F364275
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 253 | 194 | 236 | 255 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0008119|Ga0451577_0008119_7628_8491 |
| Length | 287 |
| Sequence | VNINEKYHVEQADEPNGPPAAARAFGLGAMKAVILAGGMGTRIAEETHLRPKPMIEIGGQPILWHILKIYASHGIREFIICCGYKGYLIKEYFANYFLHTSDITFDLQANRMEVHQRFAEPWRVTLVDTGQHTGTGGRLLRVADYLRGESDFCFTYGDGVADVDVTALIEHHRRSGLLATITATVPPGRFGALDIDHAAGRVRAYREKPRGDGGVVNGGFFVLKPQVIDLIEGDDTLWEQAPLEQLAAAGQLGVYSHTGFWQPMDTVRDRNHLEQLWAEGRAPWKSW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 2 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 3 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 4 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 5 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 6 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 7 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 8 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 9 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 10 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 11 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 15 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 16 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 17 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 18 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 64 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 85 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 86 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 87 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 88 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 89 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 90 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 125 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 126 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 127 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 128 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 130 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 131 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 132 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 133 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 134 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 135 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 137 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 138 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 139 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 140 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 143 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 144 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 145 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 146 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 147 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 148 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 149 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 150 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 151 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 152 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 153 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 171 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 172 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 173 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 174 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 176 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 177 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 178 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 179 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 180 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 181 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 182 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 183 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 184 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 185 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 186 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 188 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 190 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 191 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 192 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 194 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.28 |
| Metatranscriptomes | 0.4 |
| Isolates | 6.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.02 |
| Nodule | 2.37 |
| Rhizoplane | 6.32 |
| Rhizosphere | 64.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10031276 | 3300001979 | Bacteria | 1719 |
| 2 | JGI24737J22298_10050167 | 3300001990 | Bacteria | 1269 |
| 3 | JGI25156J39149_1000313 | 3300002705 | Bacteria | 32091 |
| 4 | JGI25154J39366_1000711 | 3300002738 | Bacteria | 15124 |
| 5 | JGI25158J39367_1000009 | 3300002739 | Bacteria | 53723 |
