F363388
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 252 | 213 | 504 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0027176|Ga0395900_0027176_4287_5081 |
| Length | 264 |
| Sequence | LLQYIFIAVTSSQISRRGAVGAGVEIRGLAKRYVTGKTTVSALDGVDLTAEPGALVAIMGPSGSGKSTLLHLVGAMDSADSGEIVVGDLQVTSLSRGEQVAYRRRIGFVFQRFHLLPALTALDNVLAPVLPYKTDFDKDERGRELLTAVGLGGREESLPSELSGGEQQRIAIARALVNDPILVLADEPTGNLDSQTSSEIVDLLLDLREQRGMTVFIGTHDAVVASRCDRIVRLFDGQIVDEVEVPGDLEPDVVLDRITRVEGT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 2 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 19 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 20 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 21 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 22 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 23 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 24 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 26 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 27 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 28 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 29 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 30 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 31 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 32 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 46 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 65 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 68 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 69 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 70 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 71 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 72 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 73 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 74 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 75 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 76 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 77 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 78 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 79 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 80 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 81 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 82 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 83 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 84 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 85 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 86 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 87 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 88 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 89 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 90 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 91 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 92 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 93 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 94 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 95 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 96 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 97 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 98 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 99 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 100 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 101 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 102 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 103 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 104 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 105 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 106 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 153 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 154 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 157 