F363388

General Info

Members Datasets Scaffolds Average Seq Length
252 213 504 238

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0027176|Ga0395900_0027176_4287_5081
Length 264
Sequence LLQYIFIAVTSSQISRRGAVGAGVEIRGLAKRYVTGKTTVSALDGVDLTAEPGALVAIMGPSGSGKSTLLHLVGAMDSADSGEIVVGDLQVTSLSRGEQVAYRRRIGFVFQRFHLLPALTALDNVLAPVLPYKTDFDKDERGRELLTAVGLGGREESLPSELSGGEQQRIAIARALVNDPILVLADEPTGNLDSQTSSEIVDLLLDLREQRGMTVFIGTHDAVVASRCDRIVRLFDGQIVDEVEVPGDLEPDVVLDRITRVEGT

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
79 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
93 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
119 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
140 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
148 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
149 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
174 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
175 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
191 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
192 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
193 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
194 2643221714 Streptomyces sp. Root264 Isolate Unclassified
195 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
196 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
197 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
198 2858882152 Micromonospora noduli MED15 Isolate Nodule
199 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
200 2867428634 Streptomyces sp. RP5T Isolate Unclassified
201 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
202 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
203 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
204 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
205 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
206 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
207 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
208 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
209 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
210 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
211 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
212 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
213 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.48
Metatranscriptomes 0.4
Isolates 9.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 1.19
Rhizoplane 3.17
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0027176 3300037418 Bacteria 5860
2 Ga0006562J51391_1048486 3300003578 Bacteria 990
3 Ga0065704_10100112 3300005289 Bacteria 2286
4 Ga0065707_10109112 3300005295 Bacteria 2482
5 Ga0070670_100046634 3300005331 Bacteria 3727
6 Ga0070680_100208887 3300005336 Bacteria 1647
7 Ga0070668_100146546 3300005347 Bacteria 1906
8 Ga0070673_100313344 3300005364 Bacteria 1384
9 Ga0070703_10000077 3300005406 Bacteria 48491
10 Ga0070700_100211536 3300005441 Bacteria 1369
11 Ga0070694_100008485 3300005444 Bacteria 6287
12 Ga0070698_100012976 3300005471 Bacteria 8821
