F364275

General Info

Members Datasets Scaffolds Average Seq Length
253 194 236 255

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0008119|Ga0451577_0008119_7628_8491
Length 287
Sequence VNINEKYHVEQADEPNGPPAAARAFGLGAMKAVILAGGMGTRIAEETHLRPKPMIEIGGQPILWHILKIYASHGIREFIICCGYKGYLIKEYFANYFLHTSDITFDLQANRMEVHQRFAEPWRVTLVDTGQHTGTGGRLLRVADYLRGESDFCFTYGDGVADVDVTALIEHHRRSGLLATITATVPPGRFGALDIDHAAGRVRAYREKPRGDGGVVNGGFFVLKPQVIDLIEGDDTLWEQAPLEQLAAAGQLGVYSHTGFWQPMDTVRDRNHLEQLWAEGRAPWKSW

Samples

Sample ID Description Type Environment
1 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
2 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
3 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
4 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
5 2643221638 Duganella sp. Root336D2 Isolate Unclassified
6 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
7 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
8 2821131069 Duganella sp. 1224 Isolate Unclassified
9 2857564685 Duganella sp. R-74599 Isolate Unclassified
10 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
11 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
15 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
16 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
17 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
86 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
93 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
125 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
128 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
129 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
158 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
190 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
191 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
192 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
194 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.28
Metatranscriptomes 0.4
Isolates 6.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.02
Nodule 2.37
Rhizoplane 6.32
Rhizosphere 64.43
Stem 0
Stem Tuber 0
Unclassified 11.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10031276 3300001979 Bacteria 1719
2 JGI24737J22298_10050167 3300001990 Bacteria 1269
3 JGI25156J39149_1000313 3300002705 Bacteria 32091
4 JGI25154J39366_1000711 3300002738 Bacteria 15124
5 JGI25158J39367_1000009 3300002739 Bacteria 53723
6 JGI25159J45721_1000039 3300002987 Bacteria 69707
7 JGI25159J45721_1000074 3300002987 Bacteria 48266
8 JGI25159J45721_1000778 3300002987 Bacteria 13861
9 JGI25160J50197_1000106 3300003354 Bacteria 80449
10 JGI25161J50226_1000041 3300003374 Bacteria 124485
11 JGI25161J50226_1000115 3300003374 Bacteria 62500
12 Ga0055542_1011516 3300003762 Bacteria 1565
13 Ga0055526_1000076 3300003771 Bacteria 92438
14 Ga0055526_1002128 3300003771 Bacteria 13593
15 Ga0055537_1000295 3300003773 Bacteria 35299
16 Ga0055524_1002721 3300003775 Bacteria 8926
17 Ga0055534_1000047 3300003784 Bacteria 94932
18 Ga0055528_1000049 3300003790 Bacteria 94814
19 Ga0055543_1000092 3300004625 Bacteria 78538
20 Ga0055543_1000094 3300004625 Bacteria 78040
21 Ga0065165_1000434 3300005262 Bacteria 65848
22 Ga0065165_1000492 3300005262 Bacteria 61002
23 Ga0070658_10132651 3300005327 Bacteria 2076
24 Ga0070676_10004431 3300005328 Bacteria 7388
25 Ga0070670_100021991 3300005331 Bacteria 5487