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 158 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 159 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 160 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 161 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 174 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 175 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 176 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 178 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 190 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 191 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 192 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 193 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 194 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 195 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 196 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 197 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 198 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 199 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 200 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 201 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 202 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 203 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 204 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 205 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 206 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 207 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 208 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 209 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 210 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 211 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 212 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 213 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.48 |
| Metatranscriptomes | 0.4 |
| Isolates | 9.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.79 |
| Nodule | 1.19 |
| Rhizoplane | 3.17 |
| Rhizosphere | 88.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395900_0027176 | 3300037418 | Bacteria | 5860 |
| 2 | Ga0006562J51391_1048486 | 3300003578 | Bacteria | 990 |
| 3 | Ga0065704_10100112 | 3300005289 | Bacteria | 2286 |
| 4 | Ga0065707_10109112 | 3300005295 | Bacteria | 2482 |
| 5 | Ga0070670_100046634 | 3300005331 | Bacteria | 3727 |
| 6 | Ga0070680_100208887 | 3300005336 | Bacteria | 1647 |
| 7 | Ga0070668_100146546 | 3300005347 | Bacteria | 1906 |
| 8 | Ga0070673_100313344 | 3300005364 | Bacteria | 1384 |
| 9 | Ga0070703_10000077 | 3300005406 | Bacteria | 48491 |
| 10 | Ga0070700_100211536 | 3300005441 | Bacteria | 1369 |
| 11 | Ga0070694_100008485 | 3300005444 | Bacteria | 6287 |
| 12 | Ga0070698_100012976 | 3300005471 | Bacteria | 8821 |
| 13 | Ga0070684_100404269 | 3300005535 | Bacteria | 1259 |
| 14 | Ga0070686_100313640 | 3300005544 | Bacteria | 1167 |
| 15 | Ga0070695_100655439 | 3300005545 | Bacteria | 829 |
| 16 | Ga0070665_100179853 | 3300005548 | Bacteria | 2116 |
| 17 | Ga0070664_100157750 | 3300005564 | Bacteria | 2006 |
| 18 | Ga0068857_100378729 | 3300005577 | Bacteria | 1314 |
| 19 | Ga0068864_100036778 | 3300005618 | Bacteria | 4175 |
| 20 | Ga0068864_100047203 | 3300005618 | Bacteria | 3698 |
| 21 | Ga0068860_100193476 | 3300005843 | Bacteria | 1969 |
| 22 | Ga0068862_100076585 | 3300005844 | Bacteria | 2895 |
| 23 | Ga0081538_10000631 | 3300005981 | Bacteria | 39014 |
| 24 | Ga0081539_10001866 | 3300005985 | Bacteria | 33101 |
| 25 | Ga0070712_100743786 | 3300006175 | Bacteria | 839 |
| 26 | Ga0068871_100598230 | 3300006358 | Bacteria | 1003 |
| 27 | Ga0075428_100029583 | 3300006844 | Bacteria | 6060 |
| 28 | Ga0075428_100058617 | 3300006844 | Unclassified | 4215 |
| 29 | Ga0075428_100240239 | 3300006844 | Bacteria | 1954 |
