F361814

General Info

Members Datasets Scaffolds Average Seq Length
250 186 243 222

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0759017|Ga0466967_0759017_198_926
Length 242
Sequence LKRKATIVKIGIVKMVKMKSRLNFVHRFIPPKDVPSDEKVRQLATTEGKAFTTFLLLHGTGGNEEDLIPLAYEIDKRAAILSPRGKVLENGIAPRFFRRLAEGIFDIEDLIFRTNELADFVNDASKTYGFDLQHIIAVGYSNGANIAASMLLLRPEILSSAILFRAMVPLVPQTLPDLTKMHILISSGLYDPIVSRQEAEKLLALFRNAGANVSISWQESGHELSMDDIRKAKEWLLQYSSL

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
4 2643221734 Bosea sp. Root670 Isolate Unclassified
5 2773857925 Microvirga vignae BR3299 Isolate Unclassified
6 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
7 2902330777 Methylobacterium sp. 2A Isolate Unclassified
8 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
9 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
10 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
128 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
166 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
167 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
168 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.6
Metatranscriptomes 9.6
Isolates 2.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.8
Nodule 0
Rhizoplane 6.8
Rhizosphere 80.8
Stem 0
Stem Tuber 0
Unclassified 5.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_6740322 2162886011 Archaea 3149
2 MBSR1b_contig_1121171 2162886012 Unclassified 2573
3 ARcpr5oldR_c001080 3300000041 Archaea 2863
4 JGI25151J46595_10000047 3300003187 Bacteria 166938
5 Ga0055538_1000276 3300003751 Bacteria 26446
6 Ga0055526_1000468 3300003771 Bacteria 32069
7 Ga0055524_1000352 3300003775 Bacteria 41872
8 Ga0058863_11955504 3300004799 Archaea 843
9 Ga0058862_10123790 3300004803 Archaea 2066
10 Ga0065704_10087015 3300005289 Archaea 3051
11 Ga0065712_10001727 3300005290 Archaea 19903
12 Ga0065715_10003922 3300005293 Archaea 5994
13 Ga0065707_10034718 3300005295 Bacteria 943
14 Ga0070682_100008929 3300005337 Archaea 5661
15 Ga0070682_100656724 3300005337 Archaea 835
16 Ga0068868_100083494 3300005338 Unclassified 2564
17 Ga0068868_100113810 3300005338 Archaea 2201
18 Ga0070691_10036012 3300005341 Archaea 2332
19 Ga0070691_10139001 3300005341 Archaea 1236
20 Ga0070675_100369548 3300005354 Archaea 1275
21 Ga0070709_10001979 3300005434 Archaea 11170
22 Ga0070709_10020014 3300005434 Unclassified 3879
23 Ga0070709_10025044 3300005434 Archaea 3521
24 Ga0070709_10403015 3300005434 Archaea 1022
25 Ga0070713_100359834 3300005436 Archaea 1352
26 Ga0070710_10008005 3300005437 Archaea 5138
27 Ga0070710_10123750 3300005437 Archaea 1569
28 Ga0070711_100000529 3300005439 Archaea 19839
29 Ga0070711_100001587 3300005439 Archaea 12517
30 Ga0070711_100015804 3300005439 Archaea 4780
31 Ga0070711_100078307 3300005439 Archaea 2348
32 Ga0070705_100026655 3300005440 Archaea 3148
33 Ga0070708_100264649 3300005445 Bacteria 1617
34 Ga0070678_100086498 3300005456 Archaea 2391
35 Ga0070678_100577140 3300005456 Bacteria 1001
36 Ga0070684_100092089 3300005535 Archaea 2697
37 Ga0070695_100466797 3300005545 Bacteria 970
38 Ga0070696_100000601 3300005546 Bacteria 23057
39 Ga0070665_100000007 3300005548 Bacteria 649878
40 Ga0070665_100447728 3300005548 Bacteria 1301
41 Ga0068854_100212228 3300005578 Archaea 1527
42 Ga0068856_100037754 3300005614 Archaea 4740
43 Ga0068856_100153333 3300005614 Archaea 2313
44 Ga0068864_100463010 3300005618 Archaea 1214
45 Ga0068863_100427746 3300005841 Bacteria 1298
46 Ga0068860_100000135 3300005843 Bacteria 120265
47 Ga0081455_10313178 3300005937 Unclassified 1121
48 Ga0081538_10007901 3300005981 Archaea 9116
49 Ga0081540_1005344 3300005983 Bacteria 9608
50 Ga0081539_10001146 3300005985 Bacteria 48005
51 Ga0075368_10007377 3300006042 Bacteria 3878
52 Ga0075364_10137986 3300006051 Bacteria 1639
53 Ga0070715_10000338 3300006163 Archaea 11690
54 Ga0070715_10004372 3300006163 Archaea 4628
55 Ga0070715_10013986 3300006163 Archaea 2960
56 Ga0070716_100000085 3300006173 Archaea 36733