26 Ga0070677_10075155 3300005333 Bacteria 1431
27 Ga0068869_100152137 3300005334 Bacteria 1795
28 Ga0070666_10006119 3300005335 Bacteria 7397
29 Ga0068868_100007691 3300005338 Bacteria 7687
30 Ga0068868_100137339 3300005338 Bacteria 2005
31 Ga0070660_100000537 3300005339 Bacteria 25342
32 Ga0070660_100012177 3300005339 Bacteria 6141
33 Ga0070660_100571151 3300005339 Bacteria 944
34 Ga0070661_100119367 3300005344 Bacteria 1974
35 Ga0070661_100237140 3300005344 Bacteria 1403
36 Ga0070675_100014550 3300005354 Bacteria 6206
37 Ga0070671_100058216 3300005355 Bacteria 3217
38 Ga0070674_100003315 3300005356 Bacteria 9014
39 Ga0070673_100289504 3300005364 Bacteria 1439
40 Ga0070659_100002095 3300005366 Bacteria 14218
41 Ga0070667_100066172 3300005367 Bacteria 3070
42 Ga0070709_10237628 3300005434 Bacteria 1307
43 Ga0070705_100342993 3300005440 Bacteria 1086
44 Ga0070700_100000001 3300005441 Bacteria 346167
45 Ga0070663_100000402 3300005455 Bacteria 22670
46 Ga0070678_100014868 3300005456 Bacteria 4926
47 Ga0070662_100031241 3300005457 Bacteria 3736
48 Ga0068867_100004840 3300005459 Bacteria 9472
49 Ga0070707_100137730 3300005468 Bacteria 2375
50 Ga0070707_100421799 3300005468 Bacteria 1294
51 Ga0070684_100413474 3300005535 Bacteria 1244
52 Ga0068853_100194437 3300005539 Bacteria 1844
53 Ga0070672_100014456 3300005543 Bacteria 5595
54 Ga0070695_100108780 3300005545 Bacteria 1878
55 Ga0068855_100001138 3300005563 Bacteria 32970
56 Ga0068855_100003503 3300005563 Bacteria 19223
57 Ga0068855_100045404 3300005563 Bacteria 5197
58 Ga0070664_100045383 3300005564 Bacteria 3712
59 Ga0068852_100784853 3300005616 Bacteria 966
60 Ga0070712_100068618 3300006175 Bacteria 2527
61 Ga0075366_10001746 3300006195 Bacteria 10934
62 Ga0075366_10022969 3300006195 Bacteria 3633
63 Ga0097621_100008769 3300006237 Bacteria 7305
64 Ga0075370_10023537 3300006353 Bacteria 3393
65 Ga0068871_100017327 3300006358 Bacteria 5447
66 Ga0099823_1000364 3300006944 Bacteria 28802
67 Ga0105244_10000185 3300009036 Bacteria 63288
68 Ga0105250_10002832 3300009092 Bacteria 8498
69 Ga0105240_10024586 3300009093 Bacteria 7935
70 Ga0111539_10000172 3300009094 Bacteria 74842
71 Ga0105248_10058458 3300009177 Bacteria 4331
72 Ga0105248_10343064 3300009177 Bacteria 1681
73 Ga0105237_10059528 3300009545 Bacteria 3821
74 Ga0105237_10088923 3300009545 Bacteria 3078
75 Ga0105238_10027418 3300009551 Bacteria 5804
76 Ga0105239_10008956 3300010375 Bacteria 11325
77 Ga0157373_10022068 3300013100 Bacteria 4620
78 Ga0157373_10025559 3300013100 Bacteria 4270
79 Ga0157371_10019716 3300013102 Bacteria 4966
80 Ga0157370_10023559 3300013104 Bacteria 6110
81 Ga0157369_10635328 3300013105 Bacteria 1101
82 Ga0157374_10109791 3300013296 Bacteria 2652
83 Ga0157374_10616182 3300013296 Bacteria 1096
84 Ga0157378_10008957 3300013297 Bacteria 8713
85 Ga0157378_10198606 3300013297 Bacteria 1896
86 Ga0163162_10083990 3300013306 Bacteria 3259
87 Ga0157372_10348251 3300013307 Bacteria 1726
88 Ga0157375_10017760 3300013308 Bacteria 6431
89 Ga0163163_10337553 3300014325 Bacteria 1562
90 Ga0182008_10081244 3300014497 Bacteria 1595
91 Ga0157376_10087717 3300014969 Bacteria 2686
92 Ga0182006_1025243 3300015261 Bacteria 2442
93 Ga0183362_10005 3300015683 Bacteria 437616
94 Ga0213873_10000018 3300021358 Bacteria 123140
95 Ga0213872_10004417 3300021361 Bacteria 7470
96 Ga0213876_10000058 3300021384 Bacteria 134080
