F362636

General Info

Members Datasets Scaffolds Average Seq Length
251 180 502 98

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0366059|Ga0451576_0366059_358_651
Length 97
Sequence MKKALFNELLTGVREMQAIRAGKLKAAAVTKLTPDHPRAVRAQLGMTQEQFAELLGVPVGTLRNWEQGIRKPAGAAKTLLRVAAKHPKAVLDALKAA

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
110 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
113 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
128 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
129 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
130 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
162 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
163 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.99
Nodule 0
Rhizoplane 2.39
Rhizosphere 93.23
Stem 0
Stem Tuber 0
Unclassified 41.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0366059 3300045051 Unclassified 1510
2 MBSR1b_contig_10322687 2162886012 Unclassified 814
3 MBSR1b_contig_10456323 2162886012 Bacteria 1893
4 JGI24749J21850_1054717 3300002076 Unclassified 599
5 rootH1_10350418 3300003323 Bacteria 1509
6 Ga0065715_10159288 3300005293 Bacteria 1645
7 Ga0065715_10466210 3300005293 Unclassified 811
8 Ga0065707_10002167 3300005295 Bacteria 7510
9 Ga0070683_100960929 3300005329 Unclassified 820
10 Ga0070690_100019449 3300005330 Bacteria 4122
11 Ga0070670_100124366 3300005331 Bacteria 2226
12 Ga0068869_100500929 3300005334 Unclassified 1014
13 Ga0070666_10793841 3300005335 Unclassified 697
14 Ga0070682_100033569 3300005337 Bacteria 3119
15 Ga0068868_100000131 3300005338 Bacteria 48140
16 Ga0068868_100001691 3300005338 Bacteria 15096
17 Ga0068868_100246646 3300005338 Bacteria 1502
18 Ga0070689_100106728 3300005340 Bacteria 2222
19 Ga0070689_100175286 3300005340 Bacteria 1739
20 Ga0070691_10078307 3300005341 Bacteria 1614
21 Ga0070692_10071491 3300005345 Unclassified 1849
22 Ga0070692_11154946 3300005345 Bacteria 549
23 Ga0070668_100808359 3300005347 Bacteria 833
24 Ga0070669_101392242 3300005353 Unclassified 608
25 Ga0070675_101332134 3300005354 Unclassified 662
26 Ga0070674_100793000 3300005356 Bacteria 817
27 Ga0070673_100086335 3300005364 Unclassified 2556
28 Ga0070673_100400078 3300005364 Unclassified 1228
29 Ga0070673_100962854 3300005364 Unclassified 793
30 Ga0070673_102163572 3300005364 Unclassified 528
31 Ga0070688_100901426 3300005365 Unclassified 697
32 Ga0070667_100718832 3300005367 Unclassified 925
33 Ga0070713_101992115 3300005436 Unclassified 563
34 Ga0070701_10002199 3300005438 Bacteria 7446
35 Ga0070701_10056704 3300005438 Bacteria 2050
36 Ga0070700_100000013 3300005441 Bacteria 158921
37 Ga0070700_101215387 3300005441 Bacteria 630
38 Ga0070694_100126288 3300005444 Bacteria 1842
39 Ga0070708_102058336 3300005445 Unclassified 528
40 Ga0070662_100566017 3300005457 Unclassified 953
41 Ga0070685_10158907 3300005466 Bacteria 1439
42 Ga0070707_100152823 3300005468 Bacteria 2247
43 Ga0070699_101033893 3300005518 Unclassified 753
44 Ga0070672_100737906 3300005543 Unclassified 864
45 Ga0070686_100030326 3300005544 Bacteria 3297
46 Ga0070686_101396897 3300005544 Bacteria 587
47 Ga0070695_100001951 3300005545 Bacteria 11705