| 30 | Ga0075431_100027198 | 3300006847 | Bacteria | 5867 |
| 31 | Ga0075433_10012833 | 3300006852 | Bacteria | 6789 |
| 32 | Ga0075433_10073354 | 3300006852 | Bacteria | 3010 |
| 33 | Ga0075429_100028082 | 3300006880 | Bacteria | 4883 |
| 34 | Ga0075436_100000013 | 3300006914 | Bacteria | 177118 |
| 35 | Ga0075435_100000917 | 3300007076 | Bacteria | 18572 |
| 36 | Ga0105251_10014511 | 3300009011 | Bacteria | 4349 |
| 37 | Ga0111539_10160702 | 3300009094 | Bacteria | 2627 |
| 38 | Ga0105245_10091680 | 3300009098 | Bacteria | 2797 |
| 39 | Ga0105245_10865292 | 3300009098 | Bacteria | 944 |
| 40 | Ga0114129_10015266 | 3300009147 | Bacteria | 10931 |
| 41 | Ga0114129_10087174 | 3300009147 | Bacteria | 4329 |
| 42 | Ga0114129_10479415 | 3300009147 | Bacteria | 1628 |
| 43 | Ga0105243_10138942 | 3300009148 | Bacteria | 2070 |
| 44 | Ga0105248_10082867 | 3300009177 | Bacteria | 3608 |
| 45 | Ga0105248_10317127 | 3300009177 | Bacteria | 1756 |
| 46 | Ga0105238_10096943 | 3300009551 | Bacteria | 2935 |
| 47 | Ga0105249_10050642 | 3300009553 | Bacteria | 3786 |
| 48 | Ga0105249_10240603 | 3300009553 | Bacteria | 1789 |
| 49 | Ga0105249_10373894 | 3300009553 | Bacteria | 1449 |
| 50 | Ga0105246_10651740 | 3300011119 | Bacteria | 917 |
| 51 | Ga0157374_10006409 | 3300013296 | Bacteria | 9989 |
| 52 | Ga0163162_10006807 | 3300013306 | Bacteria | 11088 |
| 53 | Ga0163163_10605295 | 3300014325 | Bacteria | 1159 |
| 54 | Ga0157380_10093882 | 3300014326 | Bacteria | 2482 |
| 55 | Ga0213872_10039981 | 3300021361 | Bacteria | 2141 |
| 56 | Ga0209758_1019442 | 3300025297 | Bacteria | 3273 |
| 57 | Ga0207426_1025458 | 3300025302 | Bacteria | 1992 |
| 58 | Ga0207713_1031647 | 3300025735 | Bacteria | 2335 |
| 59 | Ga0207653_10000326 | 3300025885 | Bacteria | 25312 |
| 60 | Ga0207660_10410703 | 3300025917 | Bacteria | 1091 |
| 61 | Ga0207646_10816659 | 3300025922 | Bacteria | 830 |
| 62 | Ga0207694_10076581 | 3300025924 | Bacteria | 2620 |
| 63 | Ga0207687_10041857 | 3300025927 | Bacteria | 3148 |
| 64 | Ga0207687_10171978 | 3300025927 | Bacteria | 1671 |
| 65 | Ga0207687_10582358 | 3300025927 | Bacteria | 942 |
| 66 | Ga0207664_10038934 | 3300025929 | Bacteria | 3688 |
| 67 | Ga0207691_10225061 | 3300025940 | Bacteria | 1626 |
| 68 | Ga0207711_10162931 | 3300025941 | Bacteria | 2020 |
| 69 | Ga0207711_10210540 | 3300025941 | Bacteria | 1776 |
| 70 | Ga0207679_10338818 | 3300025945 | Bacteria | 1307 |
| 71 | Ga0207651_10289171 | 3300025960 | Bacteria | 1358 |
| 72 | Ga0207658_10162397 | 3300025986 | Bacteria | 1832 |
| 73 | Ga0207708_10122811 | 3300026075 | Bacteria | 2024 |
| 74 | Ga0207708_10134004 | 3300026075 | Bacteria | 1939 |
| 75 | Ga0207641_10188035 | 3300026088 | Bacteria | 1896 |
| 76 | Ga0207641_10345564 | 3300026088 | Bacteria | 1417 |
| 77 | Ga0207641_10375442 | 3300026088 | Bacteria | 1360 |
| 78 | Ga0207676_10074888 | 3300026095 | Bacteria | 2729 |
| 79 | Ga0207676_10433858 | 3300026095 | Bacteria | 1235 |
| 80 | Ga0207674_10643068 | 3300026116 | Bacteria | 1024 |
| 81 | Ga0207428_10303295 | 3300027907 | Bacteria | 1182 |
| 82 | Ga0268265_10044177 | 3300028380 | Bacteria | 3317 |
| 83 | Ga0268264_10582803 | 3300028381 | Bacteria | 1101 |
| 84 | Ga0265325_10144254 | 3300031241 | Bacteria | 1130 |
| 85 | Ga0265340_10163796 | 3300031247 | Bacteria | 1009 |
| 86 | Ga0265339_10029513 | 3300031249 | Bacteria | 3111 |
| 87 | Ga0265316_10439026 | 3300031344 | Bacteria | 937 |
| 88 | Ga0265313_10024290 | 3300031595 | Bacteria | 3240 |
| 89 | Ga0265314_10109967 | 3300031711 | Bacteria | 1753 |
| 90 | Ga0265342_10195771 | 3300031712 | Bacteria | 1101 |
| 91 | Ga0307406_10113500 | 3300031901 | Bacteria | 1870 |
| 92 | Ga0307406_10405388 | 3300031901 | Bacteria | 1082 |
| 93 | Ga0307412_10071159 | 3300031911 | Bacteria | 2373 |