97 Ga0213876_10003656 3300021384 Bacteria 8742
98 Ga0213875_10032138 3300021388 Bacteria 2481
99 Ga0209436_100042 3300025208 Bacteria 73600
100 Ga0209672_100532 3300025228 Bacteria 20804
101 Ga0209759_1000562 3300025256 Bacteria 37533
102 Ga0209759_1030767 3300025256 Bacteria 1055
103 Ga0209565_1000112 3300025263 Bacteria 117209
104 Ga0209673_1000210 3300025273 Bacteria 117276
105 Ga0209130_1000099 3300025284 Bacteria 141717
106 Ga0209130_1000227 3300025284 Bacteria 73760
107 Ga0209675_1000142 3300025291 Bacteria 95327
108 Ga0209564_1000245 3300025295 Bacteria 117378
109 Ga0209050_1000366 3300025298 Bacteria 86616
110 Ga0209256_1000252 3300025299 Bacteria 94936
111 Ga0207426_1000062 3300025302 Bacteria 362040
112 Ga0207655_1002080 3300025728 Bacteria 16796
113 Ga0207680_10003093 3300025903 Bacteria 7817
114 Ga0207647_10065262 3300025904 Bacteria 2210
115 Ga0207645_10006119 3300025907 Bacteria 8646
116 Ga0207705_10041174 3300025909 Bacteria 3314
117 Ga0207695_10011856 3300025913 Bacteria 10512
118 Ga0207657_10001827 3300025919 Bacteria 22959
119 Ga0207646_10375624 3300025922 Bacteria 1284
120 Ga0207694_10026822 3300025924 Bacteria 4386
121 Ga0207659_10068148 3300025926 Bacteria 2587
122 Ga0207644_10091547 3300025931 Bacteria 2268
123 Ga0207690_10000615 3300025932 Bacteria 23019
124 Ga0207706_10009783 3300025933 Bacteria 8797
125 Ga0207669_10019988 3300025937 Bacteria 3500
126 Ga0207691_10000171 3300025940 Bacteria 60451
127 Ga0207711_10498202 3300025941 Bacteria 1135
128 Ga0207667_10000427 3300025949 Bacteria 56780
129 Ga0207667_10003296 3300025949 Bacteria 19914
130 Ga0207667_10050793 3300025949 Bacteria 4374
131 Ga0207651_10249159 3300025960 Bacteria 1452
132 Ga0207677_10001576 3300026023 Bacteria 12068
133 Ga0207639_10522633 3300026041 Bacteria 1087
134 Ga0207678_10006529 3300026067 Bacteria 10340
135 Ga0207648_10029606 3300026089 Bacteria 4856
136 Ga0207683_10007252 3300026121 Bacteria 9501
137 Ga0209389_1000144 3300027296 Bacteria 61045
138 Ga0209489_100625 3300027361 Bacteria 68635
139 Ga0265318_10000013 3300028577 Bacteria 208938
140 Ga0265336_10000147 3300028666 Bacteria 50015
141 Ga0265336_10062909 3300028666 Bacteria 1112
142 Ga0265324_10000090 3300029957 Bacteria 70577
143 Ga0265324_10000381 3300029957 Bacteria 32068
144 Ga0265324_10077337 3300029957 Bacteria 1132
145 Ga0265320_10008077 3300031240 Bacteria 6472
146 Ga0265325_10000271 3300031241 Bacteria 36968
147 Ga0265331_10000024 3300031250 Bacteria 235118
148 Ga0265327_10000079 3300031251 Bacteria 206892
149 Ga0265316_10126239 3300031344 Bacteria 1929
150 Ga0265313_10016554 3300031595 Bacteria 4233
151 Ga0265314_10001603 3300031711 Bacteria 24883
152 Ga0307414_10677457 3300032004 Bacteria 932
153 Ga0307411_10431622 3300032005 Bacteria 1097
154 Ga0373923_0220330 3300035111 Bacteria 882
155 Ga0395899_0017908 3300037312 Bacteria 5391
156 Ga0395899_0139311 3300037312 Bacteria 1727
157 Ga0436364_1397959 3300037853 Bacteria 2605
158 Ga0395901_0265841 3300038443 Bacteria 1785
159 Ga0395901_1298269 3300038443 Bacteria 690
160 Ga0400488_07463 3300038741 Bacteria 1231
161 Ga0436365_0337700 3300039437 Bacteria 40984
162 Ga0436365_1806815 3300039437 Bacteria 14007
163 Ga0436361_0878496 3300039447 Bacteria 34656
164 Ga0436361_1165399 3300039447 Bacteria 929
165 Ga0436362_0011715 3300039453 Bacteria 44760
166 Ga0450911_025665 3300042115 Bacteria 764