48 Ga0070696_100672612 3300005546 Unclassified 841
49 Ga0070693_100011982 3300005547 Bacteria 4378
50 Ga0070693_100320526 3300005547 Bacteria 1051
51 Ga0070693_100652290 3300005547 Unclassified 765
52 Ga0070704_100381195 3300005549 Unclassified 1198
53 Ga0070704_100570752 3300005549 Bacteria 991
54 Ga0068855_100117108 3300005563 Bacteria 3053
55 Ga0068854_100027261 3300005578 Bacteria 3936
56 Ga0070702_100261542 3300005615 Bacteria 1178
57 Ga0068852_102609607 3300005616 Unclassified 525
58 Ga0068859_100227615 3300005617 Unclassified 1953
59 Ga0068864_100000034 3300005618 Bacteria 199411
60 Ga0068861_100064456 3300005719 Bacteria 2819
61 Ga0068861_101064006 3300005719 Bacteria 776
62 Ga0068861_101652291 3300005719 Unclassified 632
63 Ga0068863_102000689 3300005841 Unclassified 589
64 Ga0068858_100160348 3300005842 Unclassified 2117
65 Ga0068858_101251385 3300005842 Unclassified 730
66 Ga0068858_102082858 3300005842 Bacteria 561
67 Ga0068860_100002124 3300005843 Bacteria 20903
68 Ga0068860_102735117 3300005843 Bacteria 512
69 Ga0070715_10366064 3300006163 Unclassified 792
70 Ga0070716_100201289 3300006173 Unclassified 1324
71 Ga0070716_100494206 3300006173 Unclassified 901
72 Ga0075366_10051146 3300006195 Bacteria 2455
73 Ga0075366_10328958 3300006195 Unclassified 937
74 Ga0068871_100652075 3300006358 Unclassified 961
75 Ga0068871_101149065 3300006358 Unclassified 727
76 Ga0075428_100002824 3300006844 Bacteria 18911
77 Ga0075428_101015289 3300006844 Bacteria 878
78 Ga0075431_100405514 3300006847 Unclassified 1364
79 Ga0075431_100667046 3300006847 Bacteria 1019
80 Ga0075433_10230285 3300006852 Bacteria 1646
81 Ga0075434_100061945 3300006871 Bacteria 3723
82 Ga0075434_101026823 3300006871 Bacteria 838
83 Ga0075429_100189368 3300006880 Bacteria 1803
84 Ga0068865_100577373 3300006881 Unclassified 947
85 Ga0075436_100070968 3300006914 Bacteria 2408
86 Ga0097620_100227615 3300006931 Unclassified 1953
87 Ga0075435_100020027 3300007076 Bacteria 5116
88 Ga0075435_100318401 3300007076 Bacteria 1331
89 Ga0075435_100847655 3300007076 Unclassified 796
90 Ga0111539_10011205 3300009094 Bacteria 11269
91 Ga0111539_10099080 3300009094 Bacteria 3423
92 Ga0105245_10855693 3300009098 Bacteria 949
93 Ga0105245_10859761 3300009098 Bacteria 947
94 Ga0114129_11328640 3300009147 Bacteria 890
95 Ga0105243_10444774 3300009148 Bacteria 1214
96 Ga0105243_12588551 3300009148 Unclassified 547
97 Ga0105248_10443283 3300009177 Bacteria 1463
98 Ga0105249_10034973 3300009553 Unclassified 4554
99 Ga0105249_10257922 3300009553 Unclassified 1731
100 Ga0099796_10271116 3300010159 Unclassified 711
101 Ga0157370_10239570 3300013104 Unclassified 1679
102 Ga0157378_12102278 3300013297 Unclassified 615
103 Ga0163162_10084764 3300013306 Bacteria 3245
104 Ga0163162_10643610 3300013306 Bacteria 1184
105 Ga0157375_10186958 3300013308 Bacteria 2225
106 Ga0157380_10038676 3300014326 Bacteria 3706
107 Ga0157380_10161937 3300014326 Bacteria 1945
108 Ga0157380_10164993 3300014326 Bacteria 1929
109 Ga0157377_10000040 3300014745 Bacteria 112182
110 Ga0157377_10124947 3300014745 Bacteria 1564
111 Ga0157379_11630022 3300014968 Unclassified 630
112 Ga0157376_10313316 3300014969 Unclassified 1489