57 Ga0070712_100000535 3300006175 Archaea 21858
58 Ga0075369_10030513 3300006186 Bacteria 2271
59 Ga0075369_10109739 3300006186 Bacteria 1243
60 Ga0068871_100105007 3300006358 Archaea 2370
61 Ga0068871_100359344 3300006358 Archaea 1290
62 Ga0075430_100326264 3300006846 Archaea 1269
63 Ga0075431_100350380 3300006847 Archaea 1484
64 Ga0075433_10052363 3300006852 Archaea 3557
65 Ga0075433_10275717 3300006852 Archaea 1490
66 Ga0075434_100007370 3300006871 Archaea 10183
67 Ga0075434_100028700 3300006871 Archaea 5470
68 Ga0075434_100063430 3300006871 Archaea 3677
69 Ga0075434_100087501 3300006871 Archaea 3116
70 Ga0075429_100551562 3300006880 Unclassified 1010
71 Ga0075436_100080468 3300006914 Archaea 2257
72 Ga0075436_100126672 3300006914 Archaea 1789
73 Ga0075435_100033340 3300007076 Archaea 4071
74 Ga0075435_100086326 3300007076 Archaea 2584
75 Ga0111539_10118460 3300009094 Bacteria 3103
76 Ga0105247_10075940 3300009101 Archaea 2109
77 Ga0105247_10211500 3300009101 Bacteria 1308
78 Ga0114129_10010598 3300009147 Archaea 13143
79 Ga0114129_10062310 3300009147 Archaea 5211
80 Ga0105241_10110409 3300009174 Archaea 2200
81 Ga0105241_10116955 3300009174 Archaea 2142
82 Ga0105237_10474217 3300009545 Archaea 1257
83 Ga0105238_10823542 3300009551 Bacteria 944
84 Ga0105249_10107771 3300009553 Bacteria 2629
85 Ga0105249_10322698 3300009553 Bacteria 1556
86 Ga0105239_10152624 3300010375 Bacteria 2578
87 Ga0105246_10021681 3300011119 Archaea 4137
88 Ga0157374_10017755 3300013296 Archaea 6270
89 Ga0157374_10165183 3300013296 Archaea 2157
90 Ga0157378_10048763 3300013297 Archaea 3766
91 Ga0157378_10188582 3300013297 Bacteria 1943
92 Ga0157378_10528537 3300013297 Archaea 1182
93 Ga0157372_10824228 3300013307 Archaea 1077
94 Ga0157375_10011951 3300013308 Bacteria 7685
95 Ga0157375_10067899 3300013308 Archaea 3564
96 Ga0157375_11724947 3300013308 Bacteria 742
97 Ga0163163_10227933 3300014325 Unclassified 1912
98 Ga0157380_10054356 3300014326 Bacteria 3177
99 Ga0157377_10001133 3300014745 Archaea 11295
100 Ga0157377_10015285 3300014745 Archaea 3923
101 Ga0157377_10025152 3300014745 Bacteria 3173
102 Ga0157379_10398936 3300014968 Archaea 1264
103 Ga0157376_10342046 3300014969 Archaea 1429
104 Ga0182006_1009864 3300015261 Unclassified 4269
105 Ga0182007_10004667 3300015262 Archaea 6178
106 Ga0182005_1052441 3300015265 Archaea 1111
107 Ga0206356_10442958 3300020070 Archaea 891
108 Ga0206349_1871181 3300020075 Archaea 2400
109 Ga0213874_10005355 3300021377 Bacteria 2985
110 Ga0224712_10024020 3300022467 Archaea 2124
111 Ga0224712_10105345 3300022467 Bacteria 1202
112 Ga0209784_100165 3300025224 Bacteria 57266
113 Ga0209675_1001330 3300025291 Bacteria 14616
114 Ga0209025_1000016 3300025294 Bacteria 770739
115 Ga0209564_1000035 3300025295 Bacteria 442446
116 Ga0209256_1000025 3300025299 Bacteria 442449
117 Ga0207692_10016444 3300025898 Archaea 3277
118 Ga0207688_10017313 3300025901 Archaea 3916
119 Ga0207685_10000158 3300025905 Archaea 10231
120 Ga0207685_10004112 3300025905 Archaea 3648
121 Ga0207699_10001333 3300025906 Archaea 11725
122 Ga0207699_10038788 3300025906 Archaea 2733
123 Ga0207699_10101606 3300025906 Archaea 1826
124 Ga0207695_10078098 3300025913 Bacteria 3359
125 Ga0207695_10159042 3300025913 Bacteria 2192
126 Ga0207671_10577399 3300025914 Archaea 896
127 Ga0207693_10000341 3300025915 Archaea 43032
128 Ga0207693_10002416 3300025915 Archaea 16214
129 Ga0207663_10000127 3300025916 Archaea 36602
130 Ga0207663_10000179 3300025916 Archaea 28398
131 Ga0207663_10002890 3300025916 Archaea 8299
132 Ga0207665_10000149 3300025939 Archaea 47417
133 Ga0207661_10090736 3300025944 Archaea 2545
134 Ga0207661_10357254 3300025944 Archaea 1319
135 Ga0207712_10258937 3300025961 Bacteria 1410
136 Ga0207677_10096251 3300026023 Bacteria 2165
137 Ga0207677_10177753 3300026023 Archaea 1671
138 Ga0207677_10216518 3300026023 Archaea 1533
139 Ga0207703_10051617 3300026035 Bacteria 3334
140 Ga0207702_10194969 3300026078 Archaea 1874
141 Ga0207641_10461972 3300026088 Bacteria 1228