167 Ga0451577_0007448 3300042876 Bacteria 10752
168 Ga0451577_0008119 3300042876 Bacteria 10244
169 Ga0451577_0031747 3300042876 Bacteria 4765
170 Ga0451577_0511274 3300042876 Bacteria 1091
171 Ga0466972_0132285 3300044658 Bacteria 1175
172 Ga0453683_0001365 3300044673 Bacteria 21310
173 Ga0453683_0019296 3300044673 Bacteria 4369
174 Ga0453683_0157983 3300044673 Bacteria 1434
175 Ga0453684_0063928 3300044712 Bacteria 4704
176 Ga0453684_0322275 3300044712 Bacteria 1750
177 Ga0453684_0349489 3300044712 Bacteria 1668
178 Ga0466971_0329856 3300044719 Bacteria 736
179 Ga0451576_0000006 3300045051 Bacteria 949698
180 Ga0451576_0000535 3300045051 Bacteria 81918
181 Ga0451576_0000652 3300045051 Bacteria 71674
182 Ga0451576_0000868 3300045051 Bacteria 58132
183 Ga0451576_0003730 3300045051 Bacteria 20605
184 Ga0451576_0005010 3300045051 Bacteria 16830
185 Ga0495627_000004 3300046453 Bacteria 640612
186 Ga0495653_0000066 3300046463 Bacteria 91671
187 Ga0495585_0001745 3300046492 Bacteria 16560
188 Ga0495606_0000063 3300046507 Bacteria 184610
189 Ga0495606_0001879 3300046507 Bacteria 26316
190 Ga0495606_0002100 3300046507 Bacteria 24258
191 Ga0495610_0000647 3300046512 Bacteria 34128
192 Ga0495644_0050658 3300046523 Bacteria 1559
193 Ga0495609_0001180 3300046538 Bacteria 18046
194 Ga0495597_0000069 3300046542 Bacteria 89990
195 Ga0495668_0000152 3300046616 Bacteria 104716
196 Ga0495661_0100320 3300046665 Bacteria 1630
197 Ga0495671_0186972 3300046692 Bacteria 1006
198 Ga0495660_0010827 3300046810 Bacteria 5295
199 Ga0495660_0014570 3300046810 Bacteria 4546
200 Ga0495660_0079751 3300046810 Bacteria 1719
201 Ga0495672_0000125 3300047320 Bacteria 118271
202 Ga0495681_0000895 3300047470 Bacteria 23009
203 Ga0495686_0000860 3300047472 Bacteria 38959
204 Ga0496100_0475768 3300048903 Bacteria 960
205 Ga0496101_0193236 3300048904 Bacteria 1571
206 Ga0496101_0351586 3300048904 Bacteria 1158
207 Ga0496102_0224244 3300048905 Bacteria 1772
208 Ga0496104_0034953 3300048907 Bacteria 4689
209 Ga0496105_0081161 3300048908 Bacteria 2679
210 Ga0496105_0099483 3300048908 Bacteria 2402
211 Ga0496106_0024989 3300048909 Bacteria 4444
212 Ga0496109_0027637 3300048912 Bacteria 5069
213 Ga0496111_0374697 3300048914 Bacteria 1053
214 Ga0496112_0359802 3300048915 Bacteria 1397
215 Ga0496114_0013085 3300048917 Bacteria 6647
216 Ga0496116_0084686 3300048919 Bacteria 1952
217 Ga0496117_0251161 3300048920 Bacteria 964
218 Ga0496118_0026364 3300048921 Bacteria 4953
219 Ga0496118_0110752 3300048921 Bacteria 1822
220 Ga0496121_0002670 3300048924 Bacteria 26700
221 Ga0496121_0006329 3300048924 Bacteria 14764
222 Ga0496121_0022337 3300048924 Bacteria 6146
223 Ga0496123_0006732 3300048926 Bacteria 11056
224 Ga0496123_0055548 3300048926 Bacteria 2596
225 Ga0496124_0160342 3300048927 Bacteria 1753
226 Ga0496125_0007187 3300048928 Bacteria 11871
227 Ga0496126_0005982 3300048929 Bacteria 13672
228 Ga0501042_0309117 3300049578 Bacteria 1142
229 nmdc:mga0k408_199_c1 3300050493 Bacteria 31769
230 nmdc:mga0k408_21372_c1 3300050493 Bacteria 3634
231 nmdc:mga08y16_47278_c1 3300050511 Bacteria 4504
232 Ga0500593_000159 3300053117 Bacteria 26967
233 Ga0500618_029182 3300053125 Bacteria 1302
234 Ga0500645_000061 3300053730 Bacteria 85703
235 Ga0500645_000257 3300053730 Bacteria 38752
236 Ga0587088_015160 3300059508 Bacteria 1211