113 Ga0157376_10483738 3300014969 Unclassified 1213
114 Ga0157376_10703234 3300014969 Bacteria 1016
115 Ga0163161_10841052 3300017792 Unclassified 774
116 Ga0213876_10002312 3300021384 Bacteria 11248
117 Ga0207692_10010149 3300025898 Bacteria 3959
118 Ga0207685_10361492 3300025905 Unclassified 735
119 Ga0207663_11405862 3300025916 Bacteria 562
120 Ga0207662_10111168 3300025918 Bacteria 1708
121 Ga0207646_10308131 3300025922 Bacteria 1431
122 Ga0207650_10142363 3300025925 Unclassified 1886
123 Ga0207659_10538065 3300025926 Unclassified 992
124 Ga0207687_10211001 3300025927 Bacteria 1523
125 Ga0207644_10923464 3300025931 Bacteria 732
126 Ga0207709_10983814 3300025935 Unclassified 689
127 Ga0207669_11022233 3300025937 Unclassified 695
128 Ga0207704_10455937 3300025938 Unclassified 1021
129 Ga0207665_10254566 3300025939 Unclassified 1298
130 Ga0207665_10445856 3300025939 Unclassified 992
131 Ga0207691_10218078 3300025940 Bacteria 1655
132 Ga0207711_10384449 3300025941 Bacteria 1302
133 Ga0207689_10121283 3300025942 Bacteria 2150
134 Ga0207689_11444802 3300025942 Bacteria 575
135 Ga0207661_11068255 3300025944 Unclassified 743
136 Ga0207667_10095786 3300025949 Bacteria 3063
137 Ga0207651_10522649 3300025960 Bacteria 1029
138 Ga0207651_10621573 3300025960 Bacteria 946
139 Ga0207651_11899574 3300025960 Unclassified 535
140 Ga0207712_10064714 3300025961 Unclassified 2608
141 Ga0207640_10018735 3300025981 Bacteria 4074
142 Ga0207677_10000005 3300026023 Bacteria 287656
143 Ga0207703_10238791 3300026035 Unclassified 1633
144 Ga0207703_11573783 3300026035 Bacteria 632
145 Ga0207708_10322592 3300026075 Unclassified 1261
146 Ga0207676_10000020 3300026095 Bacteria 301541
147 Ga0207675_100092219 3300026118 Bacteria 2849
148 Ga0207675_100819356 3300026118 Unclassified 945
149 Ga0207675_100853344 3300026118 Bacteria 926
150 Ga0207675_101341415 3300026118 Unclassified 736
151 Ga0207698_12263005 3300026142 Unclassified 556
152 Ga0207428_10320861 3300027907 Bacteria 1144
153 Ga0268265_10429064 3300028380 Bacteria 1229
154 Ga0268264_10002356 3300028381 Bacteria 16680
155 Ga0265319_1279827 3300028563 Bacteria 507
156 Ga0265328_10146284 3300031239 Unclassified 888
157 Ga0316576_10000299 3300031727 Bacteria 21886
158 Ga0316576_10721898 3300031727 Bacteria 721
159 Ga0316578_10018985 3300031728 Bacteria 3778
160 Ga0316578_10820900 3300031728 Bacteria 538
161 Ga0316577_10618561 3300031733 Unclassified 616
162 Ga0316577_10746928 3300031733 Unclassified 555
163 Ga0307416_100395172 3300032002 Bacteria 1418
164 Ga0373944_0293335 3300035089 Unclassified 609
165 Ga0373943_0050054 3300035170 Bacteria 2052
166 Ga0316574_0798963 3300035398 Bacteria 574
167 Ga0316574_0818547 3300035398 Unclassified 566
168 Ga0373927_0034392 3300035695 Bacteria 3296
169 Ga0373947_0119295 3300035725 Bacteria 1674
170 Ga0373937_0560173 3300036401 Bacteria 1086
171 Ga0373937_1458748 3300036401 Unclassified 632
172 Ga0316582_0795071 3300036647 Bacteria 648
173 Ga0316584_0480746 3300036712 Bacteria 875
174 Ga0373925_0381684 3300037068 Bacteria 1147
175 Ga0436364_0805646 3300037853 Unclassified 583
176 Ga0436365_0711227 3300039437 Bacteria 19529
177 Ga0436361_0823101 3300039447 Bacteria 572