142 Ga0207641_10753172 3300026088 Bacteria 962
143 Ga0207683_10060304 3300026121 Archaea 3335
144 Ga0207683_10562713 3300026121 Bacteria 1054
145 Ga0207683_10653498 3300026121 Archaea 974
146 Ga0268266_10242193 3300028379 Bacteria 1665
147 Ga0268264_10000038 3300028381 Bacteria 383623
148 Ga0307513_10053180 3300031456 Bacteria 4355
149 Ga0307509_10437402 3300031507 Bacteria 1005
150 Ga0307408_100173727 3300031548 Bacteria 1722
151 Ga0307405_10417031 3300031731 Bacteria 1055
152 Ga0307413_10034071 3300031824 Archaea 2907
153 Ga0307413_10592601 3300031824 Bacteria 906
154 Ga0307410_10139361 3300031852 Archaea 1792
155 Ga0307409_100417484 3300031995 Archaea 1286
156 Ga0307416_100126739 3300032002 Bacteria 2288
157 Ga0307414_10066324 3300032004 Archaea 2580
158 Ga0373934_0000277 3300035086 Bacteria 18535
159 Ga0373953_0000500 3300035117 Bacteria 10897
160 Ga0373956_0015888 3300035119 Bacteria 3157
161 Ga0373957_0005138 3300035120 Bacteria 4041
162 Ga0373955_0188501 3300035172 Bacteria 1225
163 Ga0373924_0151649 3300035410 Bacteria 1014
164 Ga0373933_0640212 3300035724 Bacteria 699
165 Ga0242420_005112 3300038996 Archaea 2016
166 Ga0436365_0151344 3300039437 Archaea 1347
167 Ga0436365_1914724 3300039437 Bacteria 2413
168 Ga0436363_1564337 3300039450 Bacteria 3312
169 Ga0436362_0925838 3300039453 Archaea 832
170 Ga0439448_0270080 3300042005 Bacteria 602
171 Ga0439451_011994 3300042009 Archaea 1748
172 Ga0451577_0044961 3300042876 Bacteria 3952
173 Ga0466970_0313700 3300044765 Bacteria 886
174 Ga0466967_0759017 3300045976 Archaea 962
175 Ga0495592_0043344 3300046454 Bacteria 3366
176 Ga0495653_0557461 3300046463 Bacteria 708
177 Ga0495628_0309261 3300046516 Bacteria 1168
178 Ga0495587_0007681 3300046536 Bacteria 6975
179 Ga0495667_0142962 3300046559 Bacteria 1541
180 Ga0495657_0021754 3300046675 Bacteria 4600
181 Ga0495604_0149072 3300047317 Bacteria 1664
182 Ga0495680_0246769 3300047322 Bacteria 1266
183 Ga0495675_0001098 3300047444 Bacteria 16419
184 Ga0496102_0071248 3300048905 Archaea 3191
185 Ga0496103_0212609 3300048906 Archaea 1244
186 Ga0496104_0089592 3300048907 Archaea 2939
187 Ga0496105_0033877 3300048908 Archaea 4198
188 Ga0496106_0040508 3300048909 Bacteria 3489
189 Ga0496106_0044970 3300048909 Unclassified 3315
190 Ga0496106_0171179 3300048909 Archaea 1721
191 Ga0496106_0334411 3300048909 Archaea 1216
192 Ga0496107_0067613 3300048910 Archaea 2593
193 Ga0496107_0099206 3300048910 Archaea 2134
194 Ga0496111_0079214 3300048914 Bacteria 2396
195 Ga0496111_0169816 3300048914 Archaea 1620
196 Ga0496112_0484859 3300048915 Archaea 1172
197 Ga0496113_0267473 3300048916 Archaea 1366
198 Ga0496114_0617556 3300048917 Unclassified 955
199 Ga0496115_0314155 3300048918 Archaea 1283
200 Ga0496121_0041938 3300048924 Bacteria 3990
201 Ga0496126_0054881 3300048929 Bacteria 3607
202 Ga0496126_0098832 3300048929 Bacteria 2557
203 Ga0501076_1107950 3300049592 Bacteria 652
204 Ga0501209_075483 3300049656 Archaea 965
205 Ga0501045_0217677 3300049824 Unclassified 1422
206 nmdc:mga05p37_190697_c1 3300050507 Archaea 2489
207 nmdc:mga05p37_569417_c2 3300050507 Bacteria 849
208 nmdc:mga09592_47646_c1 3300050508 Unclassified 3612
209 nmdc:mga06r32_564205_c1 3300050510 Archaea 1111
210 nmdc:mga08y16_1741_c1 3300050511 Bacteria 22071
211 nmdc:mga08y16_399751_c1 3300050511 Bacteria 1406
212 nmdc:mga0n895_125785_c1 3300050512 Archaea 2587
213 nmdc:mga0n895_13103_c1 3300050512 Archaea 7462
214 nmdc:mga0n895_17536_c1 3300050512 Archaea 6601
215 nmdc:mga0n895_443182_c1 3300050512 Unclassified 1312
216 nmdc:mga0rr50_104029_c1 3300050513 Archaea 2236
217 nmdc:mga0rr50_459989_c1 3300050513 Archaea 1079
218 nmdc:mga08x19_101320_c1 3300050514 Archaea 1911
219 nmdc:mga0a205_62478_c1 3300050515 Archaea 3598
220 nmdc:mga0a205_87047_c1 3300050515 Archaea 3018
221 nmdc:mga0sz30_23389_c1 3300050516 Bacteria 2513
222 Ga0495595_0007506 3300053084 Bacteria 4467
223 Ga0500556_0034315 3300053104 Bacteria 1745
224 Ga0500572_000102 3300053111 Bacteria 27944