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_1165399 Ga0436361_1165399_171_800 209
2 3300048912 Ga0496109_0027637 Ga0496109_0027637_23_682 218
3 3300038443 Ga0395901_1298269 Ga0395901_1298269_12_671 219
4 3300049578 Ga0501042_0309117 Ga0501042_0309117_464_1123 219
5 iso_pu_bacteria 2600255292 2601667175 226
6 iso_pu_bacteria 2600255292 2601670722 226
7 iso_pu_bacteria 2643221638 2644214913 229
8 3300044673 Ga0453683_0001365 Ga0453683_0001365_10432_11133 232
9 3300045051 Ga0451576_0003730 Ga0451576_0003730_6925_7626 232
10 3300048924 Ga0496121_0002670 Ga0496121_0002670_16041_16739 232
11 3300006195 Ga0075366_10022969 Ga0075366_100229692 233
12 3300006353 Ga0075370_10023537 Ga0075370_100235372 233
13 3300035111 Ga0373923_0220330 Ga0373923_0220330_29_730 233
14 3300038741 Ga0400488_07463 Ga0400488_07463_481_1188 233
15 3300042115 Ga0450911_025665 Ga0450911_025665_34_735 233
16 3300044719 Ga0466971_0329856 Ga0466971_0329856_17_718 233
17 3300048903 Ga0496100_0475768 Ga0496100_0475768_21_722 233
18 iso_pu_bacteria 2657244999 2657681327 251
19 iso_pu_bacteria 2802429268 2804752522 251
20 iso_pu_bacteria 2894510363 2894511803 251
21 iso_pu_bacteria 2513237082 2513555971 252
22 iso_pu_bacteria 2515154123 2515688492 252
23 iso_pu_bacteria 2600255067 2600812669 252
24 iso_pu_bacteria 2600255292 2601666668 252
25 iso_pu_bacteria 2600255292 2601671163 252
26 3300042876 Ga0451577_0511274 Ga0451577_0511274_181_942 253
27 3300044712 Ga0453684_0349489 Ga0453684_0349489_288_1049 253
28 iso_pu_bacteria 2821131069 2821135112 253
29 iso_pu_bacteria 2857564685 2857570325 253
30 iso_pu_bacteria 2921643360 2921644693 253
31 iso_pu_bacteria 641736154 642416139 253
32 iso_pu_bacteria 8020945358 8020951647 253
33 3300005327 Ga0070658_10132651 Ga0070658_101326512 255
34 3300005328 Ga0070676_10004431 Ga0070676_100044313 255
35 3300005331 Ga0070670_100021991 Ga0070670_1000219912 255
36 3300005338 Ga0068868_100137339 Ga0068868_1001373392 255
37 3300005339 Ga0070660_100012177 Ga0070660_1000121773 255
38 3300005339 Ga0070660_100571151 Ga0070660_1005711511 255
39 3300005344 Ga0070661_100237140 Ga0070661_1002371402 255
40 3300005354 Ga0070675_100014550 Ga0070675_1000145502 255
41 3300005356 Ga0070674_100003315 Ga0070674_1000033155 255
42 3300005364 Ga0070673_100289504 Ga0070673_1002895042 255
43 3300005440 Ga0070705_100342993 Ga0070705_1003429931 255
44 3300005456 Ga0070678_100014868 Ga0070678_1000148682 255
45 3300005457 Ga0070662_100031241 Ga0070662_1000312413 255
46 3300005459 Ga0068867_100004840 Ga0068867_1000048402 255
47 3300005543 Ga0070672_100014456 Ga0070672_1000144562 255
48 3300005564 Ga0070664_100045383 Ga0070664_1000453832 255
49 3300005616 Ga0068852_100784853 Ga0068852_1007848532 255
50 3300006175 Ga0070712_100068618 Ga0070712_1000686182 255
51 3300006237 Ga0097621_100008769 Ga0097621_1000087693 255
52 3300006358 Ga0068871_100017327 Ga0068871_1000173272 255
53 3300009094 Ga0111539_10000172 Ga0111539_1000017212 255
54 3300009177 Ga0105248_10058458 Ga0105248_100584581 255
55 3300013102 Ga0157371_10019716 Ga0157371_100197163 255
56 3300013105 Ga0157369_10635328 Ga0157369_106353282 255
57 3300013296 Ga0157374_10109791 Ga0157374_101097912 255
58 3300013297 Ga0157378_10008957 Ga0157378_100089574 255
59 3300013306 Ga0163162_10083990 Ga0163162_100839903 255
60 3300013308 Ga0157375_10017760 Ga0157375_100177603 255
61 3300014325 Ga0163163_10337553 Ga0163163_103375532 255
62 3300025907 Ga0207645_10006119 Ga0207645_100061193 255
63 3300025909 Ga0207705_10041174 Ga0207705_100411743 255
64 3300025926 Ga0207659_10068148 Ga0207659_100681482 255
65 3300025933 Ga0207706_10009783 Ga0207706_100097834 255
66 3300025937 Ga0207669_10019988 Ga0207669_100199882 255
67 3300025940 Ga0207691_10000171 Ga0207691_100001718 255
68 3300025960 Ga0207651_10249159 Ga0207651_102491591 255
69 3300026089 Ga0207648_10029606 Ga0207648_100296064 255
70 3300026121 Ga0207683_10007252 Ga0207683_100072526 255
71 3300028577 Ga0265318_10000013 Ga0265318_1000001370 255
72 3300031240 Ga0265320_10008077 Ga0265320_100080776 255
73 3300031344 Ga0265316_10126239 Ga0265316_101262392 255
74 3300031595 Ga0265313_10016554 Ga0265313_100165543 255
75 3300031711 Ga0265314_10001603 Ga0265314_1000160310 255
76 3300032004 Ga0307414_10677457 Ga0307414_106774571 255
77 3300032005 Ga0307411_10431622 Ga0307411_104316221 255
78 3300048904 Ga0496101_0351586 Ga0496101_0351586_177_947 255
79 3300048908 Ga0496105_0099483 Ga0496105_0099483_1513_2283 255
80 3300048909 Ga0496106_0024989 Ga0496106_0024989_1633_2403 255
81 3300048914 Ga0496111_0374697 Ga0496111_0374697_115_885 255
82 3300048917 Ga0496114_0013085 Ga0496114_0013085_4455_5225 255
83 3300050511 nmdc:mga08y16_47278_c1 nmdc:mga08y16_47278_c1_711_1481 255
84 3300005335 Ga0070666_10006119 Ga0070666_100061194 256
85 3300005338 Ga0068868_100007691 Ga0068868_1000076913 256
86 3300005355 Ga0070671_100058216 Ga0070671_1000582162 256
87 3300005367 Ga0070667_100066172 Ga0070667_1000661723 256
88 3300005441 Ga0070700_100000001 Ga0070700_100000001105 256
89 3300005468 Ga0070707_100421799 Ga0070707_1004217992 256
90 3300005535 Ga0070684_100413474 Ga0070684_1004134743 256
91 3300005563 Ga0068855_100045404 Ga0068855_1000454042 256
92 3300006195 Ga0075366_10001746 Ga0075366_1000174610 256
93 3300015683 Ga0183362_10005 Ga0183362_1000567 256
94 3300021358 Ga0213873_10000018 Ga0213873_10000018135 256
95 3300021384 Ga0213876_10000058 Ga0213876_10000058140 256
96 3300021384 Ga0213876_10003656 Ga0213876_100036562 256
97 3300025228 Ga0209672_100532 Ga0209672_10053217 256
98 3300025256 Ga0209759_1030767 Ga0209759_10307671 256
99 3300025903 Ga0207680_10003093 Ga0207680_100030936 256
100 3300025922 Ga0207646_10375624 Ga0207646_103756242 256
101 3300025931 Ga0207644_10091547 Ga0207644_100915472 256
102 3300025949 Ga0207667_10050793 Ga0207667_100507932 256
103 3300026023 Ga0207677_10001576 Ga0207677_1000157612 256
104 3300039437 Ga0436365_0337700 Ga0436365_0337700_39127_39906 256
105 3300039437 Ga0436365_1806815 Ga0436365_1806815_11544_12332 256
106 3300039453 Ga0436362_0011715 Ga0436362_0011715_42528_43307 256
107 3300042876 Ga0451577_0008119 Ga0451577_0008119_7628_8491 256
108 3300044712 Ga0453684_0063928 Ga0453684_0063928_3344_4207 256
109 3300046665 Ga0495661_0100320 Ga0495661_0100320_443_1213 256
110 3300050493 nmdc:mga0k408_199_c1 nmdc:mga0k408_199_c1_23101_23871 256
111 3300001979 JGI24740J21852_10031276 JGI24740J21852_100312762 257
112 3300001990 JGI24737J22298_10050167 JGI24737J22298_100501672 257
113 3300002705 JGI25156J39149_1000313 JGI25156J39149_100031320 257
114 3300002738 JGI25154J39366_1000711 JGI25154J39366_10007114 257
115 3300002739 JGI25158J39367_1000009 JGI25158J39367_100000918 257
116 3300002987 JGI25159J45721_1000039 JGI25159J45721_100003948 257
117 3300002987 JGI25159J45721_1000074 JGI25159J45721_10000742 257
118 3300002987 JGI25159J45721_1000778 JGI25159J45721_10007785 257
119 3300003354 JGI25160J50197_1000106 JGI25160J50197_100010632 257
120 3300003374 JGI25161J50226_1000041 JGI25161J50226_100004172 257
121 3300003374 JGI25161J50226_1000115 JGI25161J50226_100011527 257
122 3300003762 Ga0055542_1011516 Ga0055542_10115162 257
123 3300003771 Ga0055526_1000076 Ga0055526_100007660 257
124 3300003771 Ga0055526_1002128 Ga0055526_10021288 257
125 3300003773 Ga0055537_1000295 Ga0055537_10002952 257
126 3300003775 Ga0055524_1002721 Ga0055524_10027212 257
127 3300003784 Ga0055534_1000047 Ga0055534_100004751 257
128 3300003790 Ga0055528_1000049 Ga0055528_100004916 257
129 3300004625 Ga0055543_1000092 Ga0055543_100009223 257
130 3300004625 Ga0055543_1000094 Ga0055543_100009421 257
131 3300005262 Ga0065165_1000434 Ga0065165_100043423 257
132 3300005262 Ga0065165_1000492 Ga0065165_100049242 257
133 3300005333 Ga0070677_10075155 Ga0070677_100751552 257
134 3300005334 Ga0068869_100152137 Ga0068869_1001521372 257
135 3300005339 Ga0070660_100000537 Ga0070660_10000053711 257
136 3300005344 Ga0070661_100119367 Ga0070661_1001193673 257
137 3300005366 Ga0070659_100002095 Ga0070659_1000020955 257
138 3300005434 Ga0070709_10237628 Ga0070709_102376282 257
139 3300005455 Ga0070663_100000402 Ga0070663_10000040212 257
140 3300005468 Ga0070707_100137730 Ga0070707_1001377301 257
141 3300005539 Ga0068853_100194437 Ga0068853_1001944371 257
142 3300005545 Ga0070695_100108780 Ga0070695_1001087801 257
143 3300005563 Ga0068855_100001138 Ga0068855_10000113810 257
144 3300005563 Ga0068855_100003503 Ga0068855_10000350317 257
145 3300006944 Ga0099823_1000364 Ga0099823_100036418 257
146 3300009036 Ga0105244_10000185 Ga0105244_100001857 257
147 3300009092 Ga0105250_10002832 Ga0105250_100028326 257
148 3300009093 Ga0105240_10024586 Ga0105240_100245868 257
149 3300009177 Ga0105248_10343064 Ga0105248_103430642 257
150 3300009545 Ga0105237_10059528 Ga0105237_100595283 257
151 3300009545 Ga0105237_10088923 Ga0105237_100889232 257
152 3300009551 Ga0105238_10027418 Ga0105238_100274182 257
153 3300010375 Ga0105239_10008956 Ga0105239_100089562 257
154 3300013100 Ga0157373_10022068 Ga0157373_100220683 257
155 3300013100 Ga0157373_10025559 Ga0157373_100255594 257
156 3300013104 Ga0157370_10023559 Ga0157370_100235594 257
157 3300013296 Ga0157374_10616182 Ga0157374_106161821 257
158 3300013297 Ga0157378_10198606 Ga0157378_101986062 257
159 3300013307 Ga0157372_10348251 Ga0157372_103482512 257
160 3300014497 Ga0182008_10081244 Ga0182008_100812441 257
161 3300014969 Ga0157376_10087717 Ga0157376_100877172 257
162 3300015261 Ga0182006_1025243 Ga0182006_10252433 257
163 3300021361 Ga0213872_10004417 Ga0213872_100044174 257
164 3300021388 Ga0213875_10032138 Ga0213875_100321383 257
165 3300025208 Ga0209436_100042 Ga0209436_10004227 257
166 3300025256 Ga0209759_1000562 Ga0209759_100056215 257
167 3300025263 Ga0209565_1000112 Ga0209565_100011216 257
168 3300025273 Ga0209673_1000210 Ga0209673_100021071 257
169 3300025284 Ga0209130_1000099 Ga0209130_100009964 257
170 3300025284 Ga0209130_1000227 Ga0209130_100022723 257
171 3300025291 Ga0209675_1000142 Ga0209675_100014249 257
172 3300025295 Ga0209564_1000245 Ga0209564_100024570 257
173 3300025298 Ga0209050_1000366 Ga0209050_100036623 257
174 3300025299 Ga0209256_1000252 Ga0209256_100025249 257
175 3300025302 Ga0207426_1000062 Ga0207426_1000062229 257
176 3300025728 Ga0207655_1002080 Ga0207655_10020809 257
177 3300025904 Ga0207647_10065262 Ga0207647_100652621 257
178 3300025913 Ga0207695_10011856 Ga0207695_100118562 257
179 3300025919 Ga0207657_10001827 Ga0207657_1000182715 257
180 3300025924 Ga0207694_10026822 Ga0207694_100268222 257
181 3300025932 Ga0207690_10000615 Ga0207690_1000061515 257
182 3300025941 Ga0207711_10498202 Ga0207711_104982022 257
183 3300025949 Ga0207667_10000427 Ga0207667_1000042717 257
184 3300025949 Ga0207667_10003296 Ga0207667_1000329616 257
185 3300026041 Ga0207639_10522633 Ga0207639_105226332 257
186 3300026067 Ga0207678_10006529 Ga0207678_100065299 257
187 3300027296 Ga0209389_1000144 Ga0209389_100014454 257
188 3300027361 Ga0209489_100625 Ga0209489_10062554 257
189 3300028666 Ga0265336_10000147 Ga0265336_1000014739 257
190 3300028666 Ga0265336_10062909 Ga0265336_100629092 257
191 3300029957 Ga0265324_10000090 Ga0265324_1000009031 257
192 3300029957 Ga0265324_10000381 Ga0265324_100003813 257
193 3300029957 Ga0265324_10077337 Ga0265324_100773372 257
194 3300031241 Ga0265325_10000271 Ga0265325_1000027118 257
195 3300031250 Ga0265331_10000024 Ga0265331_10000024218 257
196 3300031251 Ga0265327_10000079 Ga0265327_1000007927 257
197 3300037312 Ga0395899_0017908 Ga0395899_0017908_2181_2954 257
198 3300037312 Ga0395899_0139311 Ga0395899_0139311_476_1381 257
199 3300037853 Ga0436364_1397959 Ga0436364_1397959_1215_1991 257
200 3300038443 Ga0395901_0265841 Ga0395901_0265841_339_1136 257
201 3300039447 Ga0436361_0878496 Ga0436361_0878496_23544_24317 257
202 3300042876 Ga0451577_0007448 Ga0451577_0007448_1961_2734 257
203 3300042876 Ga0451577_0031747 Ga0451577_0031747_3687_4460 257
204 3300044658 Ga0466972_0132285 Ga0466972_0132285_198_971 257
205 3300044673 Ga0453683_0019296 Ga0453683_0019296_964_1740 257
206 3300044673 Ga0453683_0157983 Ga0453683_0157983_525_1301 257
207 3300044712 Ga0453684_0322275 Ga0453684_0322275_560_1333 257
208 3300045051 Ga0451576_0000006 Ga0451576_0000006_675474_676247 257
209 3300045051 Ga0451576_0000006 Ga0451576_0000006_690839_691612 257
210 3300045051 Ga0451576_0000535 Ga0451576_0000535_66338_67114 257
211 3300045051 Ga0451576_0000652 Ga0451576_0000652_45552_46325 257
212 3300045051 Ga0451576_0000868 Ga0451576_0000868_35029_35802 257
213 3300045051 Ga0451576_0005010 Ga0451576_0005010_13279_14052 257