178 Ga0436361_1181958 3300039447 Unclassified 838
179 Ga0451787_256142 3300041441 Unclassified 667
180 Ga0451807_0989699 3300041486 Bacteria 745
181 Ga0451807_1699156 3300041486 Unclassified 647
182 Ga0451807_2337326 3300041486 Unclassified 1091
183 Ga0451837_1284370 3300041494 Bacteria 4107
184 Ga0439464_0181273 3300042439 Unclassified 667
185 Ga0453683_0020237 3300044673 Bacteria 4253
186 Ga0453684_0026983 3300044712 Bacteria 8267
187 Ga0451576_1478959 3300045051 Bacteria 706
188 Ga0495590_0402552 3300046457 Bacteria 525
189 Ga0495629_0123546 3300046459 Bacteria 1803
190 Ga0495639_0016504 3300046475 Bacteria 3207
191 Ga0495620_0000799 3300046515 Bacteria 19320
192 Ga0495620_0366262 3300046515 Unclassified 546
193 Ga0495640_0162559 3300046533 Bacteria 1430
194 Ga0495658_0795638 3300046683 Unclassified 605
195 Ga0495624_0671033 3300046690 Bacteria 616
196 Ga0495600_0152097 3300046809 Bacteria 1498
197 Ga0495581_0132695 3300047315 Bacteria 1451
198 Ga0495636_0341031 3300047318 Unclassified 706
199 Ga0495676_0189734 3300047321 Bacteria 1434
200 Ga0495680_0622148 3300047322 Bacteria 720
201 Ga0495686_0175956 3300047472 Bacteria 1242
202 Ga0496104_1877986 3300048907 Unclassified 501
203 Ga0496109_0900215 3300048912 Unclassified 823
204 Ga0496119_0236911 3300048922 Bacteria 926
205 Ga0501034_0102685 3300049571 Bacteria 2853
206 Ga0501034_0620912 3300049571 Unclassified 985
207 Ga0501042_0521662 3300049578 Unclassified 863
208 Ga0501047_0193628 3300049581 Bacteria 1896
209 Ga0501048_0150310 3300049582 Bacteria 1647
210 Ga0501067_0063218 3300049583 Unclassified 2049
211 Ga0501068_0044911 3300049584 Bacteria 2662
212 Ga0501068_1011451 3300049584 Unclassified 549
213 Ga0501071_0012762 3300049587 Bacteria 5712
214 Ga0501071_0134770 3300049587 Bacteria 1837
215 Ga0501072_1107282 3300049588 Unclassified 616
216 Ga0501072_1134290 3300049588 Bacteria 608
217 Ga0501073_0029143 3300049589 Bacteria 3944
218 Ga0501073_0463319 3300049589 Bacteria 876
219 Ga0501074_0108001 3300049590 Bacteria 1992
220 Ga0501074_1319002 3300049590 Unclassified 506
221 Ga0501075_0043753 3300049591 Bacteria 3358
222 Ga0501077_0000245 3300049593 Bacteria 32081
223 Ga0501199_001955 3300049650 Bacteria 1896
224 Ga0501236_052330 3300049670 Unclassified 704
225 Ga0501257_065524 3300049686 Unclassified 922
226 Ga0501080_0678387 3300049742 Unclassified 910
227 Ga0501081_0315341 3300049743 Unclassified 1149
228 Ga0501083_0052960 3300049744 Bacteria 2725
229 Ga0501083_0835310 3300049744 Unclassified 599
230 Ga0501083_1049050 3300049744 Unclassified 530
231 nmdc:mga0k408_200121_c1 3300050493 Bacteria 1192
232 nmdc:mga0k408_304988_c1 3300050493 Unclassified 950
233 nmdc:mga05p37_1646961_c1 3300050507 Bacteria 629
234 nmdc:mga09592_1083952_c1 3300050508 Unclassified 666
235 nmdc:mga09592_577705_c1 3300050508 Unclassified 964
236 nmdc:mga09592_869287_c1 3300050508 Unclassified 759
237 nmdc:mga06r32_668189_c1 3300050510 Bacteria 1006
238 nmdc:mga08y16_265590_c1 3300050511 Bacteria 1772
239 nmdc:mga0n895_21799_c1 3300050512 Bacteria 5997
240 nmdc:mga0rr50_477226_c1 3300050513 Unclassified 1059
241 nmdc:mga0rr50_60189_c1 3300050513 Bacteria 2856
242 nmdc:mga08x19_113409_c1 3300050514 Bacteria 1810
243 nmdc:mga08x19_949776_c1 3300050514 Bacteria 611
244 nmdc:mga0a205_157153_c1 3300050515 Bacteria 2172
245 Ga0495601_0246345 3300053077 Unclassified 1167
246 Ga0500597_152620 3300053120 Bacteria 991
247 Ga0501084_0384452 3300054114 Unclassified 1186
248 Ga0501084_0654351 3300054114 Bacteria 887
249 Ga0590074_063515 3300059423 Unclassified 689
250 Ga0501082_0000270 3300060353 Bacteria 45823
251 Ga0501082_1924963 3300060353 Unclassified 515
252 Ga0451576_0366059
253 MBSR1b_contig_10322687
254 MBSR1b_contig_10456323
255 JGI24749J21850_1054717
256 rootH1_10350418
257 Ga0065715_10159288
258 Ga0065715_10466210
259 Ga0065707_10002167
260 Ga0070683_100960929
261 Ga0070690_100019449
262 Ga0070670_100124366
263 Ga0068869_100500929
264 Ga0070666_10793841
265 Ga0070682_100033569
266 Ga0068868_100000131
267 Ga0068868_100001691
268 Ga0068868_100246646
269 Ga0070689_100106728
270 Ga0070689_100175286
271 Ga0070691_10078307
272 Ga0070692_10071491
273 Ga0070692_11154946
274 Ga0070668_100808359
275 Ga0070669_101392242
276 Ga0070675_101332134
277 Ga0070674_100793000
278 Ga0070673_100086335
279 Ga0070673_100400078
280 Ga0070673_100962854
281 Ga0070673_102163572
282 Ga0070688_100901426
283 Ga0070667_100718832
284 Ga0070713_101992115
285 Ga0070701_10002199
286 Ga0070701_10056704
287 Ga0070700_100000013
288 Ga0070700_101215387
289 Ga0070694_100126288
290 Ga0070708_102058336
291 Ga0070662_100566017
292 Ga0070685_10158907
293 Ga0070707_100152823
294 Ga0070699_101033893
295 Ga0070672_100737906
296 Ga0070686_100030326
297 Ga0070686_101396897
298 Ga0070695_100001951
299 Ga0070696_100672612
300 Ga0070693_100011982
301 Ga0070693_100320526
302 Ga0070693_100652290
303 Ga0070704_100381195
304 Ga0070704_100570752
305 Ga0068855_100117108
306 Ga0068854_100027261
307 Ga0070702_100261542
308 Ga0068852_102609607
309 Ga0068859_100227615
310 Ga0068864_100000034
311 Ga0068861_100064456
312 Ga0068861_101064006
313 Ga0068861_101652291
314 Ga0068863_102000689
315 Ga0068858_100160348
316 Ga0068858_101251385
317 Ga0068858_102082858
318 Ga0068860_100002124
319 Ga0068860_102735117
320 Ga0070715_10366064
321 Ga0070716_100201289
322 Ga0070716_100494206
323 Ga0075366_10051146
324 Ga0075366_10328958
325 Ga0068871_100652075
326 Ga0068871_101149065
327 Ga0075428_100002824
328 Ga0075428_101015289
329 Ga0075431_100405514
330 Ga0075431_100667046
331 Ga0075433_10230285
332 Ga0075434_100061945
333 Ga0075434_101026823
334 Ga0075429_100189368
335 Ga0068865_100577373
336 Ga0075436_100070968
337 Ga0097620_100227615
338 Ga0075435_100020027
339 Ga0075435_100318401
340 Ga0075435_100847655
341 Ga0111539_10011205
342 Ga0111539_10099080
343 Ga0105245_10855693
344 Ga0105245_10859761
345 Ga0114129_11328640
346 Ga0105243_10444774
347 Ga0105243_12588551
348 Ga0105248_10443283
349 Ga0105249_10034973
350 Ga0105249_10257922
351 Ga0099796_10271116
352 Ga0157370_10239570
353 Ga0157378_12102278
354 Ga0163162_10084764
355 Ga0163162_10643610
356 Ga0157375_10186958
357 Ga0157380_10038676
358 Ga0157380_10161937
359 Ga0157380_10164993
360 Ga0157377_10000040
361 Ga0157377_10124947
362 Ga0157379_11630022
363 Ga0157376_10313316
364 Ga0157376_10483738
365 Ga0157376_10703234
366 Ga0163161_10841052