| 6 | JGI25159J45721_1000039 | 3300002987 | Bacteria | 69707 |
| 7 | JGI25159J45721_1000074 | 3300002987 | Bacteria | 48266 |
| 8 | JGI25159J45721_1000778 | 3300002987 | Bacteria | 13861 |
| 9 | JGI25160J50197_1000106 | 3300003354 | Bacteria | 80449 |
| 10 | JGI25161J50226_1000041 | 3300003374 | Bacteria | 124485 |
| 11 | JGI25161J50226_1000115 | 3300003374 | Bacteria | 62500 |
| 12 | Ga0055542_1011516 | 3300003762 | Bacteria | 1565 |
| 13 | Ga0055526_1000076 | 3300003771 | Bacteria | 92438 |
| 14 | Ga0055526_1002128 | 3300003771 | Bacteria | 13593 |
| 15 | Ga0055537_1000295 | 3300003773 | Bacteria | 35299 |
| 16 | Ga0055524_1002721 | 3300003775 | Bacteria | 8926 |
| 17 | Ga0055534_1000047 | 3300003784 | Bacteria | 94932 |
| 18 | Ga0055528_1000049 | 3300003790 | Bacteria | 94814 |
| 19 | Ga0055543_1000092 | 3300004625 | Bacteria | 78538 |
| 20 | Ga0055543_1000094 | 3300004625 | Bacteria | 78040 |
| 21 | Ga0065165_1000434 | 3300005262 | Bacteria | 65848 |
| 22 | Ga0065165_1000492 | 3300005262 | Bacteria | 61002 |
| 23 | Ga0070658_10132651 | 3300005327 | Bacteria | 2076 |
| 24 | Ga0070676_10004431 | 3300005328 | Bacteria | 7388 |
| 25 | Ga0070670_100021991 | 3300005331 | Bacteria | 5487 |
| 26 | Ga0070677_10075155 | 3300005333 | Bacteria | 1431 |
| 27 | Ga0068869_100152137 | 3300005334 | Bacteria | 1795 |
| 28 | Ga0070666_10006119 | 3300005335 | Bacteria | 7397 |
| 29 | Ga0068868_100007691 | 3300005338 | Bacteria | 7687 |
| 30 | Ga0068868_100137339 | 3300005338 | Bacteria | 2005 |
| 31 | Ga0070660_100000537 | 3300005339 | Bacteria | 25342 |
| 32 | Ga0070660_100012177 | 3300005339 | Bacteria | 6141 |
| 33 | Ga0070660_100571151 | 3300005339 | Bacteria | 944 |
| 34 | Ga0070661_100119367 | 3300005344 | Bacteria | 1974 |
| 35 | Ga0070661_100237140 | 3300005344 | Bacteria | 1403 |
| 36 | Ga0070675_100014550 | 3300005354 | Bacteria | 6206 |
| 37 | Ga0070671_100058216 | 3300005355 | Bacteria | 3217 |
| 38 | Ga0070674_100003315 | 3300005356 | Bacteria | 9014 |
| 39 | Ga0070673_100289504 | 3300005364 | Bacteria | 1439 |
| 40 | Ga0070659_100002095 | 3300005366 | Bacteria | 14218 |
| 41 | Ga0070667_100066172 | 3300005367 | Bacteria | 3070 |
| 42 | Ga0070709_10237628 | 3300005434 | Bacteria | 1307 |
| 43 | Ga0070705_100342993 | 3300005440 | Bacteria | 1086 |
| 44 | Ga0070700_100000001 | 3300005441 | Bacteria | 346167 |
| 45 | Ga0070663_100000402 | 3300005455 | Bacteria | 22670 |
| 46 | Ga0070678_100014868 | 3300005456 | Bacteria | 4926 |
| 47 | Ga0070662_100031241 | 3300005457 | Bacteria | 3736 |
| 48 | Ga0068867_100004840 | 3300005459 | Bacteria | 9472 |
| 49 | Ga0070707_100137730 | 3300005468 | Bacteria | 2375 |
| 50 | Ga0070707_100421799 | 3300005468 | Bacteria | 1294 |
| 51 | Ga0070684_100413474 | 3300005535 | Bacteria | 1244 |
| 52 | Ga0068853_100194437 | 3300005539 | Bacteria | 1844 |
| 53 | Ga0070672_100014456 | 3300005543 | Bacteria | 5595 |
| 54 | Ga0070695_100108780 | 3300005545 | Bacteria | 1878 |
| 55 | Ga0068855_100001138 | 3300005563 | Bacteria | 32970 |
| 56 | Ga0068855_100003503 | 3300005563 | Bacteria | 19223 |
| 57 | Ga0068855_100045404 | 3300005563 | Bacteria | 5197 |
| 58 | Ga0070664_100045383 | 3300005564 | Bacteria | 3712 |
| 59 | Ga0068852_100784853 | 3300005616 | Bacteria | 966 |
| 60 | Ga0070712_100068618 | 3300006175 | Bacteria | 2527 |
| 61 | Ga0075366_10001746 | 3300006195 | Bacteria | 10934 |
| 62 | Ga0075366_10022969 | 3300006195 | Bacteria | 3633 |
| 63 | Ga0097621_100008769 | 3300006237 | Bacteria | 7305 |
| 64 | Ga0075370_10023537 | 3300006353 | Bacteria | 3393 |
| 65 | Ga0068871_100017327 | 3300006358 | Bacteria | 5447 |
| 66 | Ga0099823_1000364 | 3300006944 | Bacteria | 28802 |
| 67 | Ga0105244_10000185 | 3300009036 | Bacteria | 63288 |
| 68 | Ga0105250_10002832 | 3300009092 | Bacteria | 8498 |
| 69 | Ga0105240_10024586 | 3300009093 | Bacteria | 7935 |
| 70 | Ga0111539_10000172 | 3300009094 | Bacteria | 74842 |
| 71 | Ga0105248_10058458 | 3300009177 | Bacteria | 4331 |
| 72 | Ga0105248_10343064 | 3300009177 | Bacteria | 1681 |
| 73 | Ga0105237_10059528 | 3300009545 | Bacteria | 3821 |
| 74 | Ga0105237_10088923 | 3300009545 | Bacteria | 3078 |
| 75 | Ga0105238_10027418 | 3300009551 | Bacteria | 5804 |
| 76 | Ga0105239_10008956 | 3300010375 | Bacteria | 11325 |
| 77 | Ga0157373_10022068 | 3300013100 | Bacteria | 4620 |
| 78 | Ga0157373_10025559 | 3300013100 | Bacteria | 4270 |
| 79 | Ga0157371_10019716 | 3300013102 | Bacteria | 4966 |
| 80 | Ga0157370_10023559 | 3300013104 | Bacteria | 6110 |
| 81 | Ga0157369_10635328 | 3300013105 | Bacteria | 1101 |
| 82 | Ga0157374_10109791 | 3300013296 | Bacteria | 2652 |
| 83 | Ga0157374_10616182 | 3300013296 | Bacteria | 1096 |
| 84 | Ga0157378_10008957 | 3300013297 | Bacteria | 8713 |
| 85 | Ga0157378_10198606 | 3300013297 | Bacteria | 1896 |