| 94 | Ga0307416_100267640 | 3300032002 | Bacteria | 1675 |
| 95 | Ga0307411_10573253 | 3300032005 | Bacteria | 966 |
| 96 | Ga0373951_0000040 | 3300035091 | Bacteria | 51161 |
| 97 | Ga0373923_0083483 | 3300035111 | Bacteria | 1388 |
| 98 | Ga0373925_0255962 | 3300037068 | Bacteria | 1405 |
| 99 | Ga0395899_0133543 | 3300037312 | Bacteria | 1771 |
| 100 | Ga0395898_0037122 | 3300037466 | Bacteria | 4835 |
| 101 | Ga0395905_0023438 | 3300037471 | Bacteria | 5832 |
| 102 | Ga0436364_0681904 | 3300037853 | Bacteria | 1155 |
| 103 | Ga0395901_0074121 | 3300038443 | Bacteria | 3551 |
| 104 | Ga0395901_0144216 | 3300038443 | Bacteria | 2503 |
| 105 | Ga0436365_0936514 | 3300039437 | Bacteria | 806 |
| 106 | Ga0436360_1094473 | 3300039438 | Bacteria | 7502 |
| 107 | Ga0436361_1013072 | 3300039447 | Bacteria | 10141 |
| 108 | Ga0436362_1026367 | 3300039453 | Bacteria | 2415 |
| 109 | Ga0439451_038528 | 3300042009 | Bacteria | 960 |
| 110 | Ga0451577_0064367 | 3300042876 | Bacteria | 3270 |
| 111 | Ga0466972_0000990 | 3300044658 | Bacteria | 13672 |
| 112 | Ga0466965_0000281 | 3300044683 | Bacteria | 16772 |
| 113 | Ga0466966_0026876 | 3300044684 | Bacteria | 3753 |
| 114 | Ga0466963_0000391 | 3300044694 | Bacteria | 19979 |
| 115 | Ga0466964_0011207 | 3300044706 | Bacteria | 3385 |
| 116 | Ga0466964_0058395 | 3300044706 | Bacteria | 1599 |
| 117 | Ga0453684_0002151 | 3300044712 | Bacteria | 49340 |
| 118 | Ga0453684_0170404 | 3300044712 | Bacteria | 2566 |
| 119 | Ga0453684_0347653 | 3300044712 | Bacteria | 1673 |
| 120 | Ga0466971_0004549 | 3300044719 | Bacteria | 5998 |
| 121 | Ga0466971_0072460 | 3300044719 | Bacteria | 1565 |
| 122 | Ga0466968_0086108 | 3300044735 | Bacteria | 1387 |
| 123 | Ga0466970_0012726 | 3300044765 | Bacteria | 4304 |
| 124 | Ga0466957_0017939 | 3300044842 | Bacteria | 4151 |
| 125 | Ga0466960_0000141 | 3300044901 | Bacteria | 24549 |
| 126 | Ga0451576_0015566 | 3300045051 | Bacteria | 8419 |
| 127 | Ga0466958_0000133 | 3300045836 | Bacteria | 24894 |
| 128 | Ga0466958_0106280 | 3300045836 | Bacteria | 1750 |
| 129 | Ga0466967_0022486 | 3300045976 | Bacteria | 5146 |
| 130 | Ga0466967_0084023 | 3300045976 | Bacteria | 2880 |
| 131 | Ga0466967_0085478 | 3300045976 | Bacteria | 2856 |
| 132 | Ga0466967_0275830 | 3300045976 | Bacteria | 1612 |
| 133 | Ga0466967_0359686 | 3300045976 | Bacteria | 1410 |
| 134 | Ga0466967_0394524 | 3300045976 | Bacteria | 1345 |
| 135 | Ga0495592_0039005 | 3300046454 | Bacteria | 3570 |
| 136 | Ga0495629_0056250 | 3300046459 | Bacteria | 2751 |
| 137 | Ga0495651_0106082 | 3300046462 | Bacteria | 2083 |
| 138 | Ga0495582_0025202 | 3300046473 | Bacteria | 3258 |
| 139 | Ga0495605_0001560 | 3300046474 | Bacteria | 14882 |
| 140 | Ga0495639_0032568 | 3300046475 | Bacteria | 2325 |
| 141 | Ga0495662_0008024 | 3300046476 | Bacteria | 5199 |
| 142 | Ga0495664_0107238 | 3300046477 | Bacteria | 1685 |
| 143 | Ga0495664_0112577 | 3300046477 | Bacteria | 1643 |
| 144 | Ga0495585_0025509 | 3300046492 | Bacteria | 3383 |
| 145 | Ga0495607_0062924 | 3300046501 | Bacteria | 2101 |
| 146 | Ga0495583_0088457 | 3300046506 | Bacteria | 1337 |
| 147 | Ga0495606_0019952 | 3300046507 | Bacteria | 4962 |
| 148 | Ga0495610_0021878 | 3300046512 | Bacteria | 3509 |
| 149 | Ga0495616_0009625 | 3300046513 | Bacteria | 5636 |
| 150 | Ga0495618_0145299 | 3300046514 | Bacteria | 1516 |
| 151 | Ga0495620_0005440 | 3300046515 | Bacteria | 7101 |
| 152 | Ga0495628_0082250 | 3300046516 | Bacteria | 2501 |
| 153 | Ga0495631_0004146 | 3300046518 | Bacteria | 7768 |
| 154 | Ga0495640_0003430 | 3300046533 | Bacteria | 12761 |
| 155 | Ga0495640_0027338 | 3300046533 | Bacteria | 4115 |
| 156 | Ga0495609_0068681 | 3300046538 | Bacteria | 1559 |
| 157 | Ga0495621_0014651 | 3300046539 | Bacteria | 2486 |