214 3300046453 Ga0495627_000004 Ga0495627_000004_35507_36280 257
215 3300046463 Ga0495653_0000066 Ga0495653_0000066_78187_78960 257
216 3300046492 Ga0495585_0001745 Ga0495585_0001745_1499_2272 257
217 3300046507 Ga0495606_0000063 Ga0495606_0000063_76447_77220 257
218 3300046507 Ga0495606_0001879 Ga0495606_0001879_12049_12822 257
219 3300046507 Ga0495606_0002100 Ga0495606_0002100_11824_12597 257
220 3300046512 Ga0495610_0000647 Ga0495610_0000647_4119_4892 257
221 3300046523 Ga0495644_0050658 Ga0495644_0050658_277_1050 257
222 3300046538 Ga0495609_0001180 Ga0495609_0001180_13775_14548 257
223 3300046542 Ga0495597_0000069 Ga0495597_0000069_16231_17004 257
224 3300046616 Ga0495668_0000152 Ga0495668_0000152_87199_87972 257
225 3300046692 Ga0495671_0186972 Ga0495671_0186972_62_835 257
226 3300046810 Ga0495660_0010827 Ga0495660_0010827_3019_3792 257
227 3300046810 Ga0495660_0014570 Ga0495660_0014570_2454_3227 257
228 3300046810 Ga0495660_0079751 Ga0495660_0079751_79_852 257
229 3300047320 Ga0495672_0000125 Ga0495672_0000125_23909_24682 257
230 3300047470 Ga0495681_0000895 Ga0495681_0000895_7306_8079 257
231 3300047472 Ga0495686_0000860 Ga0495686_0000860_6934_7707 257
232 3300048904 Ga0496101_0193236 Ga0496101_0193236_287_1060 257
233 3300048905 Ga0496102_0224244 Ga0496102_0224244_959_1744 257
234 3300048907 Ga0496104_0034953 Ga0496104_0034953_1446_2219 257
235 3300048908 Ga0496105_0081161 Ga0496105_0081161_1726_2499 257
236 3300048915 Ga0496112_0359802 Ga0496112_0359802_356_1129 257
237 3300048919 Ga0496116_0084686 Ga0496116_0084686_719_1492 257
238 3300048920 Ga0496117_0251161 Ga0496117_0251161_41_814 257
239 3300048921 Ga0496118_0026364 Ga0496118_0026364_2443_3216 257
240 3300048921 Ga0496118_0110752 Ga0496118_0110752_287_1060 257
241 3300048924 Ga0496121_0006329 Ga0496121_0006329_518_1291 257
242 3300048924 Ga0496121_0022337 Ga0496121_0022337_5125_5898 257
243 3300048926 Ga0496123_0006732 Ga0496123_0006732_2559_3332 257
244 3300048926 Ga0496123_0055548 Ga0496123_0055548_1183_1956 257
245 3300048927 Ga0496124_0160342 Ga0496124_0160342_911_1684 257
246 3300048928 Ga0496125_0007187 Ga0496125_0007187_1684_2457 257
247 3300048929 Ga0496126_0005982 Ga0496126_0005982_9518_10291 257
248 3300050493 nmdc:mga0k408_21372_c1 nmdc:mga0k408_21372_c1_658_1431 257
249 3300053117 Ga0500593_000159 Ga0500593_000159_21279_22055 257
250 3300053125 Ga0500618_029182 Ga0500618_029182_199_972 257
251 3300053730 Ga0500645_000061 Ga0500645_000061_48036_48812 257
252 3300053730 Ga0500645_000257 Ga0500645_000257_14412_15188 257
253 3300059508 Ga0587088_015160 Ga0587088_015160_393_1166 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

31

252

0.86

PF12804

NTP_transf_3

MobA-like NTP transferase domain

32

276

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.9185 2 256
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.9147 2 256
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.9052 2 256
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.9046 2 256
4y7t-assembly1.cif.gz_A structural analysis of muru 0.832 1 248
ID Description Score Start End Superfamily
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9185 2 256 3.90.550.10
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9046 2 256 3.90.550.10
af_A4I3X5_10_117_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8315 1 106 3.90.550.10
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8109 1 246 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8064 2 248 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A838W7T2-F1-model_v4 NTP transferase domain-containing protein 0.9651 1 94 GO:0047343
AF-A0A2K9ZBA7-F1-model_v4 Glucose-1-phosphate cytidylyltransferase (Modular protein) (EC 2.7.7.33) 0.964 1 256 GO:0009243
GO:0047343
AF-A0A383BKH4-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9639 1 149 GO:0009058
GO:0047343
AF-A0A6N6SEA7-F1-model_v4 Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) 0.9638 1 255 GO:0009243
GO:0047343
AF-A0A523XVD3-F1-model_v4 Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) 0.9633 27 256 GO:0009243
GO:0047343

Feature Viewer

pLDDT pTM Quality
90.99 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map