225 Ga0500616_0012562 3300053153 Bacteria 4953
226 Ga0587093_004635 3300059478 Archaea 1412
227 Ga0587066_002178 3300059490 Archaea 2118
228 Ga0587070_005634 3300059491 Archaea 1650
229 Ga0587073_0020231 3300059492 Archaea 1266
230 Ga0587086_008337 3300059507 Archaea 1209
231 Ga0587088_020983 3300059508 Archaea 1089
232 Ga0587089_001835 3300059509 Archaea 2057
233 Ga0587106_004110 3300059605 Archaea 1577
234 Ga0587099_000639 3300059622 Archaea 2135
235 Ga0587117_027062 3300059627 Archaea 841
236 Ga0587062_003072 3300059639 Archaea 1657
237 Ga0587067_004278 3300059640 Archaea 1848
238 Ga0587067_012349 3300059640 Bacteria 1332
239 Ga0587069_002312 3300059642 Archaea 1908
240 Ga0587076_002877 3300059645 Archaea 1985
241 Ga0587107_004975 3300059652 Archaea 1381
242 Ga0587114_020999 3300059655 Archaea 921
243 Ga0587071_006979 3300060344 Archaea 1785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10118460 Ga0111539_101184602 175
2 3300013308 Ga0157375_10011951 Ga0157375_100119516 175
3 3300014326 Ga0157380_10054356 Ga0157380_100543563 175
4 3300014745 Ga0157377_10025152 Ga0157377_100251524 175
5 3300050507 nmdc:mga05p37_569417_c2 nmdc:mga05p37_569417_c2_100_660 175
6 3300050508 nmdc:mga09592_47646_c1 nmdc:mga09592_47646_c1_2679_3239 175
7 3300050511 nmdc:mga08y16_1741_c1 nmdc:mga08y16_1741_c1_20255_20815 175
8 3300042005 Ga0439448_0270080 Ga0439448_0270080_34_585 182
9 3300049592 Ga0501076_1107950 Ga0501076_1107950_12_593 192
10 3300042876 Ga0451577_0044961 Ga0451577_0044961_243_860 195
11 iso_pu_bacteria 2773857925 2774868336 196
12 3300005545 Ga0070695_100466797 Ga0070695_1004667971 199
13 3300005546 Ga0070696_100000601 Ga0070696_1000006017 199
14 3300031548 Ga0307408_100173727 Ga0307408_1001737271 199
15 3300031731 Ga0307405_10417031 Ga0307405_104170312 199
16 3300032002 Ga0307416_100126739 Ga0307416_1001267394 199
17 3300050511 nmdc:mga08y16_399751_c1 nmdc:mga08y16_399751_c1_51_668 199
18 3300003751 Ga0055538_1000276 Ga0055538_10002764 202
19 3300025224 Ga0209784_100165 Ga0209784_1001655 202
20 iso_pu_bacteria 2595698237 2596374756 202
21 iso_pu_bacteria 2643221734 2644733243 202
22 iso_pu_bacteria 2902330777 2902330940 202
23 iso_pu_bacteria 2917699015 2917700756 202
24 iso_pu_bacteria 2928125067 2928125466 202
25 3300005295 Ga0065707_10034718 Ga0065707_100347182 203
26 3300005985 Ga0081539_10001146 Ga0081539_1000114634 203
27 3300006186 Ga0075369_10030513 Ga0075369_100305132 203
28 3300050516 nmdc:mga0sz30_23389_c1 nmdc:mga0sz30_23389_c1_505_1119 203
29 3300035724 Ga0373933_0640212 Ga0373933_0640212_11_628 204
30 3300053104 Ga0500556_0034315 Ga0500556_0034315_404_1042 204
31 3300005445 Ga0070708_100264649 Ga0070708_1002646493 205
32 3300009551 Ga0105238_10823542 Ga0105238_108235422 205
33 3300013308 Ga0157375_11724947 Ga0157375_117249471 205
34 3300025913 Ga0207695_10078098 Ga0207695_100780982 205
35 3300003187 JGI25151J46595_10000047 JGI25151J46595_1000004783 206
36 3300003771 Ga0055526_1000468 Ga0055526_100046825 206
37 3300003775 Ga0055524_1000352 Ga0055524_100035213 206
38 3300005843 Ga0068860_100000135 Ga0068860_10000013565 206
39 3300005983 Ga0081540_1005344 Ga0081540_100534410 206
40 3300006042 Ga0075368_10007377 Ga0075368_100073772 206
41 3300006051 Ga0075364_10137986 Ga0075364_101379862 206
42 3300009101 Ga0105247_10211500 Ga0105247_102115002 206
43 3300025291 Ga0209675_1001330 Ga0209675_100133016 206
44 3300025294 Ga0209025_1000016 Ga0209025_1000016145 206
45 3300025295 Ga0209564_1000035 Ga0209564_1000035304 206
46 3300025299 Ga0209256_1000025 Ga0209256_1000025142 206
47 3300026035 Ga0207703_10051617 Ga0207703_100516171 206
48 3300026088 Ga0207641_10753172 Ga0207641_107531722 206
49 3300028381 Ga0268264_10000038 Ga0268264_10000038143 206
50 3300031456 Ga0307513_10053180 Ga0307513_100531802 206
51 3300031507 Ga0307509_10437402 Ga0307509_104374022 206
52 3300044765 Ga0466970_0313700 Ga0466970_0313700_13_645 206
53 3300048924 Ga0496121_0041938 Ga0496121_0041938_298_939 206
54 3300048929 Ga0496126_0098832 Ga0496126_0098832_374_1015 206
55 3300053111 Ga0500572_000102 Ga0500572_000102_2040_2693 206
56 3300005548 Ga0070665_100447728 Ga0070665_1004477282 207
57 3300005841 Ga0068863_100427746 Ga0068863_1004277462 207
58 3300009553 Ga0105249_10107771 Ga0105249_101077714 207
59 3300010375 Ga0105239_10152624 Ga0105239_101526243 207
60 3300025913 Ga0207695_10159042 Ga0207695_101590422 207
61 3300025961 Ga0207712_10258937 Ga0207712_102589372 207
62 3300026088 Ga0207641_10461972 Ga0207641_104619722 207
63 3300028379 Ga0268266_10242193 Ga0268266_102421932 207
64 3300035086 Ga0373934_0000277 Ga0373934_0000277_17687_18313 207
65 3300035117 Ga0373953_0000500 Ga0373953_0000500_8788_9414 207
66 3300035119 Ga0373956_0015888 Ga0373956_0015888_165_791 207
67 3300035120 Ga0373957_0005138 Ga0373957_0005138_340_966 207
68 3300035172 Ga0373955_0188501 Ga0373955_0188501_318_944 207
69 3300035410 Ga0373924_0151649 Ga0373924_0151649_165_791 207
70 3300046454 Ga0495592_0043344 Ga0495592_0043344_2211_2837 207
71 3300046463 Ga0495653_0557461 Ga0495653_0557461_16_642 207
72 3300046536 Ga0495587_0007681 Ga0495587_0007681_282_908 207
73 3300046559 Ga0495667_0142962 Ga0495667_0142962_320_946 207
74 3300046675 Ga0495657_0021754 Ga0495657_0021754_1414_2040 207
75 3300047317 Ga0495604_0149072 Ga0495604_0149072_64_690 207
76 3300047322 Ga0495680_0246769 Ga0495680_0246769_193_819 207
77 3300047444 Ga0495675_0001098 Ga0495675_0001098_2202_2828 207
78 3300048929 Ga0496126_0054881 Ga0496126_0054881_2075_2701 207
79 3300053084 Ga0495595_0007506 Ga0495595_0007506_2977_3603 207
80 3300005456 Ga0070678_100577140 Ga0070678_1005771402 208
81 3300026121 Ga0207683_10562713 Ga0207683_105627132 208
82 3300031824 Ga0307413_10592601 Ga0307413_105926012 208
83 3300053153 Ga0500616_0012562 Ga0500616_0012562_2756_3400 208
84 3300009553 Ga0105249_10322698 Ga0105249_103226982 209
85 3300022467 Ga0224712_10105345 Ga0224712_101053452 209
86 3300042009 Ga0439451_011994 Ga0439451_011994_583_1215 209
87 3300005548 Ga0070665_100000007 Ga0070665_100000007244 210
88 3300021377 Ga0213874_10005355 Ga0213874_100053552 210
89 3300039437 Ga0436365_1914724 Ga0436365_1914724_1608_2246 210
90 3300039450 Ga0436363_1564337 Ga0436363_1564337_2239_2877 210
91 3300020070 Ga0206356_10442958 Ga0206356_104429581 211
92 3300050512 nmdc:mga0n895_443182_c1 nmdc:mga0n895_443182_c1_213_848 211
93 3300006186 Ga0075369_10109739 Ga0075369_101097391 212
94 3300031824 Ga0307413_10034071 Ga0307413_100340712 212
95 3300031852 Ga0307410_10139361 Ga0307410_101393612 212
96 3300031995 Ga0307409_100417484 Ga0307409_1004174842 212
97 3300032004 Ga0307414_10066324 Ga0307414_100663242 212
98 3300004799 Ga0058863_11955504 Ga0058863_119555041 213
99 3300005289 Ga0065704_10087015 Ga0065704_100870152 213
100 3300005337 Ga0070682_100656724 Ga0070682_1006567241 213
101 3300005578 Ga0068854_100212228 Ga0068854_1002122282 213
102 3300006358 Ga0068871_100359344 Ga0068871_1003593442 213
103 3300006880 Ga0075429_100551562 Ga0075429_1005515622 213
104 3300013296 Ga0157374_10017755 Ga0157374_100177558 213
105 3300014969 Ga0157376_10342046 Ga0157376_103420462 213
106 3300026023 Ga0207677_10216518 Ga0207677_102165182 213
107 3300026121 Ga0207683_10653498 Ga0207683_106534982 213
108 3300049656 Ga0501209_075483 Ga0501209_075483_11_658 213
109 iso_pu_bacteria 2786546517 2787438285 213
110 3300005338 Ga0068868_100083494 Ga0068868_1000834942 214
111 3300005341 Ga0070691_10036012 Ga0070691_100360123 214
112 3300005434 Ga0070709_10001979 Ga0070709_100019798 214
113 3300005437 Ga0070710_10008005 Ga0070710_100080054 214
114 3300005439 Ga0070711_100015804 Ga0070711_1000158047 214
115 3300005440 Ga0070705_100026655 Ga0070705_1000266553 214
116 3300005456 Ga0070678_100086498 Ga0070678_1000864984 214
117 3300005614 Ga0068856_100037754 Ga0068856_1000377544 214
118 3300006163 Ga0070715_10000338 Ga0070715_100003382 214
119 3300006173 Ga0070716_100000085 Ga0070716_10000008542 214
120 3300006175 Ga0070712_100000535 Ga0070712_1000005359 214