| 158 | Ga0495645_0027585 | 3300046543 | Bacteria | 4127 |
| 159 | Ga0495633_0009380 | 3300046558 | Bacteria | 5411 |
| 160 | Ga0495668_0026585 | 3300046616 | Bacteria | 3282 |
| 161 | Ga0495634_0040966 | 3300046642 | Bacteria | 3147 |
| 162 | Ga0495611_0006165 | 3300046648 | Bacteria | 5116 |
| 163 | Ga0495611_0036474 | 3300046648 | Bacteria | 2182 |
| 164 | Ga0495625_0010858 | 3300046660 | Bacteria | 7486 |
| 165 | Ga0495659_0013166 | 3300046664 | Bacteria | 2690 |
| 166 | Ga0495588_0000878 | 3300046674 | Bacteria | 13283 |
| 167 | Ga0495657_0025170 | 3300046675 | Bacteria | 4230 |
| 168 | Ga0495669_0246033 | 3300046684 | Bacteria | 859 |
| 169 | Ga0495613_0009838 | 3300046689 | Bacteria | 7111 |
| 170 | Ga0495613_0101523 | 3300046689 | Bacteria | 2077 |
| 171 | Ga0495613_0139565 | 3300046689 | Bacteria | 1732 |
| 172 | Ga0495624_0081620 | 3300046690 | Bacteria | 2002 |
| 173 | Ga0495649_0013433 | 3300046694 | Bacteria | 4724 |
| 174 | Ga0495589_0004773 | 3300046794 | Bacteria | 7204 |
| 175 | Ga0495600_0113569 | 3300046809 | Bacteria | 1763 |
| 176 | Ga0495660_0004951 | 3300046810 | Bacteria | 8020 |
| 177 | Ga0495581_0078725 | 3300047315 | Bacteria | 1907 |
| 178 | Ga0495581_0316108 | 3300047315 | Bacteria | 912 |
| 179 | Ga0495604_0016500 | 3300047317 | Bacteria | 5904 |
| 180 | Ga0495636_0047257 | 3300047318 | Bacteria | 1797 |
| 181 | Ga0495676_0014390 | 3300047321 | Bacteria | 7080 |
| 182 | Ga0495687_046925 | 3300047443 | Bacteria | 1861 |
| 183 | Ga0495677_0109792 | 3300047445 | Bacteria | 1048 |
| 184 | Ga0495685_014195 | 3300047447 | Bacteria | 2706 |
| 185 | Ga0495686_0118551 | 3300047472 | Bacteria | 1580 |
| 186 | Ga0495593_0122844 | 3300047673 | Bacteria | 1321 |
| 187 | Ga0496105_0302433 | 3300048908 | Bacteria | 1286 |
| 188 | Ga0496107_0066126 | 3300048910 | Bacteria | 2621 |
| 189 | Ga0496108_0023670 | 3300048911 | Bacteria | 5054 |
| 190 | Ga0496109_0012015 | 3300048912 | Bacteria | 7457 |
| 191 | Ga0496110_0094358 | 3300048913 | Bacteria | 2679 |
| 192 | Ga0496111_0340383 | 3300048914 | Bacteria | 1110 |
| 193 | Ga0496112_0078781 | 3300048915 | Bacteria | 3258 |
| 194 | Ga0496112_0162591 | 3300048915 | Bacteria | 2199 |
| 195 | Ga0496121_0181188 | 3300048924 | Bacteria | 1520 |
| 196 | Ga0496123_0218241 | 3300048926 | Bacteria | 964 |
| 197 | Ga0501031_0016463 | 3300049568 | Bacteria | 4803 |
| 198 | Ga0501032_0260361 | 3300049569 | Bacteria | 1125 |
| 199 | Ga0501038_0104652 | 3300049574 | Bacteria | 2352 |
| 200 | Ga0501039_0047668 | 3300049575 | Bacteria | 3312 |
| 201 | Ga0501040_0011318 | 3300049576 | Bacteria | 5839 |
| 202 | Ga0501041_0059703 | 3300049577 | Bacteria | 2334 |
| 203 | Ga0501042_0023796 | 3300049578 | Bacteria | 4290 |
| 204 | Ga0501043_0015851 | 3300049579 | Bacteria | 5907 |
| 205 | Ga0501048_0024457 | 3300049582 | Bacteria | 4409 |
| 206 | Ga0501071_0029642 | 3300049587 | Bacteria | 3864 |
| 207 | Ga0501072_0043630 | 3300049588 | Bacteria | 3525 |
| 208 | Ga0501075_0091194 | 3300049591 | Bacteria | 2313 |
| 209 | Ga0501199_006763 | 3300049650 | Bacteria | 1174 |
| 210 | Ga0501235_023888 | 3300049669 | Bacteria | 1364 |
| 211 | Ga0501257_004247 | 3300049686 | Bacteria | 3120 |
| 212 | Ga0501079_0073080 | 3300049741 | Bacteria | 2651 |
| 213 | Ga0501266_005709 | 3300049763 | Bacteria | 1546 |
| 214 | Ga0501044_0026715 | 3300049823 | Bacteria | 6110 |
| 215 | Ga0501045_0013282 | 3300049824 | Bacteria | 5814 |
| 216 | nmdc:mga05p37_348455_c1 | 3300050507 | Bacteria | 1744 |
| 217 | nmdc:mga05p37_70362_c1 | 3300050507 | Bacteria | 4303 |
| 218 | nmdc:mga09592_23327_c1 | 3300050508 | Bacteria | 5110 |
| 219 | nmdc:mga06r32_132901_c1 | 3300050510 | Unclassified | 2462 |
| 220 | nmdc:mga06r32_83469_c1 | 3300050510 | Bacteria | 3113 |
| 221 | nmdc:mga08y16_67116_c1 | 3300050511 | Bacteria | 3742 |