13 Ga0070684_100404269 3300005535 Bacteria 1259
14 Ga0070686_100313640 3300005544 Bacteria 1167
15 Ga0070695_100655439 3300005545 Bacteria 829
16 Ga0070665_100179853 3300005548 Bacteria 2116
17 Ga0070664_100157750 3300005564 Bacteria 2006
18 Ga0068857_100378729 3300005577 Bacteria 1314
19 Ga0068864_100036778 3300005618 Bacteria 4175
20 Ga0068864_100047203 3300005618 Bacteria 3698
21 Ga0068860_100193476 3300005843 Bacteria 1969
22 Ga0068862_100076585 3300005844 Bacteria 2895
23 Ga0081538_10000631 3300005981 Bacteria 39014
24 Ga0081539_10001866 3300005985 Bacteria 33101
25 Ga0070712_100743786 3300006175 Bacteria 839
26 Ga0068871_100598230 3300006358 Bacteria 1003
27 Ga0075428_100029583 3300006844 Bacteria 6060
28 Ga0075428_100058617 3300006844 Unclassified 4215
29 Ga0075428_100240239 3300006844 Bacteria 1954
30 Ga0075431_100027198 3300006847 Bacteria 5867
31 Ga0075433_10012833 3300006852 Bacteria 6789
32 Ga0075433_10073354 3300006852 Bacteria 3010
33 Ga0075429_100028082 3300006880 Bacteria 4883
34 Ga0075436_100000013 3300006914 Bacteria 177118
35 Ga0075435_100000917 3300007076 Bacteria 18572
36 Ga0105251_10014511 3300009011 Bacteria 4349
37 Ga0111539_10160702 3300009094 Bacteria 2627
38 Ga0105245_10091680 3300009098 Bacteria 2797
39 Ga0105245_10865292 3300009098 Bacteria 944
40 Ga0114129_10015266 3300009147 Bacteria 10931
41 Ga0114129_10087174 3300009147 Bacteria 4329
42 Ga0114129_10479415 3300009147 Bacteria 1628
43 Ga0105243_10138942 3300009148 Bacteria 2070
44 Ga0105248_10082867 3300009177 Bacteria 3608
45 Ga0105248_10317127 3300009177 Bacteria 1756
46 Ga0105238_10096943 3300009551 Bacteria 2935
47 Ga0105249_10050642 3300009553 Bacteria 3786
48 Ga0105249_10240603 3300009553 Bacteria 1789
49 Ga0105249_10373894 3300009553 Bacteria 1449
50 Ga0105246_10651740 3300011119 Bacteria 917
51 Ga0157374_10006409 3300013296 Bacteria 9989
52 Ga0163162_10006807 3300013306 Bacteria 11088
53 Ga0163163_10605295 3300014325 Bacteria 1159
54 Ga0157380_10093882 3300014326 Bacteria 2482
55 Ga0213872_10039981 3300021361 Bacteria 2141
56 Ga0209758_1019442 3300025297 Bacteria 3273
57 Ga0207426_1025458 3300025302 Bacteria 1992
58 Ga0207713_1031647 3300025735 Bacteria 2335
59 Ga0207653_10000326 3300025885 Bacteria 25312
60 Ga0207660_10410703 3300025917 Bacteria 1091
61 Ga0207646_10816659 3300025922 Bacteria 830
62 Ga0207694_10076581 3300025924 Bacteria 2620
63 Ga0207687_10041857 3300025927 Bacteria 3148
64 Ga0207687_10171978 3300025927 Bacteria 1671
65 Ga0207687_10582358 3300025927 Bacteria 942
66 Ga0207664_10038934 3300025929 Bacteria 3688
67 Ga0207691_10225061 3300025940 Bacteria 1626
68 Ga0207711_10162931 3300025941 Bacteria 2020
69 Ga0207711_10210540 3300025941 Bacteria 1776
70 Ga0207679_10338818 3300025945 Bacteria 1307
71 Ga0207651_10289171 3300025960 Bacteria 1358
72 Ga0207658_10162397 3300025986 Bacteria 1832
73 Ga0207708_10122811 3300026075 Bacteria 2024
74 Ga0207708_10134004 3300026075 Bacteria 1939
75 Ga0207641_10188035 3300026088 Bacteria 1896
76 Ga0207641_10345564 3300026088 Bacteria 1417