121 3300009174 Ga0105241_10110409 Ga0105241_101104091 214
122 3300013297 Ga0157378_10048763 Ga0157378_100487632 214
123 3300013297 Ga0157378_10188582 Ga0157378_101885822 214
124 3300014325 Ga0163163_10227933 Ga0163163_102279332 214
125 3300014745 Ga0157377_10001133 Ga0157377_100011339 214
126 3300025898 Ga0207692_10016444 Ga0207692_100164442 214
127 3300025901 Ga0207688_10017313 Ga0207688_100173132 214
128 3300025905 Ga0207685_10000158 Ga0207685_100001588 214
129 3300025906 Ga0207699_10001333 Ga0207699_100013338 214
130 3300025915 Ga0207693_10000341 Ga0207693_1000034136 214
131 3300025916 Ga0207663_10000127 Ga0207663_1000012724 214
132 3300025939 Ga0207665_10000149 Ga0207665_100001498 214
133 3300025944 Ga0207661_10357254 Ga0207661_103572542 214
134 3300026023 Ga0207677_10096251 Ga0207677_100962512 214
135 3300026121 Ga0207683_10060304 Ga0207683_100603042 214
136 3300046516 Ga0495628_0309261 Ga0495628_0309261_335_982 214
137 3300048905 Ga0496102_0071248 Ga0496102_0071248_1488_2180 214
138 3300048908 Ga0496105_0033877 Ga0496105_0033877_2249_2941 214
139 3300048909 Ga0496106_0044970 Ga0496106_0044970_302_994 214
140 3300048914 Ga0496111_0079214 Ga0496111_0079214_302_994 214
141 3300048915 Ga0496112_0484859 Ga0496112_0484859_379_1071 214
142 3300048917 Ga0496114_0617556 Ga0496114_0617556_178_873 214
143 3300050512 nmdc:mga0n895_125785_c1 nmdc:mga0n895_125785_c1_1872_2567 214
144 3300059640 Ga0587067_012349 Ga0587067_012349_112_804 214
145 3300005434 Ga0070709_10403015 Ga0070709_104030152 215
146 3300005436 Ga0070713_100359834 Ga0070713_1003598342 215
147 3300005437 Ga0070710_10123750 Ga0070710_101237503 215
148 3300005439 Ga0070711_100000529 Ga0070711_10000052914 215
149 3300006846 Ga0075430_100326264 Ga0075430_1003262643 215
150 3300025916 Ga0207663_10000179 Ga0207663_1000017912 215
151 3300048910 Ga0496107_0067613 Ga0496107_0067613_17_724 215
152 3300005434 Ga0070709_10020014 Ga0070709_100200142 216
153 3300005439 Ga0070711_100001587 Ga0070711_10000158714 216
154 3300006163 Ga0070715_10013986 Ga0070715_100139864 216
155 3300006871 Ga0075434_100028700 Ga0075434_1000287008 216
156 3300006914 Ga0075436_100080468 Ga0075436_1000804682 216
157 3300007076 Ga0075435_100033340 Ga0075435_1000333406 216
158 3300015261 Ga0182006_1009864 Ga0182006_10098644 216
159 3300015262 Ga0182007_10004667 Ga0182007_100046672 216
160 3300025905 Ga0207685_10004112 Ga0207685_100041124 216
161 3300025906 Ga0207699_10038788 Ga0207699_100387882 216
162 3300025916 Ga0207663_10002890 Ga0207663_100028904 216
163 3300048909 Ga0496106_0040508 Ga0496106_0040508_1363_2061 216
164 3300050510 nmdc:mga06r32_564205_c1 nmdc:mga06r32_564205_c1_364_1065 216
165 3300050513 nmdc:mga0rr50_104029_c1 nmdc:mga0rr50_104029_c1_960_1658 216
166 3300050514 nmdc:mga08x19_101320_c1 nmdc:mga08x19_101320_c1_420_1118 216
167 3300050515 nmdc:mga0a205_87047_c1 nmdc:mga0a205_87047_c1_1123_1821 216
168 3300059507 Ga0587086_008337 Ga0587086_008337_39_755 216
169 3300005981 Ga0081538_10007901 Ga0081538_1000790112 217
170 3300049824 Ga0501045_0217677 Ga0501045_0217677_554_1225 217
171 3300000041 ARcpr5oldR_c001080 ARcpr5oldR_0010803 218
172 3300004803 Ga0058862_10123790 Ga0058862_101237901 218
173 3300005337 Ga0070682_100008929 Ga0070682_1000089292 218
174 3300005338 Ga0068868_100113810 Ga0068868_1001138103 218
175 3300005341 Ga0070691_10139001 Ga0070691_101390012 218
176 3300005354 Ga0070675_100369548 Ga0070675_1003695481 218
177 3300005434 Ga0070709_10025044 Ga0070709_100250442 218
178 3300005439 Ga0070711_100078307 Ga0070711_1000783071 218
179 3300005535 Ga0070684_100092089 Ga0070684_1000920892 218
180 3300005614 Ga0068856_100153333 Ga0068856_1001533332 218
181 3300005618 Ga0068864_100463010 Ga0068864_1004630102 218
182 3300006163 Ga0070715_10004372 Ga0070715_100043723 218
183 3300006358 Ga0068871_100105007 Ga0068871_1001050074 218
184 3300006847 Ga0075431_100350380 Ga0075431_1003503802 218
185 3300006852 Ga0075433_10275717 Ga0075433_102757172 218
186 3300006871 Ga0075434_100007370 Ga0075434_10000737021 218
187 3300006871 Ga0075434_100063430 Ga0075434_1000634304 218
188 3300006914 Ga0075436_100126672 Ga0075436_1001266722 218
189 3300009101 Ga0105247_10075940 Ga0105247_100759401 218
190 3300009174 Ga0105241_10116955 Ga0105241_101169552 218
191 3300009545 Ga0105237_10474217 Ga0105237_104742172 218
192 3300011119 Ga0105246_10021681 Ga0105246_100216813 218
193 3300013296 Ga0157374_10165183 Ga0157374_101651832 218
194 3300013297 Ga0157378_10528537 Ga0157378_105285372 218
195 3300013307 Ga0157372_10824228 Ga0157372_108242282 218
196 3300013308 Ga0157375_10067899 Ga0157375_100678994 218
197 3300014745 Ga0157377_10015285 Ga0157377_100152854 218
198 3300014968 Ga0157379_10398936 Ga0157379_103989362 218
199 3300015265 Ga0182005_1052441 Ga0182005_10524412 218
200 3300020075 Ga0206349_1871181 Ga0206349_18711812 218
201 3300022467 Ga0224712_10024020 Ga0224712_100240202 218
202 3300025906 Ga0207699_10101606 Ga0207699_101016063 218
203 3300025914 Ga0207671_10577399 Ga0207671_105773991 218
204 3300025915 Ga0207693_10002416 Ga0207693_1000241611 218
205 3300025944 Ga0207661_10090736 Ga0207661_100907363 218
206 3300026023 Ga0207677_10177753 Ga0207677_101777532 218
207 3300026078 Ga0207702_10194969 Ga0207702_101949691 218
208 3300039437 Ga0436365_0151344 Ga0436365_0151344_387_1088 218
209 3300039453 Ga0436362_0925838 Ga0436362_0925838_84_770 218
210 3300048906 Ga0496103_0212609 Ga0496103_0212609_218_931 218
211 3300048907 Ga0496104_0089592 Ga0496104_0089592_2030_2743 218
212 3300048909 Ga0496106_0171179 Ga0496106_0171179_741_1454 218
213 3300048910 Ga0496107_0099206 Ga0496107_0099206_1269_1982 218
214 3300048914 Ga0496111_0169816 Ga0496111_0169816_34_747 218
215 3300048916 Ga0496113_0267473 Ga0496113_0267473_211_924 218
216 3300048918 Ga0496115_0314155 Ga0496115_0314155_182_895 218
217 3300050512 nmdc:mga0n895_13103_c1 nmdc:mga0n895_13103_c1_294_1007 218
218 3300050512 nmdc:mga0n895_17536_c1 nmdc:mga0n895_17536_c1_2566_3267 218
219 3300059478 Ga0587093_004635 Ga0587093_004635_651_1364 218
220 3300059490 Ga0587066_002178 Ga0587066_002178_1184_1897 218
221 3300059491 Ga0587070_005634 Ga0587070_005634_861_1574 218
222 3300059492 Ga0587073_0020231 Ga0587073_0020231_346_1059 218
223 3300059508 Ga0587088_020983 Ga0587088_020983_53_766 218
224 3300059509 Ga0587089_001835 Ga0587089_001835_1184_1897 218
225 3300059605 Ga0587106_004110 Ga0587106_004110_846_1559 218
226 3300059622 Ga0587099_000639 Ga0587099_000639_226_939 218
227 3300059627 Ga0587117_027062 Ga0587117_027062_71_784 218
228 3300059639 Ga0587062_003072 Ga0587062_003072_117_830 218
229 3300059640 Ga0587067_004278 Ga0587067_004278_226_939 218
230 3300059642 Ga0587069_002312 Ga0587069_002312_15_728 218
231 3300059645 Ga0587076_002877 Ga0587076_002877_82_795 218
232 3300059652 Ga0587107_004975 Ga0587107_004975_602_1309 218
233 3300059655 Ga0587114_020999 Ga0587114_020999_192_905 218
234 3300060344 Ga0587071_006979 Ga0587071_006979_846_1559 218
235 3300009147 Ga0114129_10062310 Ga0114129_100623104 224
236 3300050507 nmdc:mga05p37_190697_c1 nmdc:mga05p37_190697_c1_845_1525 224
237 2162886011 MRS1b_contig_6740322 MRS1b_0221.00002800 226
238 2162886012 MBSR1b_contig_1121171 MBSR1b_0294.00000700 226
239 3300005290 Ga0065712_10001727 Ga0065712_1000172711 226
240 3300005293 Ga0065715_10003922 Ga0065715_100039226 226
241 3300005937 Ga0081455_10313178 Ga0081455_103131781 226
242 3300006852 Ga0075433_10052363 Ga0075433_100523632 226
243 3300006871 Ga0075434_100087501 Ga0075434_1000875014 226
244 3300007076 Ga0075435_100086326 Ga0075435_1000863262 226
245 3300009147 Ga0114129_10010598 Ga0114129_100105989 226
246 3300038996 Ga0242420_005112 Ga0242420_005112_465_1145 226
247 3300045976 Ga0466967_0759017 Ga0466967_0759017_198_926 226
248 3300048909 Ga0496106_0334411 Ga0496106_0334411_147_827 226
249 3300050513 nmdc:mga0rr50_459989_c1 nmdc:mga0rr50_459989_c1_253_933 226
250 3300050515 nmdc:mga0a205_62478_c1 nmdc:mga0a205_62478_c1_2520_3200 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

106

234

0.87

PF02230

Abhydrolase_2

Phospholipase/Carboxylesterase

39

240

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1i-assembly1.cif.gz_A crystal structure of the bacillus cereus carboxylesterase 0.9776 13 224
2h1i-assembly1.cif.gz_A crystal structure of the bacillus cereus carboxylesterase 0.9414 13 224
3b5e-assembly1.cif.gz_A crystal structure of carboxylesterase (np_108484.1) from mesorhizobium loti at 1.75 a resolution 0.929 14 222
3og9-assembly2.cif.gz_B structure of yahd with malic acid 0.9233 18 224
2r8b-assembly2.cif.gz_B the crystal structure of the protein atu2452 of unknown function from agrobacterium tumefaciens str. c58 0.9219 18 224
ID Description Score Start End Superfamily
2h1iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9805 20 224 3.40.50.1820
af_Q2FVA9_1_197_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9661 20 222 3.40.50.1820
2h1iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9608 20 224 3.40.50.1820
af_Q2FVA9_1_197_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9471 20 222 3.40.50.1820
3og9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9234 18 224 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A6A7LKX4-F1-model_v4 Alpha/beta hydrolase 0.9929 33 223 GO:0016787
AF-A0A2V6F891-F1-model_v4 Phospholipase 0.9918 68 223 GO:0016787
AF-A0A0K2D875-F1-model_v4 deleted 0.9906 18 224
AF-A0A536KII9-F1-model_v4 Alpha/beta hydrolase 0.9888 18 222 GO:0016787
AF-A0A7X6WHA4-F1-model_v4 Carboxylesterase 0.9888 20 136

Feature Viewer

pLDDT pTM Quality
90.04 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map