| 86 | Ga0163162_10083990 | 3300013306 | Bacteria | 3259 |
| 87 | Ga0157372_10348251 | 3300013307 | Bacteria | 1726 |
| 88 | Ga0157375_10017760 | 3300013308 | Bacteria | 6431 |
| 89 | Ga0163163_10337553 | 3300014325 | Bacteria | 1562 |
| 90 | Ga0182008_10081244 | 3300014497 | Bacteria | 1595 |
| 91 | Ga0157376_10087717 | 3300014969 | Bacteria | 2686 |
| 92 | Ga0182006_1025243 | 3300015261 | Bacteria | 2442 |
| 93 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 94 | Ga0213873_10000018 | 3300021358 | Bacteria | 123140 |
| 95 | Ga0213872_10004417 | 3300021361 | Bacteria | 7470 |
| 96 | Ga0213876_10000058 | 3300021384 | Bacteria | 134080 |
| 97 | Ga0213876_10003656 | 3300021384 | Bacteria | 8742 |
| 98 | Ga0213875_10032138 | 3300021388 | Bacteria | 2481 |
| 99 | Ga0209436_100042 | 3300025208 | Bacteria | 73600 |
| 100 | Ga0209672_100532 | 3300025228 | Bacteria | 20804 |
| 101 | Ga0209759_1000562 | 3300025256 | Bacteria | 37533 |
| 102 | Ga0209759_1030767 | 3300025256 | Bacteria | 1055 |
| 103 | Ga0209565_1000112 | 3300025263 | Bacteria | 117209 |
| 104 | Ga0209673_1000210 | 3300025273 | Bacteria | 117276 |
| 105 | Ga0209130_1000099 | 3300025284 | Bacteria | 141717 |
| 106 | Ga0209130_1000227 | 3300025284 | Bacteria | 73760 |
| 107 | Ga0209675_1000142 | 3300025291 | Bacteria | 95327 |
| 108 | Ga0209564_1000245 | 3300025295 | Bacteria | 117378 |
| 109 | Ga0209050_1000366 | 3300025298 | Bacteria | 86616 |
| 110 | Ga0209256_1000252 | 3300025299 | Bacteria | 94936 |
| 111 | Ga0207426_1000062 | 3300025302 | Bacteria | 362040 |
| 112 | Ga0207655_1002080 | 3300025728 | Bacteria | 16796 |
| 113 | Ga0207680_10003093 | 3300025903 | Bacteria | 7817 |
| 114 | Ga0207647_10065262 | 3300025904 | Bacteria | 2210 |
| 115 | Ga0207645_10006119 | 3300025907 | Bacteria | 8646 |
| 116 | Ga0207705_10041174 | 3300025909 | Bacteria | 3314 |
| 117 | Ga0207695_10011856 | 3300025913 | Bacteria | 10512 |
| 118 | Ga0207657_10001827 | 3300025919 | Bacteria | 22959 |
| 119 | Ga0207646_10375624 | 3300025922 | Bacteria | 1284 |
| 120 | Ga0207694_10026822 | 3300025924 | Bacteria | 4386 |
| 121 | Ga0207659_10068148 | 3300025926 | Bacteria | 2587 |
| 122 | Ga0207644_10091547 | 3300025931 | Bacteria | 2268 |
| 123 | Ga0207690_10000615 | 3300025932 | Bacteria | 23019 |
| 124 | Ga0207706_10009783 | 3300025933 | Bacteria | 8797 |
| 125 | Ga0207669_10019988 | 3300025937 | Bacteria | 3500 |
| 126 | Ga0207691_10000171 | 3300025940 | Bacteria | 60451 |
| 127 | Ga0207711_10498202 | 3300025941 | Bacteria | 1135 |
| 128 | Ga0207667_10000427 | 3300025949 | Bacteria | 56780 |
| 129 | Ga0207667_10003296 | 3300025949 | Bacteria | 19914 |
| 130 | Ga0207667_10050793 | 3300025949 | Bacteria | 4374 |
| 131 | Ga0207651_10249159 | 3300025960 | Bacteria | 1452 |
| 132 | Ga0207677_10001576 | 3300026023 | Bacteria | 12068 |
| 133 | Ga0207639_10522633 | 3300026041 | Bacteria | 1087 |
| 134 | Ga0207678_10006529 | 3300026067 | Bacteria | 10340 |
| 135 | Ga0207648_10029606 | 3300026089 | Bacteria | 4856 |
| 136 | Ga0207683_10007252 | 3300026121 | Bacteria | 9501 |
| 137 | Ga0209389_1000144 | 3300027296 | Bacteria | 61045 |
| 138 | Ga0209489_100625 | 3300027361 | Bacteria | 68635 |
| 139 | Ga0265318_10000013 | 3300028577 | Bacteria | 208938 |
| 140 | Ga0265336_10000147 | 3300028666 | Bacteria | 50015 |
| 141 | Ga0265336_10062909 | 3300028666 | Bacteria | 1112 |
| 142 | Ga0265324_10000090 | 3300029957 | Bacteria | 70577 |
| 143 | Ga0265324_10000381 | 3300029957 | Bacteria | 32068 |
| 144 | Ga0265324_10077337 | 3300029957 | Bacteria | 1132 |
| 145 | Ga0265320_10008077 | 3300031240 | Bacteria | 6472 |
| 146 | Ga0265325_10000271 | 3300031241 | Bacteria | 36968 |
| 147 | Ga0265331_10000024 | 3300031250 | Bacteria | 235118 |
| 148 | Ga0265327_10000079 | 3300031251 | Bacteria | 206892 |
| 149 | Ga0265316_10126239 | 3300031344 | Bacteria | 1929 |
| 150 | Ga0265313_10016554 | 3300031595 | Bacteria | 4233 |
| 151 | Ga0265314_10001603 | 3300031711 | Bacteria | 24883 |
| 152 | Ga0307414_10677457 | 3300032004 | Bacteria | 932 |
| 153 | Ga0307411_10431622 | 3300032005 | Bacteria | 1097 |
| 154 | Ga0373923_0220330 | 3300035111 | Bacteria | 882 |
| 155 | Ga0395899_0017908 | 3300037312 | Bacteria | 5391 |
| 156 | Ga0395899_0139311 | 3300037312 | Bacteria | 1727 |
| 157 | Ga0436364_1397959 | 3300037853 | Bacteria | 2605 |
| 158 | Ga0395901_0265841 | 3300038443 | Bacteria | 1785 |
| 159 | Ga0395901_1298269 | 3300038443 | Bacteria | 690 |
| 160 | Ga0400488_07463 | 3300038741 | Bacteria | 1231 |
| 161 | Ga0436365_0337700 | 3300039437 | Bacteria | 40984 |
| 162 | Ga0436365_1806815 | 3300039437 | Bacteria | 14007 |
| 163 | Ga0436361_0878496 | 3300039447 | Bacteria | 34656 |
| 164 | Ga0436361_1165399 | 3300039447 | Bacteria | 929 |
| 165 | Ga0436362_0011715 | 3300039453 | Bacteria | 44760 |
| 166 | Ga0450911_025665 | 3300042115 | Bacteria | 764 |