367 Ga0213876_10002312
368 Ga0207692_10010149
369 Ga0207685_10361492
370 Ga0207663_11405862
371 Ga0207662_10111168
372 Ga0207646_10308131
373 Ga0207650_10142363
374 Ga0207659_10538065
375 Ga0207687_10211001
376 Ga0207644_10923464
377 Ga0207709_10983814
378 Ga0207669_11022233
379 Ga0207704_10455937
380 Ga0207665_10254566
381 Ga0207665_10445856
382 Ga0207691_10218078
383 Ga0207711_10384449
384 Ga0207689_10121283
385 Ga0207689_11444802
386 Ga0207661_11068255
387 Ga0207667_10095786
388 Ga0207651_10522649
389 Ga0207651_10621573
390 Ga0207651_11899574
391 Ga0207712_10064714
392 Ga0207640_10018735
393 Ga0207677_10000005
394 Ga0207703_10238791
395 Ga0207703_11573783
396 Ga0207708_10322592
397 Ga0207676_10000020
398 Ga0207675_100092219
399 Ga0207675_100819356
400 Ga0207675_100853344
401 Ga0207675_101341415
402 Ga0207698_12263005
403 Ga0207428_10320861
404 Ga0268265_10429064
405 Ga0268264_10002356
406 Ga0265319_1279827
407 Ga0265328_10146284
408 Ga0316576_10000299
409 Ga0316576_10721898
410 Ga0316578_10018985
411 Ga0316578_10820900
412 Ga0316577_10618561
413 Ga0316577_10746928
414 Ga0307416_100395172
415 Ga0373944_0293335
416 Ga0373943_0050054
417 Ga0316574_0798963
418 Ga0316574_0818547
419 Ga0373927_0034392
420 Ga0373947_0119295
421 Ga0373937_0560173
422 Ga0373937_1458748
423 Ga0316582_0795071
424 Ga0316584_0480746
425 Ga0373925_0381684
426 Ga0436364_0805646
427 Ga0436365_0711227
428 Ga0436361_0823101
429 Ga0436361_1181958
430 Ga0451787_256142
431 Ga0451807_0989699
432 Ga0451807_1699156
433 Ga0451807_2337326
434 Ga0451837_1284370
435 Ga0439464_0181273
436 Ga0453683_0020237
437 Ga0453684_0026983
438 Ga0451576_1478959
439 Ga0495590_0402552
440 Ga0495629_0123546
441 Ga0495639_0016504
442 Ga0495620_0000799
443 Ga0495620_0366262
444 Ga0495640_0162559
445 Ga0495658_0795638
446 Ga0495624_0671033
447 Ga0495600_0152097
448 Ga0495581_0132695
449 Ga0495636_0341031
450 Ga0495676_0189734
451 Ga0495680_0622148
452 Ga0495686_0175956
453 Ga0496104_1877986
454 Ga0496109_0900215
455 Ga0496119_0236911
456 Ga0501034_0102685
457 Ga0501034_0620912
458 Ga0501042_0521662
459 Ga0501047_0193628
460 Ga0501048_0150310
461 Ga0501067_0063218
462 Ga0501068_0044911
463 Ga0501068_1011451
464 Ga0501071_0012762
465 Ga0501071_0134770
466 Ga0501072_1107282
467 Ga0501072_1134290
468 Ga0501073_0029143
469 Ga0501073_0463319
470 Ga0501074_0108001
471 Ga0501074_1319002
472 Ga0501075_0043753
473 Ga0501077_0000245
474 Ga0501199_001955
475 Ga0501236_052330
476 Ga0501257_065524
477 Ga0501080_0678387
478 Ga0501081_0315341
479 Ga0501083_0052960
480 Ga0501083_0835310
481 Ga0501083_1049050
482 nmdc:mga0k408_200121_c1
483 nmdc:mga0k408_304988_c1
484 nmdc:mga05p37_1646961_c1
485 nmdc:mga09592_1083952_c1
486 nmdc:mga09592_577705_c1
487 nmdc:mga09592_869287_c1
488 nmdc:mga06r32_668189_c1
489 nmdc:mga08y16_265590_c1
490 nmdc:mga0n895_21799_c1
491 nmdc:mga0rr50_477226_c1
492 nmdc:mga0rr50_60189_c1
493 nmdc:mga08x19_113409_c1
494 nmdc:mga08x19_949776_c1
495 nmdc:mga0a205_157153_c1
496 Ga0495601_0246345
497 Ga0500597_152620
498 Ga0501084_0384452
499 Ga0501084_0654351
500 Ga0590074_063515
501 Ga0501082_0000270
502 Ga0501082_1924963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

38

83

0.95

PF13560

HTH_31

Helix-turn-helix domain

35

94

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zz8-assembly2.cif.gz_C crystal structure of feii hppe in complex with substrate form 2 0.9133 32 66
2xj3-assembly1.cif.gz_A high resolution structure of the t55c mutant of cylr2. 0.9048 35 83
4yba-assembly1.cif.gz_A the structure of the c.kpn2i controller protein 0.8798 31 85
1utx-assembly1.cif.gz_B regulation of cytolysin expression by enterococcus faecalis: role of cylr2 0.8795 34 83
2auw-assembly1.cif.gz_B crystal structure of putative dna binding protein ne0471 from nitrosomonas europaea atcc 19718 0.8763 31 78
ID Description Score Start End Superfamily
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9418 35 74 1.10.260.40
af_Q58006_80_170_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9127 28 83 1.10.260.40
af_Q2FY91_1_87_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8964 35 83 1.10.260.40
4ybaA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8798 31 85 1.10.260.40
2bnoA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8674 32 66 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A7Y3BSH5-F1-model_v4 Helix-turn-helix domain-containing protein 0.9903 15 93 GO:0003677
AF-A0A8B5X1Y0-F1-model_v4 Transcriptional regulator 0.9667 16 96 GO:0003677
AF-A0A8B5X1Y0-F1-model_v4 Transcriptional regulator 0.955 16 96 GO:0003677
AF-A0A7V9N534-F1-model_v4 Type II toxin-antitoxin system HicB family antitoxin 0.9408 30 92 GO:0003677
AF-A0A7V9B1Z4-F1-model_v4 Helix-turn-helix domain-containing protein 0.9405 30 95 GO:0003677

Map