| 222 | nmdc:mga0rr50_102_c1 | 3300050513 | Bacteria | 48211 |
| 223 | nmdc:mga08x19_29_c1 | 3300050514 | Bacteria | 214647 |
| 224 | nmdc:mga0a205_27164_c1 | 3300050515 | Bacteria | 5465 |
| 225 | Ga0501084_0028583 | 3300054114 | Bacteria | 4661 |
| 226 | Ga0501082_0039207 | 3300060353 | Bacteria | 4088 |
| 227 | Ga0466962_0000323 | 3300061719 | Bacteria | 20489 |
| 228 | Ga0466962_0055548 | 3300061719 | Bacteria | 1892 |
| 229 | Ga0530510_0046010 | 3300061734 | Bacteria | 3153 |
| 230 | 2515723046 | 2515154129 | Bacteria | 5584369 |
| 231 | 2585311807 | 2582581314 | Bacteria | 11452267 |
| 232 | 2644441664 | 2643221678 | Bacteria | 9540101 |
| 233 | 2644626541 | 2643221714 | Bacteria | 9015452 |
| 234 | 2808849237 | 2808606359 | Bacteria | 9866990 |
| 235 | 2855671236 | 2855670206 | Bacteria | 7120389 |
| 236 | 2857289805 | 2857288857 | Bacteria | 7189066 |
| 237 | 2858883907 | 2858882152 | Bacteria | 7230291 |
| 238 | 2862285067 | 2862281513 | Bacteria | 9621493 |
| 239 | 2867433503 | 2867428634 | Bacteria | 9590268 |
| 240 | 2869067531 | 2869061728 | Bacteria | 7112407 |
| 241 | 2869071315 | 2869068681 | Bacteria | 7205615 |
| 242 | 2880493233 | 2880489317 | Bacteria | 7096270 |
| 243 | 2880499078 | 2880495981 | Bacteria | 7340502 |
| 244 | 2887481783 | 2887478801 | Bacteria | 8972725 |
| 245 | 2954713770 | 2954711539 | Bacteria | 10867210 |
| 246 | 2954723737 | 2954721474 | Bacteria | 10456478 |
| 247 | 2954738099 | 2954731030 | Bacteria | 10243860 |
| 248 | 2954742637 | 2954740390 | Bacteria | 10229294 |
| 249 | 2954756957 | 2954749733 | Bacteria | 10366972 |
| 250 | 2954761601 | 2954759201 | Bacteria | 9358192 |
| 251 | 8054736389 | 8054734606 | Bacteria | 6947278 |
| 252 | 8055176616 | 8055172936 | Bacteria | 9305943 |
| 253 | Ga0395900_0027176 | |||
| 254 | Ga0006562J51391_1048486 | |||
| 255 | Ga0065704_10100112 | |||
| 256 | Ga0065707_10109112 | |||
| 257 | Ga0070670_100046634 | |||
| 258 | Ga0070680_100208887 | |||
| 259 | Ga0070668_100146546 | |||
| 260 | Ga0070673_100313344 | |||
| 261 | Ga0070703_10000077 | |||
| 262 | Ga0070700_100211536 | |||
| 263 | Ga0070694_100008485 | |||
| 264 | Ga0070698_100012976 | |||
| 265 | Ga0070684_100404269 | |||
| 266 | Ga0070686_100313640 | |||
| 267 | Ga0070695_100655439 | |||
| 268 | Ga0070665_100179853 | |||
| 269 | Ga0070664_100157750 | |||
| 270 | Ga0068857_100378729 | |||
| 271 | Ga0068864_100036778 | |||
| 272 | Ga0068864_100047203 | |||
| 273 | Ga0068860_100193476 | |||
| 274 | Ga0068862_100076585 | |||
| 275 | Ga0081538_10000631 | |||
| 276 | Ga0081539_10001866 | |||
| 277 | Ga0070712_100743786 | |||
| 278 | Ga0068871_100598230 | |||
| 279 | Ga0075428_100029583 | |||
| 280 | Ga0075428_100058617 | |||
| 281 | Ga0075428_100240239 | |||
| 282 | Ga0075431_100027198 | |||
| 283 | Ga0075433_10012833 | |||
| 284 | Ga0075433_10073354 | |||
| 285 | Ga0075429_100028082 | |||
| 286 | Ga0075436_100000013 | |||
| 287 | Ga0075435_100000917 | |||
| 288 | Ga0105251_10014511 | |||
| 289 | Ga0111539_10160702 | |||
| 290 | Ga0105245_10091680 | |||
| 291 | Ga0105245_10865292 | |||
| 292 | Ga0114129_10015266 | |||
| 293 | Ga0114129_10087174 | |||
| 294 | Ga0114129_10479415 | |||
| 295 | Ga0105243_10138942 | |||
| 296 | Ga0105248_10082867 | |||
| 297 | Ga0105248_10317127 | |||
| 298 | Ga0105238_10096943 | |||
| 299 | Ga0105249_10050642 | |||
| 300 | Ga0105249_10240603 | |||
| 301 | Ga0105249_10373894 | |||
| 302 | Ga0105246_10651740 | |||
| 303 | Ga0157374_10006409 | |||
| 304 | Ga0163162_10006807 | |||
| 305 | Ga0163163_10605295 | |||
| 306 | Ga0157380_10093882 | |||
| 307 | Ga0213872_10039981 | |||
| 308 | Ga0209758_1019442 | |||
| 309 | Ga0207426_1025458 | |||
| 310 | Ga0207713_1031647 | |||
| 311 | Ga0207653_10000326 | |||
| 312 | Ga0207660_10410703 | |||
| 313 | Ga0207646_10816659 | |||
| 314 | Ga0207694_10076581 | |||