| 167 | Ga0451577_0007448 | 3300042876 | Bacteria | 10752 |
| 168 | Ga0451577_0008119 | 3300042876 | Bacteria | 10244 |
| 169 | Ga0451577_0031747 | 3300042876 | Bacteria | 4765 |
| 170 | Ga0451577_0511274 | 3300042876 | Bacteria | 1091 |
| 171 | Ga0466972_0132285 | 3300044658 | Bacteria | 1175 |
| 172 | Ga0453683_0001365 | 3300044673 | Bacteria | 21310 |
| 173 | Ga0453683_0019296 | 3300044673 | Bacteria | 4369 |
| 174 | Ga0453683_0157983 | 3300044673 | Bacteria | 1434 |
| 175 | Ga0453684_0063928 | 3300044712 | Bacteria | 4704 |
| 176 | Ga0453684_0322275 | 3300044712 | Bacteria | 1750 |
| 177 | Ga0453684_0349489 | 3300044712 | Bacteria | 1668 |
| 178 | Ga0466971_0329856 | 3300044719 | Bacteria | 736 |
| 179 | Ga0451576_0000006 | 3300045051 | Bacteria | 949698 |
| 180 | Ga0451576_0000535 | 3300045051 | Bacteria | 81918 |
| 181 | Ga0451576_0000652 | 3300045051 | Bacteria | 71674 |
| 182 | Ga0451576_0000868 | 3300045051 | Bacteria | 58132 |
| 183 | Ga0451576_0003730 | 3300045051 | Bacteria | 20605 |
| 184 | Ga0451576_0005010 | 3300045051 | Bacteria | 16830 |
| 185 | Ga0495627_000004 | 3300046453 | Bacteria | 640612 |
| 186 | Ga0495653_0000066 | 3300046463 | Bacteria | 91671 |
| 187 | Ga0495585_0001745 | 3300046492 | Bacteria | 16560 |
| 188 | Ga0495606_0000063 | 3300046507 | Bacteria | 184610 |
| 189 | Ga0495606_0001879 | 3300046507 | Bacteria | 26316 |
| 190 | Ga0495606_0002100 | 3300046507 | Bacteria | 24258 |
| 191 | Ga0495610_0000647 | 3300046512 | Bacteria | 34128 |
| 192 | Ga0495644_0050658 | 3300046523 | Bacteria | 1559 |
| 193 | Ga0495609_0001180 | 3300046538 | Bacteria | 18046 |
| 194 | Ga0495597_0000069 | 3300046542 | Bacteria | 89990 |
| 195 | Ga0495668_0000152 | 3300046616 | Bacteria | 104716 |
| 196 | Ga0495661_0100320 | 3300046665 | Bacteria | 1630 |
| 197 | Ga0495671_0186972 | 3300046692 | Bacteria | 1006 |
| 198 | Ga0495660_0010827 | 3300046810 | Bacteria | 5295 |
| 199 | Ga0495660_0014570 | 3300046810 | Bacteria | 4546 |
| 200 | Ga0495660_0079751 | 3300046810 | Bacteria | 1719 |
| 201 | Ga0495672_0000125 | 3300047320 | Bacteria | 118271 |
| 202 | Ga0495681_0000895 | 3300047470 | Bacteria | 23009 |
| 203 | Ga0495686_0000860 | 3300047472 | Bacteria | 38959 |
| 204 | Ga0496100_0475768 | 3300048903 | Bacteria | 960 |
| 205 | Ga0496101_0193236 | 3300048904 | Bacteria | 1571 |
| 206 | Ga0496101_0351586 | 3300048904 | Bacteria | 1158 |
| 207 | Ga0496102_0224244 | 3300048905 | Bacteria | 1772 |
| 208 | Ga0496104_0034953 | 3300048907 | Bacteria | 4689 |
| 209 | Ga0496105_0081161 | 3300048908 | Bacteria | 2679 |
| 210 | Ga0496105_0099483 | 3300048908 | Bacteria | 2402 |
| 211 | Ga0496106_0024989 | 3300048909 | Bacteria | 4444 |
| 212 | Ga0496109_0027637 | 3300048912 | Bacteria | 5069 |
| 213 | Ga0496111_0374697 | 3300048914 | Bacteria | 1053 |
| 214 | Ga0496112_0359802 | 3300048915 | Bacteria | 1397 |
| 215 | Ga0496114_0013085 | 3300048917 | Bacteria | 6647 |
| 216 | Ga0496116_0084686 | 3300048919 | Bacteria | 1952 |
| 217 | Ga0496117_0251161 | 3300048920 | Bacteria | 964 |
| 218 | Ga0496118_0026364 | 3300048921 | Bacteria | 4953 |
| 219 | Ga0496118_0110752 | 3300048921 | Bacteria | 1822 |
| 220 | Ga0496121_0002670 | 3300048924 | Bacteria | 26700 |
| 221 | Ga0496121_0006329 | 3300048924 | Bacteria | 14764 |
| 222 | Ga0496121_0022337 | 3300048924 | Bacteria | 6146 |
| 223 | Ga0496123_0006732 | 3300048926 | Bacteria | 11056 |
| 224 | Ga0496123_0055548 | 3300048926 | Bacteria | 2596 |
| 225 | Ga0496124_0160342 | 3300048927 | Bacteria | 1753 |
| 226 | Ga0496125_0007187 | 3300048928 | Bacteria | 11871 |
| 227 | Ga0496126_0005982 | 3300048929 | Bacteria | 13672 |
| 228 | Ga0501042_0309117 | 3300049578 | Bacteria | 1142 |
| 229 | nmdc:mga0k408_199_c1 | 3300050493 | Bacteria | 31769 |
| 230 | nmdc:mga0k408_21372_c1 | 3300050493 | Bacteria | 3634 |
| 231 | nmdc:mga08y16_47278_c1 | 3300050511 | Bacteria | 4504 |
| 232 | Ga0500593_000159 | 3300053117 | Bacteria | 26967 |
| 233 | Ga0500618_029182 | 3300053125 | Bacteria | 1302 |
| 234 | Ga0500645_000061 | 3300053730 | Bacteria | 85703 |
| 235 | Ga0500645_000257 | 3300053730 | Bacteria | 38752 |
| 236 | Ga0587088_015160 | 3300059508 | Bacteria | 1211 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039447 | Ga0436361_1165399 | Ga0436361_1165399_171_800 | 209 |
| 2 | 3300048912 | Ga0496109_0027637 | Ga0496109_0027637_23_682 | 218 |
| 3 | 3300038443 | Ga0395901_1298269 | Ga0395901_1298269_12_671 | 219 |
| 4 | 3300049578 | Ga0501042_0309117 | Ga0501042_0309117_464_1123 | 219 |
| 5 | iso_pu_bacteria | 2600255292 | 2601667175 | 226 |
| 6 | iso_pu_bacteria | 2600255292 | 2601670722 | 226 |
| 7 | iso_pu_bacteria | 2643221638 | 2644214913 | 229 |
| 8 | 3300044673 | Ga0453683_0001365 | Ga0453683_0001365_10432_11133 | 232 |
| 9 | 3300045051 | Ga0451576_0003730 | Ga0451576_0003730_6925_7626 | 232 |