77 Ga0207641_10375442 3300026088 Bacteria 1360
78 Ga0207676_10074888 3300026095 Bacteria 2729
79 Ga0207676_10433858 3300026095 Bacteria 1235
80 Ga0207674_10643068 3300026116 Bacteria 1024
81 Ga0207428_10303295 3300027907 Bacteria 1182
82 Ga0268265_10044177 3300028380 Bacteria 3317
83 Ga0268264_10582803 3300028381 Bacteria 1101
84 Ga0265325_10144254 3300031241 Bacteria 1130
85 Ga0265340_10163796 3300031247 Bacteria 1009
86 Ga0265339_10029513 3300031249 Bacteria 3111
87 Ga0265316_10439026 3300031344 Bacteria 937
88 Ga0265313_10024290 3300031595 Bacteria 3240
89 Ga0265314_10109967 3300031711 Bacteria 1753
90 Ga0265342_10195771 3300031712 Bacteria 1101
91 Ga0307406_10113500 3300031901 Bacteria 1870
92 Ga0307406_10405388 3300031901 Bacteria 1082
93 Ga0307412_10071159 3300031911 Bacteria 2373
94 Ga0307416_100267640 3300032002 Bacteria 1675
95 Ga0307411_10573253 3300032005 Bacteria 966
96 Ga0373951_0000040 3300035091 Bacteria 51161
97 Ga0373923_0083483 3300035111 Bacteria 1388
98 Ga0373925_0255962 3300037068 Bacteria 1405
99 Ga0395899_0133543 3300037312 Bacteria 1771
100 Ga0395898_0037122 3300037466 Bacteria 4835
101 Ga0395905_0023438 3300037471 Bacteria 5832
102 Ga0436364_0681904 3300037853 Bacteria 1155
103 Ga0395901_0074121 3300038443 Bacteria 3551
104 Ga0395901_0144216 3300038443 Bacteria 2503
105 Ga0436365_0936514 3300039437 Bacteria 806
106 Ga0436360_1094473 3300039438 Bacteria 7502
107 Ga0436361_1013072 3300039447 Bacteria 10141
108 Ga0436362_1026367 3300039453 Bacteria 2415
109 Ga0439451_038528 3300042009 Bacteria 960
110 Ga0451577_0064367 3300042876 Bacteria 3270
111 Ga0466972_0000990 3300044658 Bacteria 13672
112 Ga0466965_0000281 3300044683 Bacteria 16772
113 Ga0466966_0026876 3300044684 Bacteria 3753
114 Ga0466963_0000391 3300044694 Bacteria 19979
115 Ga0466964_0011207 3300044706 Bacteria 3385
116 Ga0466964_0058395 3300044706 Bacteria 1599
117 Ga0453684_0002151 3300044712 Bacteria 49340
118 Ga0453684_0170404 3300044712 Bacteria 2566
119 Ga0453684_0347653 3300044712 Bacteria 1673
120 Ga0466971_0004549 3300044719 Bacteria 5998
121 Ga0466971_0072460 3300044719 Bacteria 1565
122 Ga0466968_0086108 3300044735 Bacteria 1387
123 Ga0466970_0012726 3300044765 Bacteria 4304
124 Ga0466957_0017939 3300044842 Bacteria 4151
125 Ga0466960_0000141 3300044901 Bacteria 24549
126 Ga0451576_0015566 3300045051 Bacteria 8419
127 Ga0466958_0000133 3300045836 Bacteria 24894
128 Ga0466958_0106280 3300045836 Bacteria 1750
129 Ga0466967_0022486 3300045976 Bacteria 5146
130 Ga0466967_0084023 3300045976 Bacteria 2880
131 Ga0466967_0085478 3300045976 Bacteria 2856
132 Ga0466967_0275830 3300045976 Bacteria 1612
133 Ga0466967_0359686 3300045976 Bacteria 1410
134 Ga0466967_0394524 3300045976 Bacteria 1345
135 Ga0495592_0039005 3300046454 Bacteria 3570
136 Ga0495629_0056250 3300046459 Bacteria 2751
137 Ga0495651_0106082 3300046462 Bacteria 2083
138 Ga0495582_0025202 3300046473 Bacteria 3258
139 Ga0495605_0001560 3300046474 Bacteria 14882
140 Ga0495639_0032568 3300046475 Bacteria 2325
141 Ga0495662_0008024 3300046476 Bacteria 5199
142 Ga0495664_0107238 3300046477 Bacteria 1685
143 Ga0495664_0112577 3300046477 Bacteria 1643
144 Ga0495585_0025509 3300046492 Bacteria 3383
145 Ga0495607_0062924 3300046501 Bacteria 2101
146 Ga0495583_0088457 3300046506 Bacteria 1337
147 Ga0495606_0019952 3300046507 Bacteria 4962
148 Ga0495610_0021878 3300046512 Bacteria 3509
149 Ga0495616_0009625 3300046513 Bacteria 5636
150 Ga0495618_0145299 3300046514 Bacteria 1516
151 Ga0495620_0005440 3300046515 Bacteria 7101
152 Ga0495628_0082250 3300046516 Bacteria 2501
153 Ga0495631_0004146 3300046518 Bacteria 7768
154 Ga0495640_0003430 3300046533 Bacteria 12761
155 Ga0495640_0027338 3300046533 Bacteria 4115
156 Ga0495609_0068681 3300046538 Bacteria 1559
157 Ga0495621_0014651 3300046539 Bacteria 2486
158 Ga0495645_0027585 3300046543 Bacteria 4127
159 Ga0495633_0009380 3300046558 Bacteria 5411
160 Ga0495668_0026585 3300046616 Bacteria 3282
161 Ga0495634_0040966 3300046642 Bacteria 3147
162 Ga0495611_0006165 3300046648 Bacteria 5116
163 Ga0495611_0036474 3300046648 Bacteria 2182
164 Ga0495625_0010858 3300046660 Bacteria 7486
165 Ga0495659_0013166 3300046664 Bacteria 2690
166 Ga0495588_0000878 3300046674 Bacteria 13283
167 Ga0495657_0025170 3300046675 Bacteria 4230
168 Ga0495669_0246033 3300046684 Bacteria 859
169 Ga0495613_0009838 3300046689 Bacteria 7111
170 Ga0495613_0101523 3300046689 Bacteria 2077
171 Ga0495613_0139565 3300046689 Bacteria 1732
172 Ga0495624_0081620 3300046690 Bacteria 2002
173 Ga0495649_0013433 3300046694 Bacteria 4724
174 Ga0495589_0004773 3300046794 Bacteria 7204
175 Ga0495600_0113569 3300046809 Bacteria 1763
176 Ga0495660_0004951 3300046810 Bacteria 8020
177 Ga0495581_0078725 3300047315 Bacteria 1907
178 Ga0495581_0316108 3300047315 Bacteria 912
179 Ga0495604_0016500 3300047317 Bacteria 5904
180 Ga0495636_0047257 3300047318 Bacteria 1797
181 Ga0495676_0014390 3300047321 Bacteria 7080
182 Ga0495687_046925 3300047443 Bacteria 1861
183 Ga0495677_0109792 3300047445 Bacteria 1048
184 Ga0495685_014195 3300047447 Bacteria 2706
185 Ga0495686_0118551 3300047472 Bacteria 1580
186 Ga0495593_0122844 3300047673 Bacteria 1321
187 Ga0496105_0302433 3300048908 Bacteria 1286
188 Ga0496107_0066126 3300048910 Bacteria 2621
189 Ga0496108_0023670 3300048911 Bacteria 5054
190 Ga0496109_0012015 3300048912 Bacteria 7457
191 Ga0496110_0094358 3300048913 Bacteria 2679
192 Ga0496111_0340383 3300048914 Bacteria 1110
193 Ga0496112_0078781 3300048915 Bacteria 3258
194 Ga0496112_0162591 3300048915 Bacteria 2199
195 Ga0496121_0181188 3300048924 Bacteria 1520
196 Ga0496123_0218241 3300048926 Bacteria 964
197 Ga0501031_0016463 3300049568 Bacteria 4803
198 Ga0501032_0260361 3300049569 Bacteria 1125
199 Ga0501038_0104652 3300049574 Bacteria 2352
200 Ga0501039_0047668 3300049575 Bacteria 3312
201 Ga0501040_0011318 3300049576 Bacteria 5839
202 Ga0501041_0059703 3300049577 Bacteria 2334
203 Ga0501042_0023796 3300049578 Bacteria 4290
204 Ga0501043_0015851 3300049579 Bacteria 5907
205 Ga0501048_0024457 3300049582 Bacteria 4409