| 315 | Ga0207687_10041857 | |||
| 316 | Ga0207687_10171978 | |||
| 317 | Ga0207687_10582358 | |||
| 318 | Ga0207664_10038934 | |||
| 319 | Ga0207691_10225061 | |||
| 320 | Ga0207711_10162931 | |||
| 321 | Ga0207711_10210540 | |||
| 322 | Ga0207679_10338818 | |||
| 323 | Ga0207651_10289171 | |||
| 324 | Ga0207658_10162397 | |||
| 325 | Ga0207708_10122811 | |||
| 326 | Ga0207708_10134004 | |||
| 327 | Ga0207641_10188035 | |||
| 328 | Ga0207641_10345564 | |||
| 329 | Ga0207641_10375442 | |||
| 330 | Ga0207676_10074888 | |||
| 331 | Ga0207676_10433858 | |||
| 332 | Ga0207674_10643068 | |||
| 333 | Ga0207428_10303295 | |||
| 334 | Ga0268265_10044177 | |||
| 335 | Ga0268264_10582803 | |||
| 336 | Ga0265325_10144254 | |||
| 337 | Ga0265340_10163796 | |||
| 338 | Ga0265339_10029513 | |||
| 339 | Ga0265316_10439026 | |||
| 340 | Ga0265313_10024290 | |||
| 341 | Ga0265314_10109967 | |||
| 342 | Ga0265342_10195771 | |||
| 343 | Ga0307406_10113500 | |||
| 344 | Ga0307406_10405388 | |||
| 345 | Ga0307412_10071159 | |||
| 346 | Ga0307416_100267640 | |||
| 347 | Ga0307411_10573253 | |||
| 348 | Ga0373951_0000040 | |||
| 349 | Ga0373923_0083483 | |||
| 350 | Ga0373925_0255962 | |||
| 351 | Ga0395899_0133543 | |||
| 352 | Ga0395898_0037122 | |||
| 353 | Ga0395905_0023438 | |||
| 354 | Ga0436364_0681904 | |||
| 355 | Ga0395901_0074121 | |||
| 356 | Ga0395901_0144216 | |||
| 357 | Ga0436365_0936514 | |||
| 358 | Ga0436360_1094473 | |||
| 359 | Ga0436361_1013072 | |||
| 360 | Ga0436362_1026367 | |||
| 361 | Ga0439451_038528 | |||
| 362 | Ga0451577_0064367 | |||
| 363 | Ga0466972_0000990 | |||
| 364 | Ga0466965_0000281 | |||
| 365 | Ga0466966_0026876 | |||
| 366 | Ga0466963_0000391 | |||
| 367 | Ga0466964_0011207 | |||
| 368 | Ga0466964_0058395 | |||
| 369 | Ga0453684_0002151 | |||
| 370 | Ga0453684_0170404 | |||
| 371 | Ga0453684_0347653 | |||
| 372 | Ga0466971_0004549 | |||
| 373 | Ga0466971_0072460 | |||
| 374 | Ga0466968_0086108 | |||
| 375 | Ga0466970_0012726 | |||
| 376 | Ga0466957_0017939 | |||
| 377 | Ga0466960_0000141 | |||
| 378 | Ga0451576_0015566 | |||
| 379 | Ga0466958_0000133 | |||
| 380 | Ga0466958_0106280 | |||
| 381 | Ga0466967_0022486 | |||
| 382 | Ga0466967_0084023 | |||
| 383 | Ga0466967_0085478 | |||
| 384 | Ga0466967_0275830 | |||
| 385 | Ga0466967_0359686 | |||
| 386 | Ga0466967_0394524 | |||
| 387 | Ga0495592_0039005 | |||
| 388 | Ga0495629_0056250 | |||
| 389 | Ga0495651_0106082 | |||
| 390 | Ga0495582_0025202 | |||
| 391 | Ga0495605_0001560 | |||
| 392 | Ga0495639_0032568 | |||
| 393 | Ga0495662_0008024 | |||
| 394 | Ga0495664_0107238 | |||
| 395 | Ga0495664_0112577 | |||
| 396 | Ga0495585_0025509 | |||
| 397 | Ga0495607_0062924 | |||
| 398 | Ga0495583_0088457 | |||
| 399 | Ga0495606_0019952 | |||
| 400 | Ga0495610_0021878 | |||
| 401 | Ga0495616_0009625 | |||
| 402 | Ga0495618_0145299 | |||
| 403 | Ga0495620_0005440 | |||
| 404 | Ga0495628_0082250 | |||
| 405 | Ga0495631_0004146 | |||
| 406 | Ga0495640_0003430 | |||
| 407 | Ga0495640_0027338 | |||
| 408 | Ga0495609_0068681 | |||
| 409 | Ga0495621_0014651 | |||
| 410 | Ga0495645_0027585 | |||
| 411 | Ga0495633_0009380 | |||
| 412 | Ga0495668_0026585 | |||
| 413 | Ga0495634_0040966 | |||
| 414 | Ga0495611_0006165 | |||
| 415 | Ga0495611_0036474 | |||
| 416 | Ga0495625_0010858 | |||
| 417 | Ga0495659_0013166 | |||
| 418 | Ga0495588_0000878 | |||
| 419 | Ga0495657_0025170 | |||
| 420 | Ga0495669_0246033 | |||
| 421 | Ga0495613_0009838 | |||
| 422 | Ga0495613_0101523 | |||
| 423 | Ga0495613_0139565 | |||
| 424 | Ga0495624_0081620 | |||
| 425 | Ga0495649_0013433 | |||
| 426 | Ga0495589_0004773 | |||
| 427 | Ga0495600_0113569 | |||
| 428 | Ga0495660_0004951 | |||
| 429 | Ga0495581_0078725 | |||
| 430 | Ga0495581_0316108 | |||
| 431 | Ga0495604_0016500 | |||
| 432 | Ga0495636_0047257 | |||
| 433 | Ga0495676_0014390 | |||
| 434 | Ga0495687_046925 | |||
| 435 | Ga0495677_0109792 | |||
| 436 | Ga0495685_014195 | |||
| 437 | Ga0495686_0118551 | |||
| 438 | Ga0495593_0122844 | |||
| 439 | Ga0496105_0302433 | |||
| 440 | Ga0496107_0066126 | |||
| 441 | Ga0496108_0023670 | |||
| 442 | Ga0496109_0012015 | |||
| 443 | Ga0496110_0094358 | |||
| 444 | Ga0496111_0340383 | |||
| 445 | Ga0496112_0078781 | |||
| 446 | Ga0496112_0162591 | |||
| 447 | Ga0496121_0181188 | |||
| 448 | Ga0496123_0218241 | |||
| 449 | Ga0501031_0016463 | |||
| 450 | Ga0501032_0260361 | |||
| 451 | Ga0501038_0104652 | |||
| 452 | Ga0501039_0047668 | |||
| 453 | Ga0501040_0011318 | |||
| 454 | Ga0501041_0059703 | |||
| 455 | Ga0501042_0023796 | |||
| 456 | Ga0501043_0015851 | |||
| 457 | Ga0501048_0024457 | |||
| 458 | Ga0501071_0029642 | |||
| 459 | Ga0501072_0043630 | |||
| 460 | Ga0501075_0091194 | |||
| 461 | Ga0501199_006763 | |||
| 462 | Ga0501235_023888 | |||
| 463 | Ga0501257_004247 | |||
| 464 | Ga0501079_0073080 | |||
| 465 | Ga0501266_005709 | |||
| 466 | Ga0501044_0026715 | |||
| 467 | Ga0501045_0013282 | |||
| 468 | nmdc:mga05p37_348455_c1 | |||
| 469 | nmdc:mga05p37_70362_c1 | |||
| 470 | nmdc:mga09592_23327_c1 | |||
| 471 | nmdc:mga06r32_132901_c1 | |||
| 472 | nmdc:mga06r32_83469_c1 | |||
| 473 | nmdc:mga08y16_67116_c1 | |||
| 474 | nmdc:mga0rr50_102_c1 | |||
| 475 | nmdc:mga08x19_29_c1 | |||
| 476 | nmdc:mga0a205_27164_c1 | |||
| 477 | Ga0501084_0028583 | |||
| 478 | Ga0501082_0039207 | |||
| 479 | Ga0466962_0000323 | |||
| 480 | Ga0466962_0055548 | |||
| 481 | Ga0530510_0046010 | |||
| 482 | 2515723046 | |||
| 483 | 2585311807 | |||
| 484 | 2644441664 | |||
| 485 | 2644626541 | |||
| 486 | 2808849237 | |||
| 487 | 2855671236 | |||
| 488 | 2857289805 | |||
| 489 | 2858883907 | |||
| 490 | 2862285067 | |||
| 491 | 2867433503 | |||
| 492 | 2869067531 | |||
| 493 | 2869071315 | |||
| 494 | 2880493233 | |||
| 495 | 2880499078 | |||
| 496 | 2887481783 | |||
| 497 | 2954713770 | |||
| 498 | 2954723737 | |||
| 499 | 2954738099 | |||
| 500 | 2954742637 | |||
| 501 | 2954756957 | |||
| 502 | 2954761601 | |||
| 503 | 8054736389 | |||
| 504 | 8055176616 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9221 | 2 | 213 |
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.9162 | 5 | 215 |
| 7w7a-assembly2.cif.gz_E | heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data | 0.9112 | 5 | 205 |
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9097 | 4 | 211 |
| 3tuj-assembly1.cif.gz_C | inward facing conformations of the metni methionine abc transporter: dm crystal form | 0.9067 | 5 | 212 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6Q2V7_231_304_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9532 | 4 | 68 | 3.40.50.300 |
| af_P77737_9_333_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9121 | 3 | 212 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.909 | 4 | 210 | 3.40.50.300 |
| 2pclA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.909 | 2 | 213 | 3.40.50.300 |
| af_Q2FZR5_3_331_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8976 | 3 | 212 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1S2LLA8-F1-model_v4 | Phosphonate ABC transporter ATP-binding protein | 0.9201 | 5 | 211 |
GO:0005524
GO:0005886 GO:0015416 GO:0016887 |
| AF-A0A1M5XEN8-F1-model_v4 | ABC transporter | 0.9176 | 4 | 103 |
GO:0005524
GO:0016887 |
| AF-A0A1H2YVP6-F1-model_v4 | Putative ABC transport system ATP-binding protein | 0.9166 | 5 | 208 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A424YGU9-F1-model_v4 | ABC transporter ATP-binding protein | 0.9164 | 25 | 227 |
GO:0005524
GO:0016887 |
| AF-A0A538RLX8-F1-model_v4 | ABC transporter ATP-binding protein | 0.9159 | 5 | 217 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |