1152
162 Ga0307409_101451358 3300031995 Bacteria 713
163 Ga0307409_101737285 3300031995 Bacteria 653
164 Ga0307409_102317021 3300031995 Unclassified 566
165 Ga0307416_100103159 3300032002 Bacteria 2489
166 Ga0307416_100810704 3300032002 Bacteria 1032
167 Ga0307416_101719738 3300032002 Bacteria 732
168 Ga0307414_10472413 3300032004 Bacteria 1104
169 Ga0307411_11221739 3300032005 Bacteria 682
170 Ga0307415_100359777 3300032126 Bacteria 1228
171 Ga0316593_10140268 3300032168 Unclassified 875
172 Ga0373961_0094027 3300035241 Unclassified 962
173 Ga0316582_0100592 3300036647 Unclassified 1914
174 Ga0316582_1003771 3300036647 Unclassified 570
175 Ga0316584_0183947 3300036712 Unclassified 1546
176 Ga0316581_0109718 3300037588 Unclassified 850
177 Ga0451800_0990177 3300041459 Unclassified 795
178 Ga0439434_0249879 3300042435 Unclassified 606
179 Ga0451577_0001808 3300042876 Bacteria 27367
180 Ga0451577_0060760 3300042876 Bacteria 3369
181 Ga0451577_0182441 3300042876 Bacteria 1892
182 Ga0451577_1593895 3300042876 Unclassified 576
183 Ga0453683_0000747 3300044673 Bacteria 32801
184 Ga0453683_0023044 3300044673 Unclassified 3968
185 Ga0453683_0473855 3300044673 Bacteria 811
186 Ga0453683_0727103 3300044673 Bacteria 651
187 Ga0453683_0913911 3300044673 Unclassified 580
188 Ga0453684_0003433 3300044712 Bacteria 35733
189 Ga0453684_0004360 3300044712 Bacteria 30021
190 Ga0453684_0074571 3300044712 Bacteria 4270
191 Ga0453684_0114578 3300044712 Bacteria 3268
192 Ga0453684_0122789 3300044712 Bacteria 3132
193 Ga0453684_0175023 3300044712 Bacteria 2525
194 Ga0453684_0244887 3300044712 Unclassified 2062
195 Ga0453684_0335120 3300044712 Bacteria 1710
196 Ga0453684_0546308 3300044712 Bacteria 1277
197 Ga0453684_0626027 3300044712 Bacteria 1177
198 Ga0453684_0880743 3300044712 Bacteria 960
199 Ga0453684_1100890 3300044712 Bacteria 839
200 Ga0453684_1429049 3300044712 Unclassified 716
201 Ga0453684_1535599 3300044712 Unclassified 686
202 Ga0451576_0115921 3300045051 Bacteria 2789
203 Ga0451576_0183136 3300045051 Bacteria 2187
204 Ga0451576_1033038 3300045051 Bacteria 861
205 Ga0451576_2282306 3300045051 Bacteria 555
206 Ga0501299_198994 3300049522 Unclassified 531
207 Ga0501040_0540647 3300049576 Unclassified 841
208 Ga0501040_1073571 3300049576 Bacteria 584
209 Ga0501041_1076994 3300049577 Unclassified 518
210 Ga0501072_0752705 3300049588 Bacteria 764
211 Ga0501075_0030363 3300049591 Bacteria 4003
212 Ga0501075_0211659 3300049591 Bacteria 1479
213 Ga0501076_0090492 3300049592 Bacteria 2461
214 Ga0501076_1136786 3300049592 Unclassified 643
215 Ga0501233_100871 3300049668 Unclassified 763
216 Ga0501235_214175 3300049669 Unclassified 526
217 Ga0501245_120013 3300049708 Unclassified 553
218 Ga0501080_0027689 3300049742 Bacteria 5270
219 Ga0501080_1131121 3300049742 Unclassified 675
220 Ga0501081_0495921 3300049743 Unclassified 910
221 Ga0501081_0754595 3300049743 Unclassified 731
222 Ga0501081_1253480 3300049743 Unclassified 562
223 Ga0501263_059139 3300049760 Unclassified 598
224 nmdc:mga05p37_10017_c1 3300050507 Bacteria 11250
225 nmdc:mga05p37_1040917_c1 3300050507 Unclassified 865
226 nmdc:mga05p37_122070_c1 3300050507 Bacteria 3200
227 nmdc:mga05p37_1730999_c1 3300050507 Unclassified 607
228 nmdc:mga05p37_220531_c1 3300050507 Bacteria 2289
229 nmdc:mga05p37_2224454_c1 3300050507 Unclassified 508
230 nmdc:mga05p37_9917_c1 3300050507 Bacteria 11303
231 nmdc:mga09592_105515_c1 3300050508 Unclassified 2416
232 nmdc:mga09592_30091_c1 3300050508 Bacteria 4518
233 nmdc:mga09592_39900_c1 3300050508 Unclassified 3944
234 nmdc:mga09592_75228_c1 3300050508 Bacteria 2871
235 nmdc:mga09592_757686_c1 3300050508 Bacteria 823
236 nmdc:mga09592_93509_c1 3300050508 Unclassified 2571
237 nmdc:mga09592_995225_c1 3300050508 Unclassified 701
238 nmdc:mga0qj67_1249994_c1 3300050509 Unclassified 576
239 nmdc:mga0qj67_1365405_c1 3300050509 Unclassified 548
240 nmdc:mga0qj67_347474_c1 3300050509 Unclassified 1199
241 nmdc:mga06r32_1063593_c1 3300050510 Bacteria 759
242 nmdc:mga06r32_1245749_c1 3300050510 Unclassified 689
243 nmdc:mga06r32_590299_c1 3300050510 Unclassified 1082
244 nmdc:mga06r32_813904_c1 3300050510 Unclassified 894
245 nmdc:mga06r32_831473_c1 3300050510 Bacteria 883
246 nmdc:mga0n895_1083379_c1 3300050512 Unclassified 779
247 nmdc:mga0n895_91746_c1 3300050512 Unclassified 3040
248 nmdc:mga0a205_407213_c1 3300050515 Bacteria 1223
249 Ga0501084_0203669 3300054114 Bacteria 1670
250 Ga0501084_0242200 3300054114 Bacteria 1522
251 Ga0501084_1733080 3300054114 Unclassified 522
252 Ga0501082_0489650 3300060353 Unclassified 1075
253 Ga0501082_0599848 3300060353 Bacteria 964
254 Ga0530510_0280699 3300061734 Bacteria 1244
255 JGI25406J46586_10001942
256 SwRhRL3b_contig_2512913
257 SwRhRL2b_contig_2474596
258 Ga0065704_10000758
259 Ga0065704_10220054
260 Ga0065707_10000645
261 Ga0065707_10085031
262 Ga0065707_10096479
263 Ga0065707_10118268
264 Ga0065707_10511714
265 Ga0065707_10526892
266 Ga0065707_11013808
267 Ga0070692_11001592
268 Ga0070692_11337434
269 Ga0070692_11384006
270 Ga0070669_100402074
271 Ga0070688_101204675
272 Ga0070701_10610772
273 Ga0070705_100063574
274 Ga0070705_100126327
275 Ga0070705_100346154
276 Ga0070700_100092847
277 Ga0070700_100966328
278 Ga0070694_100108971
279 Ga0070694_100969099
280 Ga0070694_101003778
281 Ga0070708_102275942
282 Ga0068867_100851046
283 Ga0070706_100055568
284 Ga0070706_100371209
285 Ga0070706_100503082
286 Ga0070706_100988575
287 Ga0070706_101909087
288 Ga0070707_100146945
289 Ga0070707_100435960
290 Ga0070707_101123197
291 Ga0070707_101427044
292 Ga0070698_100039499
293 Ga0070698_100117678
294 Ga0070698_100130404
295 Ga0070698_100235660
296 Ga0070698_101042584
297 Ga0070699_100004736
298 Ga0070699_100291544
299 Ga0070699_100387975
300 Ga0070697_101001243
301 Ga0070695_100090708
302 Ga0070695_100621311
303 Ga0070695_101785379
304 Ga0070704_100120454
305 Ga0070704_100857366
306 Ga0070704_100927940
307 Ga0068857_101129848
308 Ga0068857_101967783
309 Ga0068859_100046995
310 Ga0068859_101045035
311 Ga0068864_100218999
312 Ga0068864_102252656
313 Ga0068861_100555863
314 Ga0068861_101675161
315 Ga0068870_10078866
316 Ga0068870_10158107
317 Ga0068870_10954996
318 Ga0068863_100751421
319 Ga0068860_102436842
320 Ga0068862_100042034
321 Ga0068862_100351970
322 Ga0068862_100399514
323 Ga0081539_10006107
324 Ga0081539_10019380
325 Ga0075428_100056903
326 Ga0075428_100375826
327 Ga0075428_100546942
328 Ga0075428_101224881
329 Ga0075428_102381178
330 Ga0075430_100292734
331 Ga0075430_100511898
332 Ga0075431_100047804
333 Ga0075431_100070222
334 Ga0075431_100568534
335 Ga0075431_100665403
336 Ga0075431_101456995
337 Ga0075433_10284463
338 Ga0075434_100794463
339 Ga0075429_100018720
340 Ga0075429_100086370
341 Ga0075429_100156854
342 Ga0075429_100226492
343 Ga0075429_100240575
344 Ga0075429_100383283
345 Ga0075429_100499894
346 Ga0075429_101388835
347 Ga0097620_100046996
348 Ga0097620_101045072
349 Ga0111539_10836371
350 Ga0111539_11472288
351 Ga0105247_11052288
352 Ga0114129_10019056
353 Ga0114129_10024559
354 Ga0114129_10066511
355 Ga0114129_10114413
356 Ga0114129_10151600
357 Ga0114129_10823771
358 Ga0114129_11445855
359 Ga0105243_10008165
360 Ga0105243_10067740
361 Ga0105243_10149089
362 Ga0105243_10905363
363 Ga0105243_11061157
364 Ga0105242_10885451
365 Ga0105249_10177284
366 Ga0105249_10266513
367 Ga0105249_10332654
368 Ga0105249_10502777
369 Ga0105249_10596968
370 Ga0105246_10672718
371 Ga0105246_10730636
372 Ga0163163_10346440
373 Ga0157380_11092641
374 Ga0157380_11849526
375 Ga0207684_10224730
376 Ga0207684_10401574
377 Ga0207660_10288323
378 Ga0207646_10216650
379 Ga0207646_11011716
380 Ga0207687_10576335
381 Ga0207709_10070234
382 Ga0207709_10082113
383 Ga0207709_11712771
384 Ga0207670_11821923
385 Ga0207712_10374263
386 Ga0207712_10472616
387 Ga0207712_10506209
388 Ga0207712_10669568
389 Ga0207712_11802596
390 Ga0207703_10712223
391 Ga0207708_10077195
392 Ga0207708_11402626
393 Ga0207674_10448907
394 Ga0207674_11002192
395 Ga0207674_11118873
396 Ga0207675_100989699
397 Ga0207675_101162114
398 Ga0209968_1022155
399 Ga0207428_11227784
400 Ga0268265_10279438
401 Ga0268265_10323319
402 Ga0307408_100202166
403 Ga0307408_100383068
404 Ga0316579_10074793
405 Ga0307405_10121078
406 Ga0307413_10114994
407 Ga0307413_10260129
408 Ga0307410_10076157
409 Ga0307406_10044735
410 Ga0307406_12127825
411 Ga0307407_10340225
412 Ga0307407_11122964
413 Ga0307412_10066262
414 Ga0307409_100024615
415 Ga0307409_100530719
416 Ga0307409_101451358
417 Ga0307409_101737285
418 Ga0307409_102317021
419 Ga0307416_100103159
420 Ga0307416_100810704
421 Ga0307416_101719738
422 Ga0307414_10472413
423 Ga0307411_11221739
424 Ga0307415_100359777
425 Ga0316593_10140268
426 Ga0373961_0094027
427 Ga0316582_0100592
428 Ga0316582_1003771
429 Ga0316584_0183947
430 Ga0316581_0109718
431 Ga0451800_0990177
432 Ga0439434_0249879
433 Ga0451577_0001808
434 Ga0451577_0060760
435 Ga0451577_0182441
436 Ga0451577_1593895
437 Ga0453683_0000747
438 Ga0453683_0023044
439 Ga0453683_0473855
440 Ga0453683_0727103
441 Ga0453683_0913911
442 Ga0453684_0003433
443 Ga0453684_0004360
444 Ga0453684_0074571
445 Ga0453684_0114578
446 Ga0453684_0122789
447 Ga0453684_0175023
448 Ga0453684_0244887
449 Ga0453684_0335120
450 Ga0453684_0546308
451 Ga0453684_0626027
452 Ga0453684_0880743
453 Ga0453684_1100890
454 Ga0453684_1429049
455 Ga0453684_1535599
456 Ga0451576_0115921
457 Ga0451576_0183136
458 Ga0451576_1033038
459 Ga0451576_2282306
460 Ga0501299_198994
461 Ga0501040_0540647
462 Ga0501040_1073571
463 Ga0501041_1076994
464 Ga0501072_0752705
465 Ga0501075_0030363
466 Ga0501075_0211659
467 Ga0501076_0090492
468 Ga0501076_1136786
469 Ga0501233_100871
470 Ga0501235_214175
471 Ga0501245_120013
472 Ga0501080_0027689
473 Ga0501080_1131121
474 Ga0501081_0495921
475 Ga0501081_0754595
476 Ga0501081_1253480
477 Ga0501263_059139
478 nmdc:mga05p37_10017_c1
479 nmdc:mga05p37_1040917_c1
480 nmdc:mga05p37_122070_c1
481 nmdc:mga05p37_1730999_c1
482 nmdc:mga05p37_220531_c1
483 nmdc:mga05p37_2224454_c1
484 nmdc:mga05p37_9917_c1
485 nmdc:mga09592_105515_c1
486 nmdc:mga09592_30091_c1
487 nmdc:mga09592_39900_c1
488 nmdc:mga09592_75228_c1
489 nmdc:mga09592_757686_c1
490 nmdc:mga09592_93509_c1
491 nmdc:mga09592_995225_c1
492 nmdc:mga0qj67_1249994_c1
493 nmdc:mga0qj67_1365405_c1
494 nmdc:mga0qj67_347474_c1
495 nmdc:mga06r32_1063593_c1
496 nmdc:mga06r32_1245749_c1
497 nmdc:mga06r32_590299_c1
498 nmdc:mga06r32_813904_c1
499 nmdc:mga06r32_831473_c1
500 nmdc:mga0n895_1083379_c1
501 nmdc:mga0n895_91746_c1
502 nmdc:mga0a205_407213_c1
503 Ga0501084_0203669
504 Ga0501084_0242200
505 Ga0501084_1733080
506 Ga0501082_0489650
507 Ga0501082_0599848
508 Ga0530510_0280699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n2h-assembly1.cif.gz_A-2 structure of d-ornithine/d-lysine decarboxylase from salmonella typhimurium 0.7726 39 57
3erw-assembly1.cif.gz_A crystal structure of stoa from bacillus subtilis 0.6491 26 69
6z3w-assembly1.cif.gz_I human er membrane protein complex 0.6431 32 60
3fk9-assembly1.cif.gz_B crystal structure of mmutator mutt protein from bacillus halodurans 0.6352 38 57
3gkn-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.6298 39 72
ID Description Score Start End Superfamily
af_Q3E7D7_72_193_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.842 42 57 3.30.420.10
af_Q60315_91_229_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8162 42 58 3.30.420.40
af_P75677_1_79_3.30.160.130 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;ykff protein like domains 0.7922 42 60 3.30.160.130
2j1rA00 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7659 42 62 2.60.120.260
af_A0A0R0GKZ3_34_156_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.742 39 60 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A388QSI5-F1-model_v4 Redoxin domain-containing protein 0.8559 39 71
AF-A0A6L4ZQW0-F1-model_v4 Redoxin domain-containing protein 0.8023 38 72
AF-X1P0R6-F1-model_v4 Thioredoxin-like fold domain-containing protein 0.6864 27 72
AF-D1JI92-F1-model_v4 Thioredoxin 0.6463 24 73
AF-A0A1V5F8W2-F1-model_v4 Thioredoxin 0.621 19 72

Map