206 Ga0501071_0029642 3300049587 Bacteria 3864
207 Ga0501072_0043630 3300049588 Bacteria 3525
208 Ga0501075_0091194 3300049591 Bacteria 2313
209 Ga0501199_006763 3300049650 Bacteria 1174
210 Ga0501235_023888 3300049669 Bacteria 1364
211 Ga0501257_004247 3300049686 Bacteria 3120
212 Ga0501079_0073080 3300049741 Bacteria 2651
213 Ga0501266_005709 3300049763 Bacteria 1546
214 Ga0501044_0026715 3300049823 Bacteria 6110
215 Ga0501045_0013282 3300049824 Bacteria 5814
216 nmdc:mga05p37_348455_c1 3300050507 Bacteria 1744
217 nmdc:mga05p37_70362_c1 3300050507 Bacteria 4303
218 nmdc:mga09592_23327_c1 3300050508 Bacteria 5110
219 nmdc:mga06r32_132901_c1 3300050510 Unclassified 2462
220 nmdc:mga06r32_83469_c1 3300050510 Bacteria 3113
221 nmdc:mga08y16_67116_c1 3300050511 Bacteria 3742
222 nmdc:mga0rr50_102_c1 3300050513 Bacteria 48211
223 nmdc:mga08x19_29_c1 3300050514 Bacteria 214647
224 nmdc:mga0a205_27164_c1 3300050515 Bacteria 5465
225 Ga0501084_0028583 3300054114 Bacteria 4661
226 Ga0501082_0039207 3300060353 Bacteria 4088
227 Ga0466962_0000323 3300061719 Bacteria 20489
228 Ga0466962_0055548 3300061719 Bacteria 1892
229 Ga0530510_0046010 3300061734 Bacteria 3153
230 2515723046 2515154129 Bacteria 5584369
231 2585311807 2582581314 Bacteria 11452267
232 2644441664 2643221678 Bacteria 9540101
233 2644626541 2643221714 Bacteria 9015452
234 2808849237 2808606359 Bacteria 9866990
235 2855671236 2855670206 Bacteria 7120389
236 2857289805 2857288857 Bacteria 7189066
237 2858883907 2858882152 Bacteria 7230291
238 2862285067 2862281513 Bacteria 9621493
239 2867433503 2867428634 Bacteria 9590268
240 2869067531 2869061728 Bacteria 7112407
241 2869071315 2869068681 Bacteria 7205615
242 2880493233 2880489317 Bacteria 7096270
243 2880499078 2880495981 Bacteria 7340502
244 2887481783 2887478801 Bacteria 8972725
245 2954713770 2954711539 Bacteria 10867210
246 2954723737 2954721474 Bacteria 10456478
247 2954738099 2954731030 Bacteria 10243860
248 2954742637 2954740390 Bacteria 10229294
249 2954756957 2954749733 Bacteria 10366972
250 2954761601 2954759201 Bacteria 9358192
251 8054736389 8054734606 Bacteria 6947278
252 8055176616 8055172936 Bacteria 9305943
253 Ga0395900_0027176
254 Ga0006562J51391_1048486
255 Ga0065704_10100112
256 Ga0065707_10109112
257 Ga0070670_100046634
258 Ga0070680_100208887
259 Ga0070668_100146546
260 Ga0070673_100313344
261 Ga0070703_10000077
262 Ga0070700_100211536
263 Ga0070694_100008485
264 Ga0070698_100012976
265 Ga0070684_100404269
266 Ga0070686_100313640
267 Ga0070695_100655439
268 Ga0070665_100179853
269 Ga0070664_100157750
270 Ga0068857_100378729
271 Ga0068864_100036778
272 Ga0068864_100047203
273 Ga0068860_100193476
274 Ga0068862_100076585
275 Ga0081538_10000631
276 Ga0081539_10001866
277 Ga0070712_100743786
278 Ga0068871_100598230
279 Ga0075428_100029583
280 Ga0075428_100058617
281 Ga0075428_100240239
282 Ga0075431_100027198
283 Ga0075433_10012833
284 Ga0075433_10073354
285 Ga0075429_100028082
286 Ga0075436_100000013
287 Ga0075435_100000917
288 Ga0105251_10014511
289 Ga0111539_10160702
290 Ga0105245_10091680
291 Ga0105245_10865292
292 Ga0114129_10015266
293 Ga0114129_10087174
294 Ga0114129_10479415
295 Ga0105243_10138942
296 Ga0105248_10082867
297 Ga0105248_10317127
298 Ga0105238_10096943
299 Ga0105249_10050642
300 Ga0105249_10240603
301 Ga0105249_10373894
302 Ga0105246_10651740
303 Ga0157374_10006409
304 Ga0163162_10006807
305 Ga0163163_10605295
306 Ga0157380_10093882
307 Ga0213872_10039981
308 Ga0209758_1019442
309 Ga0207426_1025458
310 Ga0207713_1031647
311 Ga0207653_10000326
312 Ga0207660_10410703
313 Ga0207646_10816659
314 Ga0207694_10076581
315 Ga0207687_10041857
316 Ga0207687_10171978
317 Ga0207687_10582358
318 Ga0207664_10038934
319 Ga0207691_10225061
320 Ga0207711_10162931
321 Ga0207711_10210540
322 Ga0207679_10338818
323 Ga0207651_10289171
324 Ga0207658_10162397
325 Ga0207708_10122811
326 Ga0207708_10134004
327 Ga0207641_10188035
328 Ga0207641_10345564
329 Ga0207641_10375442
330 Ga0207676_10074888
331 Ga0207676_10433858
332 Ga0207674_10643068
333 Ga0207428_10303295
334 Ga0268265_10044177
335 Ga0268264_10582803
336 Ga0265325_10144254
337 Ga0265340_10163796
338 Ga0265339_10029513
339 Ga0265316_10439026
340 Ga0265313_10024290
341 Ga0265314_10109967
342 Ga0265342_10195771
343 Ga0307406_10113500
344 Ga0307406_10405388
345 Ga0307412_10071159
346 Ga0307416_100267640
347 Ga0307411_10573253
348 Ga0373951_0000040
349 Ga0373923_0083483
350 Ga0373925_0255962
351 Ga0395899_0133543
352 Ga0395898_0037122
353 Ga0395905_0023438
354 Ga0436364_0681904
355 Ga0395901_0074121
356 Ga0395901_0144216
357 Ga0436365_0936514
358 Ga0436360_1094473
359 Ga0436361_1013072
360 Ga0436362_1026367
361 Ga0439451_038528
362 Ga0451577_0064367
363 Ga0466972_0000990
364 Ga0466965_0000281
365 Ga0466966_0026876
366 Ga0466963_0000391
367 Ga0466964_0011207
368 Ga0466964_0058395
369 Ga0453684_0002151
370 Ga0453684_0170404
371 Ga0453684_0347653
372 Ga0466971_0004549
373 Ga0466971_0072460
374 Ga0466968_0086108
375 Ga0466970_0012726
376 Ga0466957_0017939
377 Ga0466960_0000141
378 Ga0451576_0015566
379 Ga0466958_0000133
380 Ga0466958_0106280
381 Ga0466967_0022486
382 Ga0466967_0084023
383 Ga0466967_0085478
384 Ga0466967_0275830
385 Ga0466967_0359686
386 Ga0466967_0394524
387 Ga0495592_0039005
388 Ga0495629_0056250
389 Ga0495651_0106082
390 Ga0495582_0025202
391 Ga0495605_0001560
392 Ga0495639_0032568
393 Ga0495662_0008024
394 Ga0495664_0107238
395 Ga0495664_0112577
396 Ga0495585_0025509
397 Ga0495607_0062924
398 Ga0495583_0088457
399 Ga0495606_0019952
400 Ga0495610_0021878
401 Ga0495616_0009625
402 Ga0495618_0145299
403 Ga0495620_0005440
404 Ga0495628_0082250
405 Ga0495631_0004146
406 Ga0495640_0003430
407 Ga0495640_0027338
408 Ga0495609_0068681
409 Ga0495621_0014651
410 Ga0495645_0027585
411 Ga0495633_0009380
412 Ga0495668_0026585
413 Ga0495634_0040966
414 Ga0495611_0006165
415 Ga0495611_0036474
416 Ga0495625_0010858
417 Ga0495659_0013166
418 Ga0495588_0000878
419 Ga0495657_0025170
420 Ga0495669_0246033
421 Ga0495613_0009838
422 Ga0495613_0101523
423 Ga0495613_0139565
424 Ga0495624_0081620
425 Ga0495649_0013433
426 Ga0495589_0004773
427 Ga0495600_0113569
428 Ga0495660_0004951
429 Ga0495581_0078725
430 Ga0495581_0316108
431 Ga0495604_0016500
432 Ga0495636_0047257
433 Ga0495676_0014390
434 Ga0495687_046925
435 Ga0495677_0109792
436 Ga0495685_014195
437 Ga0495686_0118551
438 Ga0495593_0122844
439 Ga0496105_0302433
440 Ga0496107_0066126
441 Ga0496108_0023670
442 Ga0496109_0012015
443 Ga0496110_0094358
444 Ga0496111_0340383
445 Ga0496112_0078781
446 Ga0496112_0162591
447 Ga0496121_0181188
448 Ga0496123_0218241
449 Ga0501031_0016463
450 Ga0501032_0260361
451 Ga0501038_0104652
452 Ga0501039_0047668
453 Ga0501040_0011318
454 Ga0501041_0059703
455 Ga0501042_0023796
456 Ga0501043_0015851
457 Ga0501048_0024457
458 Ga0501071_0029642
459 Ga0501072_0043630
460 Ga0501075_0091194
461 Ga0501199_006763
462 Ga0501235_023888
463 Ga0501257_004247
464 Ga0501079_0073080
465 Ga0501266_005709
466 Ga0501044_0026715
467 Ga0501045_0013282
468 nmdc:mga05p37_348455_c1
469 nmdc:mga05p37_70362_c1
470 nmdc:mga09592_23327_c1
471 nmdc:mga06r32_132901_c1
472 nmdc:mga06r32_83469_c1
473 nmdc:mga08y16_67116_c1
474 nmdc:mga0rr50_102_c1
475 nmdc:mga08x19_29_c1
476 nmdc:mga0a205_27164_c1
477 Ga0501084_0028583
478 Ga0501082_0039207
479 Ga0466962_0000323
480 Ga0466962_0055548
481 Ga0530510_0046010
482 2515723046
483 2585311807
484 2644441664
485 2644626541
486 2808849237
487 2855671236
488 2857289805
489 2858883907
490 2862285067
491 2867433503
492 2869067531
493 2869071315
494 2880493233
495 2880499078
496 2887481783
497 2954713770
498 2954723737
499 2954738099
500 2954742637
501 2954756957
502 2954761601
503 8054736389
504 8055176616

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

43

190

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9221 2 213
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9162 5 215
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9112 5 205
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9097 4 211
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9067 5 212
ID Description Score Start End Superfamily
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9532 4 68 3.40.50.300
af_P77737_9_333_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9121 3 212 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.909 4 210 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.909 2 213 3.40.50.300
af_Q2FZR5_3_331_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8976 3 212 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1S2LLA8-F1-model_v4 Phosphonate ABC transporter ATP-binding protein 0.9201 5 211 GO:0005524
GO:0005886
GO:0015416
GO:0016887
AF-A0A1M5XEN8-F1-model_v4 ABC transporter 0.9176 4 103 GO:0005524
GO:0016887
AF-A0A1H2YVP6-F1-model_v4 Putative ABC transport system ATP-binding protein 0.9166 5 208 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A424YGU9-F1-model_v4 ABC transporter ATP-binding protein 0.9164 25 227 GO:0005524
GO:0016887
AF-A0A538RLX8-F1-model_v4 ABC transporter ATP-binding protein 0.9159 5 217 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Map