| 10 | 3300048924 | Ga0496121_0002670 | Ga0496121_0002670_16041_16739 | 232 |
| 11 | 3300006195 | Ga0075366_10022969 | Ga0075366_100229692 | 233 |
| 12 | 3300006353 | Ga0075370_10023537 | Ga0075370_100235372 | 233 |
| 13 | 3300035111 | Ga0373923_0220330 | Ga0373923_0220330_29_730 | 233 |
| 14 | 3300038741 | Ga0400488_07463 | Ga0400488_07463_481_1188 | 233 |
| 15 | 3300042115 | Ga0450911_025665 | Ga0450911_025665_34_735 | 233 |
| 16 | 3300044719 | Ga0466971_0329856 | Ga0466971_0329856_17_718 | 233 |
| 17 | 3300048903 | Ga0496100_0475768 | Ga0496100_0475768_21_722 | 233 |
| 18 | iso_pu_bacteria | 2657244999 | 2657681327 | 251 |
| 19 | iso_pu_bacteria | 2802429268 | 2804752522 | 251 |
| 20 | iso_pu_bacteria | 2894510363 | 2894511803 | 251 |
| 21 | iso_pu_bacteria | 2513237082 | 2513555971 | 252 |
| 22 | iso_pu_bacteria | 2515154123 | 2515688492 | 252 |
| 23 | iso_pu_bacteria | 2600255067 | 2600812669 | 252 |
| 24 | iso_pu_bacteria | 2600255292 | 2601666668 | 252 |
| 25 | iso_pu_bacteria | 2600255292 | 2601671163 | 252 |
| 26 | 3300042876 | Ga0451577_0511274 | Ga0451577_0511274_181_942 | 253 |
| 27 | 3300044712 | Ga0453684_0349489 | Ga0453684_0349489_288_1049 | 253 |
| 28 | iso_pu_bacteria | 2821131069 | 2821135112 | 253 |
| 29 | iso_pu_bacteria | 2857564685 | 2857570325 | 253 |
| 30 | iso_pu_bacteria | 2921643360 | 2921644693 | 253 |
| 31 | iso_pu_bacteria | 641736154 | 642416139 | 253 |
| 32 | iso_pu_bacteria | 8020945358 | 8020951647 | 253 |
| 33 | 3300005327 | Ga0070658_10132651 | Ga0070658_101326512 | 255 |
| 34 | 3300005328 | Ga0070676_10004431 | Ga0070676_100044313 | 255 |
| 35 | 3300005331 | Ga0070670_100021991 | Ga0070670_1000219912 | 255 |
| 36 | 3300005338 | Ga0068868_100137339 | Ga0068868_1001373392 | 255 |
| 37 | 3300005339 | Ga0070660_100012177 | Ga0070660_1000121773 | 255 |
| 38 | 3300005339 | Ga0070660_100571151 | Ga0070660_1005711511 | 255 |
| 39 | 3300005344 | Ga0070661_100237140 | Ga0070661_1002371402 | 255 |
| 40 | 3300005354 | Ga0070675_100014550 | Ga0070675_1000145502 | 255 |
| 41 | 3300005356 | Ga0070674_100003315 | Ga0070674_1000033155 | 255 |
| 42 | 3300005364 | Ga0070673_100289504 | Ga0070673_1002895042 | 255 |
| 43 | 3300005440 | Ga0070705_100342993 | Ga0070705_1003429931 | 255 |
| 44 | 3300005456 | Ga0070678_100014868 | Ga0070678_1000148682 | 255 |
| 45 | 3300005457 | Ga0070662_100031241 | Ga0070662_1000312413 | 255 |
| 46 | 3300005459 | Ga0068867_100004840 | Ga0068867_1000048402 | 255 |
| 47 | 3300005543 | Ga0070672_100014456 | Ga0070672_1000144562 | 255 |
| 48 | 3300005564 | Ga0070664_100045383 | Ga0070664_1000453832 | 255 |
| 49 | 3300005616 | Ga0068852_100784853 | Ga0068852_1007848532 | 255 |
| 50 | 3300006175 | Ga0070712_100068618 | Ga0070712_1000686182 | 255 |
| 51 | 3300006237 | Ga0097621_100008769 | Ga0097621_1000087693 | 255 |
| 52 | 3300006358 | Ga0068871_100017327 | Ga0068871_1000173272 | 255 |
| 53 | 3300009094 | Ga0111539_10000172 | Ga0111539_1000017212 | 255 |
| 54 | 3300009177 | Ga0105248_10058458 | Ga0105248_100584581 | 255 |
| 55 | 3300013102 | Ga0157371_10019716 | Ga0157371_100197163 | 255 |
| 56 | 3300013105 | Ga0157369_10635328 | Ga0157369_106353282 | 255 |
| 57 | 3300013296 | Ga0157374_10109791 | Ga0157374_101097912 | 255 |
| 58 | 3300013297 | Ga0157378_10008957 | Ga0157378_100089574 | 255 |
| 59 | 3300013306 | Ga0163162_10083990 | Ga0163162_100839903 | 255 |
| 60 | 3300013308 | Ga0157375_10017760 | Ga0157375_100177603 | 255 |
| 61 | 3300014325 | Ga0163163_10337553 | Ga0163163_103375532 | 255 |
| 62 | 3300025907 | Ga0207645_10006119 | Ga0207645_100061193 | 255 |
| 63 | 3300025909 | Ga0207705_10041174 | Ga0207705_100411743 | 255 |
| 64 | 3300025926 | Ga0207659_10068148 | Ga0207659_100681482 | 255 |
| 65 | 3300025933 | Ga0207706_10009783 | Ga0207706_100097834 | 255 |
| 66 | 3300025937 | Ga0207669_10019988 | Ga0207669_100199882 | 255 |
| 67 | 3300025940 | Ga0207691_10000171 | Ga0207691_100001718 | 255 |
| 68 | 3300025960 | Ga0207651_10249159 | Ga0207651_102491591 | 255 |
| 69 | 3300026089 | Ga0207648_10029606 | Ga0207648_100296064 | 255 |
| 70 | 3300026121 | Ga0207683_10007252 | Ga0207683_100072526 | 255 |
| 71 | 3300028577 | Ga0265318_10000013 | Ga0265318_1000001370 | 255 |
| 72 | 3300031240 | Ga0265320_10008077 | Ga0265320_100080776 | 255 |
| 73 | 3300031344 | Ga0265316_10126239 | Ga0265316_101262392 | 255 |
| 74 | 3300031595 | Ga0265313_10016554 | Ga0265313_100165543 | 255 |
| 75 | 3300031711 | Ga0265314_10001603 | Ga0265314_1000160310 | 255 |
| 76 | 3300032004 | Ga0307414_10677457 | Ga0307414_106774571 | 255 |
| 77 | 3300032005 | Ga0307411_10431622 | Ga0307411_104316221 | 255 |
| 78 | 3300048904 | Ga0496101_0351586 | Ga0496101_0351586_177_947 | 255 |
| 79 | 3300048908 | Ga0496105_0099483 | Ga0496105_0099483_1513_2283 | 255 |
| 80 | 3300048909 | Ga0496106_0024989 | Ga0496106_0024989_1633_2403 | 255 |
| 81 | 3300048914 | Ga0496111_0374697 | Ga0496111_0374697_115_885 | 255 |
| 82 | 3300048917 | Ga0496114_0013085 | Ga0496114_0013085_4455_5225 | 255 |
| 83 | 3300050511 | nmdc:mga08y16_47278_c1 | nmdc:mga08y16_47278_c1_711_1481 | 255 |
| 84 | 3300005335 | Ga0070666_10006119 | Ga0070666_100061194 | 256 |
| 85 | 3300005338 | Ga0068868_100007691 | Ga0068868_1000076913 | 256 |
| 86 | 3300005355 | Ga0070671_100058216 | Ga0070671_1000582162 | 256 |
| 87 | 3300005367 | Ga0070667_100066172 | Ga0070667_1000661723 | 256 |
| 88 | 3300005441 | Ga0070700_100000001 | Ga0070700_100000001105 | 256 |
| 89 | 3300005468 | Ga0070707_100421799 | Ga0070707_1004217992 | 256 |
| 90 | 3300005535 | Ga0070684_100413474 | Ga0070684_1004134743 | 256 |
| 91 | 3300005563 | Ga0068855_100045404 | Ga0068855_1000454042 | 256 |
| 92 | 3300006195 | Ga0075366_10001746 | Ga0075366_1000174610 | 256 |
| 93 | 3300015683 | Ga0183362_10005 | Ga0183362_1000567 | 256 |
| 94 | 3300021358 | Ga0213873_10000018 | Ga0213873_10000018135 | 256 |
| 95 | 3300021384 | Ga0213876_10000058 | Ga0213876_10000058140 | 256 |
| 96 | 3300021384 | Ga0213876_10003656 | Ga0213876_100036562 | 256 |
| 97 | 3300025228 | Ga0209672_100532 | Ga0209672_10053217 | 256 |
| 98 | 3300025256 | Ga0209759_1030767 | Ga0209759_10307671 | 256 |
| 99 | 3300025903 | Ga0207680_10003093 | Ga0207680_100030936 | 256 |
| 100 | 3300025922 | Ga0207646_10375624 | Ga0207646_103756242 | 256 |
| 101 | 3300025931 | Ga0207644_10091547 | Ga0207644_100915472 | 256 |
| 102 | 3300025949 | Ga0207667_10050793 | Ga0207667_100507932 | 256 |
| 103 | 3300026023 | Ga0207677_10001576 | Ga0207677_1000157612 | 256 |
| 104 | 3300039437 | Ga0436365_0337700 | Ga0436365_0337700_39127_39906 | 256 |
| 105 | 3300039437 | Ga0436365_1806815 | Ga0436365_1806815_11544_12332 | 256 |
| 106 | 3300039453 | Ga0436362_0011715 | Ga0436362_0011715_42528_43307 | 256 |
| 107 | 3300042876 | Ga0451577_0008119 | Ga0451577_0008119_7628_8491 | 256 |
| 108 | 3300044712 | Ga0453684_0063928 | Ga0453684_0063928_3344_4207 | 256 |
| 109 | 3300046665 | Ga0495661_0100320 | Ga0495661_0100320_443_1213 | 256 |
| 110 | 3300050493 | nmdc:mga0k408_199_c1 | nmdc:mga0k408_199_c1_23101_23871 | 256 |
| 111 | 3300001979 | JGI24740J21852_10031276 | JGI24740J21852_100312762 | 257 |
| 112 | 3300001990 | JGI24737J22298_10050167 | JGI24737J22298_100501672 | 257 |
| 113 | 3300002705 | JGI25156J39149_1000313 | JGI25156J39149_100031320 | 257 |
| 114 | 3300002738 | JGI25154J39366_1000711 | JGI25154J39366_10007114 | 257 |
| 115 | 3300002739 | JGI25158J39367_1000009 | JGI25158J39367_100000918 | 257 |
| 116 | 3300002987 | JGI25159J45721_1000039 | JGI25159J45721_100003948 | 257 |
| 117 | 3300002987 | JGI25159J45721_1000074 | JGI25159J45721_10000742 | 257 |
| 118 | 3300002987 | JGI25159J45721_1000778 | JGI25159J45721_10007785 | 257 |
| 119 | 3300003354 | JGI25160J50197_1000106 | JGI25160J50197_100010632 | 257 |
| 120 | 3300003374 | JGI25161J50226_1000041 | JGI25161J50226_100004172 | 257 |
| 121 | 3300003374 | JGI25161J50226_1000115 | JGI25161J50226_100011527 | 257 |
| 122 | 3300003762 | Ga0055542_1011516 | Ga0055542_10115162 | 257 |
| 123 | 3300003771 | Ga0055526_1000076 | Ga0055526_100007660 | 257 |
| 124 | 3300003771 | Ga0055526_1002128 | Ga0055526_10021288 | 257 |
| 125 | 3300003773 | Ga0055537_1000295 | Ga0055537_10002952 | 257 |
| 126 | 3300003775 | Ga0055524_1002721 | Ga0055524_10027212 | 257 |
| 127 | 3300003784 | Ga0055534_1000047 | Ga0055534_100004751 | 257 |
| 128 | 3300003790 | Ga0055528_1000049 | Ga0055528_100004916 | 257 |
| 129 | 3300004625 | Ga0055543_1000092 | Ga0055543_100009223 | 257 |
| 130 | 3300004625 | Ga0055543_1000094 | Ga0055543_100009421 | 257 |
| 131 | 3300005262 | Ga0065165_1000434 | Ga0065165_100043423 | 257 |
| 132 | 3300005262 | Ga0065165_1000492 | Ga0065165_100049242 | 257 |
| 133 | 3300005333 | Ga0070677_10075155 | Ga0070677_100751552 | 257 |
| 134 | 3300005334 | Ga0068869_100152137 | Ga0068869_1001521372 | 257 |
| 135 | 3300005339 | Ga0070660_100000537 | Ga0070660_10000053711 | 257 |
| 136 | 3300005344 | Ga0070661_100119367 | Ga0070661_1001193673 | 257 |
| 137 | 3300005366 | Ga0070659_100002095 | Ga0070659_1000020955 | 257 |
| 138 | 3300005434 | Ga0070709_10237628 | Ga0070709_102376282 | 257 |
| 139 | 3300005455 | Ga0070663_100000402 | Ga0070663_10000040212 | 257 |
| 140 | 3300005468 | Ga0070707_100137730 | Ga0070707_1001377301 | 257 |
| 141 | 3300005539 | Ga0068853_100194437 | Ga0068853_1001944371 | 257 |
| 142 | 3300005545 | Ga0070695_100108780 | Ga0070695_1001087801 | 257 |
| 143 | 3300005563 | Ga0068855_100001138 | Ga0068855_10000113810 | 257 |
| 144 | 3300005563 | Ga0068855_100003503 | Ga0068855_10000350317 | 257 |
| 145 | 3300006944 | Ga0099823_1000364 | Ga0099823_100036418 | 257 |
| 146 | 3300009036 | Ga0105244_10000185 | Ga0105244_100001857 | 257 |
| 147 | 3300009092 | Ga0105250_10002832 | Ga0105250_100028326 | 257 |
| 148 | 3300009093 | Ga0105240_10024586 | Ga0105240_100245868 | 257 |
| 149 | 3300009177 | Ga0105248_10343064 | Ga0105248_103430642 | 257 |
| 150 | 3300009545 | Ga0105237_10059528 | Ga0105237_100595283 | 257 |
| 151 | 3300009545 | Ga0105237_10088923 | Ga0105237_100889232 | 257 |
| 152 | 3300009551 | Ga0105238_10027418 | Ga0105238_100274182 | 257 |
| 153 | 3300010375 | Ga0105239_10008956 | Ga0105239_100089562 | 257 |
| 154 | 3300013100 | Ga0157373_10022068 | Ga0157373_100220683 | 257 |
| 155 | 3300013100 | Ga0157373_10025559 | Ga0157373_100255594 | 257 |
| 156 | 3300013104 | Ga0157370_10023559 | Ga0157370_100235594 | 257 |
| 157 | 3300013296 | Ga0157374_10616182 | Ga0157374_106161821 | 257 |
| 158 | 3300013297 | Ga0157378_10198606 | Ga0157378_101986062 | 257 |
| 159 | 3300013307 | Ga0157372_10348251 | Ga0157372_103482512 | 257 |
| 160 | 3300014497 | Ga0182008_10081244 | Ga0182008_100812441 | 257 |
| 161 | 3300014969 | Ga0157376_10087717 | Ga0157376_100877172 | 257 |
| 162 | 3300015261 | Ga0182006_1025243 | Ga0182006_10252433 | 257 |
| 163 | 3300021361 | Ga0213872_10004417 | Ga0213872_100044174 | 257 |
| 164 | 3300021388 | Ga0213875_10032138 | Ga0213875_100321383 | 257 |
| 165 | 3300025208 | Ga0209436_100042 | Ga0209436_10004227 | 257 |
| 166 | 3300025256 | Ga0209759_1000562 | Ga0209759_100056215 | 257 |
| 167 | 3300025263 | Ga0209565_1000112 | Ga0209565_100011216 | 257 |
| 168 | 3300025273 | Ga0209673_1000210 | Ga0209673_100021071 | 257 |
| 169 | 3300025284 | Ga0209130_1000099 | Ga0209130_100009964 | 257 |
| 170 | 3300025284 | Ga0209130_1000227 | Ga0209130_100022723 | 257 |
| 171 | 3300025291 | Ga0209675_1000142 | Ga0209675_100014249 | 257 |
| 172 | 3300025295 | Ga0209564_1000245 | Ga0209564_100024570 | 257 |
| 173 | 3300025298 | Ga0209050_1000366 | Ga0209050_100036623 | 257 |
| 174 | 3300025299 | Ga0209256_1000252 | Ga0209256_100025249 | 257 |
| 175 | 3300025302 | Ga0207426_1000062 | Ga0207426_1000062229 | 257 |
| 176 | 3300025728 | Ga0207655_1002080 | Ga0207655_10020809 | 257 |
| 177 | 3300025904 | Ga0207647_10065262 | Ga0207647_100652621 | 257 |
| 178 | 3300025913 | Ga0207695_10011856 | Ga0207695_100118562 | 257 |
| 179 | 3300025919 | Ga0207657_10001827 | Ga0207657_1000182715 | 257 |
| 180 | 3300025924 | Ga0207694_10026822 | Ga0207694_100268222 | 257 |
| 181 | 3300025932 | Ga0207690_10000615 | Ga0207690_1000061515 | 257 |
| 182 | 3300025941 | Ga0207711_10498202 | Ga0207711_104982022 | 257 |
| 183 | 3300025949 | Ga0207667_10000427 | Ga0207667_1000042717 | 257 |
| 184 | 3300025949 | Ga0207667_10003296 | Ga0207667_1000329616 | 257 |
| 185 | 3300026041 | Ga0207639_10522633 | Ga0207639_105226332 | 257 |
| 186 | 3300026067 | Ga0207678_10006529 | Ga0207678_100065299 | 257 |
| 187 | 3300027296 | Ga0209389_1000144 | Ga0209389_100014454 | 257 |
| 188 | 3300027361 | Ga0209489_100625 | Ga0209489_10062554 | 257 |
| 189 | 3300028666 | Ga0265336_10000147 | Ga0265336_1000014739 | 257 |
| 190 | 3300028666 | Ga0265336_10062909 | Ga0265336_100629092 | 257 |
| 191 | 3300029957 | Ga0265324_10000090 | Ga0265324_1000009031 | 257 |
| 192 | 3300029957 | Ga0265324_10000381 | Ga0265324_100003813 | 257 |
| 193 | 3300029957 | Ga0265324_10077337 | Ga0265324_100773372 | 257 |
| 194 | 3300031241 | Ga0265325_10000271 | Ga0265325_1000027118 | 257 |
| 195 | 3300031250 | Ga0265331_10000024 | Ga0265331_10000024218 | 257 |
| 196 | 3300031251 | Ga0265327_10000079 | Ga0265327_1000007927 | 257 |
| 197 | 3300037312 | Ga0395899_0017908 | Ga0395899_0017908_2181_2954 | 257 |
| 198 | 3300037312 | Ga0395899_0139311 | Ga0395899_0139311_476_1381 | 257 |
| 199 | 3300037853 | Ga0436364_1397959 | Ga0436364_1397959_1215_1991 | 257 |
| 200 | 3300038443 | Ga0395901_0265841 | Ga0395901_0265841_339_1136 | 257 |
| 201 | 3300039447 | Ga0436361_0878496 | Ga0436361_0878496_23544_24317 | 257 |
| 202 | 3300042876 | Ga0451577_0007448 | Ga0451577_0007448_1961_2734 | 257 |
| 203 | 3300042876 | Ga0451577_0031747 | Ga0451577_0031747_3687_4460 | 257 |
| 204 | 3300044658 | Ga0466972_0132285 | Ga0466972_0132285_198_971 | 257 |
| 205 | 3300044673 | Ga0453683_0019296 | Ga0453683_0019296_964_1740 | 257 |
| 206 | 3300044673 | Ga0453683_0157983 | Ga0453683_0157983_525_1301 | 257 |
| 207 | 3300044712 | Ga0453684_0322275 | Ga0453684_0322275_560_1333 | 257 |
| 208 | 3300045051 | Ga0451576_0000006 | Ga0451576_0000006_675474_676247 | 257 |
| 209 | 3300045051 | Ga0451576_0000006 | Ga0451576_0000006_690839_691612 | 257 |
| 210 | 3300045051 | Ga0451576_0000535 | Ga0451576_0000535_66338_67114 | 257 |
| 211 | 3300045051 | Ga0451576_0000652 | Ga0451576_0000652_45552_46325 | 257 |
| 212 | 3300045051 | Ga0451576_0000868 | Ga0451576_0000868_35029_35802 | 257 |
| 213 | 3300045051 | Ga0451576_0005010 | Ga0451576_0005010_13279_14052 | 257 |
| 214 | 3300046453 | Ga0495627_000004 | Ga0495627_000004_35507_36280 | 257 |
| 215 | 3300046463 | Ga0495653_0000066 | Ga0495653_0000066_78187_78960 | 257 |
| 216 | 3300046492 | Ga0495585_0001745 | Ga0495585_0001745_1499_2272 | 257 |
| 217 | 3300046507 | Ga0495606_0000063 | Ga0495606_0000063_76447_77220 | 257 |
| 218 | 3300046507 | Ga0495606_0001879 | Ga0495606_0001879_12049_12822 | 257 |
| 219 | 3300046507 | Ga0495606_0002100 | Ga0495606_0002100_11824_12597 | 257 |
| 220 | 3300046512 | Ga0495610_0000647 | Ga0495610_0000647_4119_4892 | 257 |
| 221 | 3300046523 | Ga0495644_0050658 | Ga0495644_0050658_277_1050 | 257 |
| 222 | 3300046538 | Ga0495609_0001180 | Ga0495609_0001180_13775_14548 | 257 |
| 223 | 3300046542 | Ga0495597_0000069 | Ga0495597_0000069_16231_17004 | 257 |
| 224 | 3300046616 | Ga0495668_0000152 | Ga0495668_0000152_87199_87972 | 257 |
| 225 | 3300046692 | Ga0495671_0186972 | Ga0495671_0186972_62_835 | 257 |
| 226 | 3300046810 | Ga0495660_0010827 | Ga0495660_0010827_3019_3792 | 257 |
| 227 | 3300046810 | Ga0495660_0014570 | Ga0495660_0014570_2454_3227 | 257 |
| 228 | 3300046810 | Ga0495660_0079751 | Ga0495660_0079751_79_852 | 257 |
| 229 | 3300047320 | Ga0495672_0000125 | Ga0495672_0000125_23909_24682 | 257 |
| 230 | 3300047470 | Ga0495681_0000895 | Ga0495681_0000895_7306_8079 | 257 |
| 231 | 3300047472 | Ga0495686_0000860 | Ga0495686_0000860_6934_7707 | 257 |
| 232 | 3300048904 | Ga0496101_0193236 | Ga0496101_0193236_287_1060 | 257 |
| 233 | 3300048905 | Ga0496102_0224244 | Ga0496102_0224244_959_1744 | 257 |
| 234 | 3300048907 | Ga0496104_0034953 | Ga0496104_0034953_1446_2219 | 257 |
| 235 | 3300048908 | Ga0496105_0081161 | Ga0496105_0081161_1726_2499 | 257 |
| 236 | 3300048915 | Ga0496112_0359802 | Ga0496112_0359802_356_1129 | 257 |
| 237 | 3300048919 | Ga0496116_0084686 | Ga0496116_0084686_719_1492 | 257 |
| 238 | 3300048920 | Ga0496117_0251161 | Ga0496117_0251161_41_814 | 257 |
| 239 | 3300048921 | Ga0496118_0026364 | Ga0496118_0026364_2443_3216 | 257 |
| 240 | 3300048921 | Ga0496118_0110752 | Ga0496118_0110752_287_1060 | 257 |
| 241 | 3300048924 | Ga0496121_0006329 | Ga0496121_0006329_518_1291 | 257 |
| 242 | 3300048924 | Ga0496121_0022337 | Ga0496121_0022337_5125_5898 | 257 |
| 243 | 3300048926 | Ga0496123_0006732 | Ga0496123_0006732_2559_3332 | 257 |
| 244 | 3300048926 | Ga0496123_0055548 | Ga0496123_0055548_1183_1956 | 257 |
| 245 | 3300048927 | Ga0496124_0160342 | Ga0496124_0160342_911_1684 | 257 |
| 246 | 3300048928 | Ga0496125_0007187 | Ga0496125_0007187_1684_2457 | 257 |
| 247 | 3300048929 | Ga0496126_0005982 | Ga0496126_0005982_9518_10291 | 257 |
| 248 | 3300050493 | nmdc:mga0k408_21372_c1 | nmdc:mga0k408_21372_c1_658_1431 | 257 |
| 249 | 3300053117 | Ga0500593_000159 | Ga0500593_000159_21279_22055 | 257 |
| 250 | 3300053125 | Ga0500618_029182 | Ga0500618_029182_199_972 | 257 |
| 251 | 3300053730 | Ga0500645_000061 | Ga0500645_000061_48036_48812 | 257 |
| 252 | 3300053730 | Ga0500645_000257 | Ga0500645_000257_14412_15188 | 257 |
| 253 | 3300059508 | Ga0587088_015160 | Ga0587088_015160_393_1166 | 257 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tzf-assembly1.cif.gz_A | x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi | 0.9185 | 2 | 256 |
| 1wvc-assembly1.cif.gz_A | alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp | 0.9147 | 2 | 256 |
| 1wvc-assembly1.cif.gz_A | alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp | 0.9052 | 2 | 256 |
| 1tzf-assembly1.cif.gz_A | x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi | 0.9046 | 2 | 256 |
| 4y7t-assembly1.cif.gz_A | structural analysis of muru | 0.832 | 1 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tzfA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9185 | 2 | 256 | 3.90.550.10 |
| 1tzfA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9046 | 2 | 256 | 3.90.550.10 |
| af_A4I3X5_10_117_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8315 | 1 | 106 | 3.90.550.10 |
| 4y7vA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8109 | 1 | 246 | 3.90.550.10 |
| af_L7N6A5_2_240_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8064 | 2 | 248 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838W7T2-F1-model_v4 | NTP transferase domain-containing protein | 0.9651 | 1 | 94 |
GO:0047343
|
| AF-A0A2K9ZBA7-F1-model_v4 | Glucose-1-phosphate cytidylyltransferase (Modular protein) (EC 2.7.7.33) | 0.964 | 1 | 256 |
GO:0009243
GO:0047343 |
| AF-A0A383BKH4-F1-model_v4 | Nucleotidyl transferase domain-containing protein | 0.9639 | 1 | 149 |
GO:0009058
GO:0047343 |
| AF-A0A6N6SEA7-F1-model_v4 | Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) | 0.9638 | 1 | 255 |
GO:0009243
GO:0047343 |
| AF-A0A523XVD3-F1-model_v4 | Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) | 0.9633 | 27 | 256 |
GO:0009243
GO:0047343 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar