F361721

General Info

Members Datasets Scaffolds Average Seq Length
250 162 500 254

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0123816|Ga0373947_0123816_705_1508
Length 267
Sequence LSEESVAEPETFTVELNGFSSRIWKAGNGPKLGFIAGFGGLPRWVPFLDALAKERTIIVPSLPGFPGGERGHTVLDNHLDWVLATHLLLHKAGLDGADLAGSSVGGSLAAEVAAIWPSSVRRLALIAPFGLFDDKEPATDPWAQRAPDFPALMCADPARWEALKAVPEGHNDPEWPIEQTRASEAAARIFWPLGNTKIEKRLPLIEAPTLLLWGEEDRIMPRSYADKFARGVSGKTEIKTIAGAGHLAELDQPDAVAQAILAWTAQA

Samples

Sample ID Description Type Environment
1 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
84 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
85 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
88 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
91 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
92 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
160 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 4.8
Rhizosphere 83.2
Stem 0
Stem Tuber 0
Unclassified 7.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373947_0123816 3300035725 Bacteria 1644
2 Ga0070683_100431413 3300005329 Bacteria 1257
3 Ga0070666_10126631 3300005335 Bacteria 1773
4 Ga0070689_100176165 3300005340 Bacteria 1735
5 Ga0070691_10003752 3300005341 Bacteria 6863
6 Ga0070691_10033133 3300005341 Bacteria 2430
7 Ga0070661_100012282 3300005344 Bacteria 5988
8 Ga0070659_100028373 3300005366 Bacteria 4321
9 Ga0070714_100075087 3300005435 Bacteria 2932
10 Ga0070714_100191016 3300005435 Bacteria 1869
11 Ga0070713_100018008 3300005436 Bacteria 5362
12 Ga0070713_100041841 3300005436 Bacteria 3736
13 Ga0070713_100345549 3300005436 Bacteria 1379
14 Ga0070711_100018366 3300005439 Bacteria 4464
15 Ga0070711_100111865 3300005439 Bacteria 2005
16 Ga0070700_100061574 3300005441 Bacteria 2368
17 Ga0070694_100463141 3300005444 Bacteria 1003
18 Ga0070708_100319003 3300005445 Bacteria 1464
19 Ga0070678_100323973 3300005456 Bacteria 1317
20 Ga0070681_10002881 3300005458 Bacteria 15895
21 Ga0070707_100041027 3300005468 Bacteria 4429
22 Ga0070679_100063938 3300005530 Bacteria 3667
23 Ga0070679_100475451 3300005530 Bacteria 1194
24 Ga0070684_100008140 3300005535 Bacteria 8184
25 Ga0070695_100017967 3300005545 Bacteria 4291
26 Ga0070665_100080696 3300005548 Bacteria 3259
27 Ga0070665_100104944 3300005548 Bacteria 2828
28 Ga0070665_100328646 3300005548 Bacteria 1533
29 Ga0070704_100237095 3300005549 Unclassified 1491
30 Ga0068855_100033506 3300005563 Bacteria 6129
31 Ga0068855_100040526 3300005563 Bacteria 5528
32 Ga0068855_100431434 3300005563 Bacteria 1440
33 Ga0070664_100036104 3300005564 Bacteria 4151
34 Ga0068854_100113179 3300005578 Bacteria 2050
35 Ga0068856_100006267 3300005614 Bacteria 11678
36 Ga0068852_100064189 3300005616 Bacteria 3200
37 Ga0068859_100754080 3300005617 Bacteria 1062
38 Ga0068860_100053272 3300005843 Bacteria 3847
39 Ga0068860_100260592 3300005843 Bacteria 1690
40 Ga0081455_10000041 3300005937 Bacteria 134032
41 Ga0081455_10053826 3300005937 Bacteria 3436
42 Ga0081455_10181052 3300005937 Bacteria 1595
43 Ga0081540_1075074 3300005983 Bacteria 1546
44 Ga0070717_10074929 3300006028 Bacteria 2830
45 Ga0075365_10381955 3300006038 Bacteria 994
46 Ga0075428_100036569 3300006844 Bacteria 5408
47 Ga0075431_100010892 3300006847 Bacteria 9147
48 Ga0075431_100227119 3300006847 Bacteria 1903
49 Ga0075431_100441143 3300006847 Bacteria 1299
50 Ga0075433_10009391 3300006852 Bacteria 7815
51 Ga0075434_100029842 3300006871 Bacteria 5367
52 Ga0075429_100008574 3300006880 Bacteria 8895
53 Ga0075436_100057819 3300006914 Bacteria 2678
54 Ga0097620_100753967 3300006931 Bacteria 1062
55 Ga0075435_100191395 3300007076 Bacteria 1731
56 Ga0099795_10088895 3300007788 Bacteria 1194
57 Ga0105240_10059529 3300009093 Bacteria 4766
58 Ga0111539_10200129 3300009094 Bacteria 2329
59 Ga0111539_10389832 3300009094 Bacteria 1622
60 Ga0111539_10398846 3300009094 Bacteria 1602
61 Ga0105245_10046308 3300009098 Bacteria 3886
62 Ga0114129_10181761 3300009147 Unclassified 2861
63 Ga0105243_10379561 3300009148 Bacteria 1307
64 Ga0105243_10648905 3300009148 Unclassified 1023
65 Ga0105241_10110642 3300009174 Bacteria 2198
66 Ga0105242_10093974 3300009176 Bacteria 2529
67 Ga0105248_10179619 3300009177 Bacteria 2385
68 Ga0105239_10368011 3300010375 Bacteria 1624
69 Ga0157371_10038899 3300013102 Bacteria 3402
70 Ga0157369_10030381 3300013105 Bacteria 5959
71 Ga0157369_10147503 3300013105 Bacteria 2487
72 Ga0157375_10031764 3300013308 Bacteria 4998
73 Ga0163163_10465860 3300014325 Bacteria 1324
74 Ga0157376_10151542 3300014969 Bacteria 2091
75 Ga0157376_10816838 3300014969 Bacteria 946
76 Ga0213874_10025272 3300021377 Bacteria 1673
77 Ga0213876_10027150 3300021384 Bacteria 3021
78 Ga0213876_10069655 3300021384 Bacteria 1858
79 Ga0213875_10000091 3300021388 Bacteria 104903
80 Ga0213875_10000882 3300021388 Bacteria 22015
81 Ga0213875_10000968 3300021388 Bacteria 20539
82 Ga0213875_10003873 3300021388 Bacteria 8379
83 Ga0213875_10009302 3300021388 Bacteria 4986
84 Ga0213875_10013811 3300021388 Bacteria 3955
85 Ga0207426_1007226 3300025302 Bacteria 4682
86 Ga0207699_10108479 3300025906 Bacteria 1775
87 Ga0207699_10194492 3300025906 Bacteria 1371
88 Ga0207654_10415074 3300025911 Bacteria 938
89 Ga0207707_10036441 3300025912 Bacteria 4300
90 Ga0207695_10139130 3300025913 Bacteria 2378
91 Ga0207663_10054413 3300025916 Unclassified 2506
92 Ga0207662_10396398 3300025918 Bacteria 935
93 Ga0207652_10085098 3300025921 Bacteria 2771
94 Ga0207652_10309562 3300025921 Bacteria 1426
95 Ga0207646_10280157 3300025922 Bacteria 1507
96 Ga0207700_10032606 3300025928 Bacteria 3718
97 Ga0207700_10266949 3300025928 Bacteria 1467
98 Ga0207664_10108011 3300025929 Bacteria 2310
99 Ga0207664_10125715 3300025929 Bacteria 2152
100 Ga0207644_10315168 3300025931 Bacteria 1264
101 Ga0207690_10187416 3300025932 Bacteria 1562
102 Ga0207661_10439114 3300025944 Bacteria 1187
103 Ga0207667_10053724 3300025949 Bacteria 4238
104 Ga0207667_10278751 3300025949 Bacteria 1708
105 Ga0207667_10586307 3300025949 Bacteria 1125
106 Ga0207708_10387079 3300026075 Unclassified 1154
107 Ga0207702_10025250 3300026078 Bacteria 4930
108 Ga0207702_10062330 3300026078 Bacteria 3184
109 Ga0207702_10280136 3300026078 Bacteria 1576
110 Ga0207674_10093118 3300026116 Bacteria 3003
111 Ga0207674_10757256 3300026116 Bacteria 937
112 Ga0207675_100769963 3300026118 Bacteria 974
113 Ga0207698_10024303 3300026142 Bacteria 4250
114 Ga0268266_10030189 3300028379 Bacteria 4606
115 Ga0268266_10120853 3300028379 Bacteria 2331
116 Ga0268264_10328048 3300028381 Bacteria 1449
117 Ga0268264_10334473 3300028381 Bacteria 1436
118 Ga0265334_10027047 3300028573 Bacteria 2312
119 Ga0265342_10137991 3300031712 Bacteria 1362
120 Ga0373930_0011413 3300034816 Bacteria 1604
121 Ga0373938_0007993 3300034957 Bacteria 1878
122 Ga0373934_0008575 3300035086 Unclassified 3813
123 Ga0373939_0005410 3300035114 Unclassified 3041
124 Ga0373941_0077869 3300035115 Bacteria 1114
125 Ga0373953_0116813 3300035117 Bacteria 1131
126 Ga0373954_0018037 3300035118 Bacteria 3174
127 Ga0373957_0103259 3300035120 Bacteria 1143
128 Ga0373942_0070778 3300035207 Bacteria 1018
129 Ga0373924_0179998 3300035410 Bacteria 930
130 Ga0373931_0025828 3300035691 Bacteria 2984
131 Ga0373935_0020663 3300035692 Bacteria 4025
132 Ga0373935_0109007 3300035692 Bacteria 1836
133 Ga0373935_0321983 3300035692 Bacteria 1097
134 Ga0373927_0020264 3300035695 Bacteria 4361
135 Ga0373927_0091647 3300035695 Bacteria 1974
136 Ga0373933_0203856 3300035724 Bacteria 1266
137 Ga0373933_0334576 3300035724 Unclassified 982
138 Ga0373947_0020510 3300035725 Bacteria 3816
139 Ga0373937_0022533 3300036401 Bacteria 5664
140 Ga0373937_0033807 3300036401 Bacteria 4647
141 Ga0373937_0041410 3300036401 Bacteria 4201
142 Ga0373937_0049646 3300036401 Bacteria 3842
143 Ga0373937_0149526 3300036401 Bacteria 2187
144 Ga0373937_0442131 3300036401 Unclassified 1234
145 Ga0373925_0189388 3300037068 Bacteria 1632
146 Ga0395900_0022139 3300037418 Bacteria 6501
147 Ga0395900_0034833 3300037418 Bacteria 5186
148 Ga0395898_0036006 3300037466 Bacteria 4918
149 Ga0436364_0128168 3300037853 Bacteria 71580
150 Ga0436364_0256383 3300037853 Bacteria 83938
151 Ga0436364_0321868 3300037853 Bacteria 3173
152 Ga0436364_0469598 3300037853 Bacteria 25895
153 Ga0436364_0542842 3300037853 Bacteria 26703
154 Ga0436364_0602614 3300037853 Bacteria 1513
155 Ga0436364_0695470 3300037853 Bacteria 1724
156 Ga0436364_0747384 3300037853 Unclassified 1406
157 Ga0436364_1042367 3300037853 Bacteria 8157
158 Ga0436364_1372039 3300037853 Bacteria 3573
159 Ga0395901_0001419 3300038443 Bacteria 24996
160 Ga0395901_0047949 3300038443 Bacteria 4435
161 Ga0436365_0091301 3300039437 Bacteria 2125
162 Ga0436365_0924262 3300039437 Bacteria 2335
163 Ga0436365_1140021 3300039437 Bacteria 3462
164 Ga0436365_1588513 3300039437 Bacteria 1388
165 Ga0436365_1777588 3300039437 Bacteria 1441
166 Ga0436360_0109128 3300039438 Bacteria 9292
167 Ga0436360_0335065 3300039438 Bacteria 4628
168 Ga0436360_1084422 3300039438 Bacteria 896
169 Ga0436361_0894365 3300039447 Bacteria 1002
170 Ga0436363_0139606 3300039450 Bacteria 4574
171 Ga0436363_1606372 3300039450 Bacteria 1124
172 Ga0436362_0061391 3300039453 Bacteria 1014
173 Ga0436362_0578887 3300039453 Bacteria 2145
174 Ga0436362_0991490 3300039453 Unclassified 1912
175 Ga0466963_0011430 3300044694 Bacteria 5407
176 Ga0466963_0278157 3300044694 Bacteria 1176
177 Ga0466957_0271060 3300044842 Bacteria 1133
178 Ga0495592_0012641 3300046454 Bacteria 6417
179 Ga0495592_0014226 3300046454 Bacteria 6045
180 Ga0495629_0133509 3300046459 Bacteria 1729
181 Ga0495651_0139340 3300046462 Bacteria 1761
182 Ga0495580_0435622 3300046472 Bacteria 881
183 Ga0495584_0108868 3300046491 Bacteria 1401
184 Ga0495594_0066627 3300046499 Bacteria 1998
185 Ga0495628_0207673 3300046516 Bacteria 1474
186 Ga0495628_0359539 3300046516 Bacteria 1069
187 Ga0495637_0103859 3300046520 Bacteria 1108
188 Ga0495652_0037972 3300046529 Bacteria 4175
189 Ga0495652_0351045 3300046529 Bacteria 1057
190 Ga0495640_0026456 3300046533 Bacteria 4193
191 Ga0495640_0330385 3300046533 Bacteria 943
192 Ga0495586_0049332 3300046535 Bacteria 2276
193 Ga0495586_0118301 3300046535 Bacteria 1479
194 Ga0495645_0003461 3300046543 Bacteria 10707
195 Ga0495645_0256797 3300046543 Unclassified 1159
196 Ga0495667_0047603 3300046559 Bacteria 2832
197 Ga0495635_0027104 3300046663 Bacteria 3987
198 Ga0495635_0060520 3300046663 Bacteria 2602
199 Ga0495657_0050031 3300046675 Bacteria 2812
200 Ga0495599_0028655 3300046678 Bacteria 3489
201 Ga0495599_0228217 3300046678 Unclassified 1137
202 Ga0495613_0168836 3300046689 Unclassified 1554
203 Ga0495600_0101731 3300046809 Unclassified 1873
204 Ga0495600_0123528 3300046809 Bacteria 1683
205 Ga0495680_0081063 3300047322 Bacteria 2451
206 Ga0495675_0016977 3300047444 Bacteria 4607
207 Ga0495675_0160412 3300047444 Unclassified 1385
208 Ga0495684_0015267 3300047471 Bacteria 5916
209 Ga0495684_0347230 3300047471 Unclassified 1054
210 Ga0495602_0002687 3300048088 Bacteria 18177
211 Ga0495602_0113949 3300048088 Bacteria 2190
212 Ga0496101_0037267 3300048904 Bacteria 3449
213 Ga0496103_0151872 3300048906 Bacteria 1484
214 Ga0496104_0005700 3300048907 Bacteria 10902
215 Ga0496105_0030908 3300048908 Bacteria 4390
216 Ga0496106_0027037 3300048909 Bacteria 4272
217 Ga0496106_0116129 3300048909 Bacteria 2088
218 Ga0496108_0228222 3300048911 Bacteria 1619
219 Ga0496109_0105349 3300048912 Bacteria 2619
220 Ga0496109_0429256 3300048912 Bacteria 1248
221 Ga0496110_0014959 3300048913 Bacteria 6451
222 Ga0496112_0067763 3300048915 Bacteria 3523
223 Ga0496115_0004038 3300048918 Bacteria 10594
224 Ga0496119_0025848 3300048922 Bacteria 4089
225 Ga0501033_0510488 3300049570 Bacteria 831
226 Ga0501034_0004514 3300049571 Bacteria 15475
227 Ga0501034_0007135 3300049571 Bacteria 11921
228 Ga0501040_0654014 3300049576 Bacteria 760
229 Ga0501043_0438220 3300049579 Bacteria 983
230 Ga0501047_0219907 3300049581 Bacteria 1756
231 Ga0501047_0392603 3300049581 Bacteria 1221
232 Ga0501068_0002416 3300049584 Bacteria 9913
233 Ga0501080_0440964 3300049742 Bacteria 1168
234 Ga0501035_0458638 3300049822 Bacteria 1054
235 nmdc:mga05p37_74166_c1 3300050507 Bacteria 4188
236 nmdc:mga09592_3754_c1 3300050508 Bacteria 12237
237 nmdc:mga06r32_3943_c1 3300050510 Bacteria 13304
238 nmdc:mga08y16_89827_c1 3300050511 Unclassified 3202
239 nmdc:mga0n895_1247_c1 3300050512 Bacteria 18773
240 nmdc:mga0rr50_33705_c1 3300050513 Bacteria 3660
241 nmdc:mga0a205_4846_c1 3300050515 Bacteria 12099
242 nmdc:mga0a205_91909_c1 3300050515 Bacteria 2932
243 Ga0495601_0002502 3300053077 Bacteria 10459
244 Ga0495601_0005858 3300053077 Bacteria 7164
245 Ga0495612_0001948 3300053078 Bacteria 8502
246 Ga0495595_0042913 3300053084 Bacteria 2073
247 Ga0495619_0035827 3300053085 Bacteria 3229
248 Ga0495619_0060749 3300053085 Bacteria 2513
249 Ga0495619_0129271 3300053085 Unclassified 1735
250 Ga0500595_030724 3300053119 Bacteria 1807
251 Ga0373947_0123816
252 Ga0070683_100431413
253 Ga0070666_10126631
254 Ga0070689_100176165
255 Ga0070691_10003752
256 Ga0070691_10033133
257 Ga0070661_100012282
258 Ga0070659_100028373
259 Ga0070714_100075087
260 Ga0070714_100191016
261 Ga0070713_100018008
262 Ga0070713_100041841
263 Ga0070713_100345549
264 Ga0070711_100018366
265 Ga0070711_100111865
266 Ga0070700_100061574
267 Ga0070694_100463141
268 Ga0070708_100319003
269 Ga0070678_100323973
270 Ga0070681_10002881
271 Ga0070707_100041027
272 Ga0070679_100063938
273 Ga0070679_100475451
274 Ga0070684_100008140
275 Ga0070695_100017967
276 Ga0070665_100080696
277 Ga0070665_100104944
278 Ga0070665_100328646
279 Ga0070704_100237095
280 Ga0068855_100033506
281 Ga0068855_100040526
282 Ga0068855_100431434
283 Ga0070664_100036104
284 Ga0068854_100113179
285 Ga0068856_100006267
286 Ga0068852_100064189
287 Ga0068859_100754080
288 Ga0068860_100053272
289 Ga0068860_100260592
290 Ga0081455_10000041
291 Ga0081455_10053826
292 Ga0081455_10181052
293 Ga0081540_1075074
294 Ga0070717_10074929
295 Ga0075365_10381955
296 Ga0075428_100036569
297 Ga0075431_100010892
298 Ga0075431_100227119
299 Ga0075431_100441143
300 Ga0075433_10009391
301 Ga0075434_100029842
302 Ga0075429_100008574
303 Ga0075436_100057819
304 Ga0097620_100753967
305 Ga0075435_100191395
306 Ga0099795_10088895
307 Ga0105240_10059529
308 Ga0111539_10200129
309 Ga0111539_10389832
310 Ga0111539_10398846
311 Ga0105245_10046308
312 Ga0114129_10181761
313 Ga0105243_10379561
314 Ga0105243_10648905
315 Ga0105241_10110642
316 Ga0105242_10093974
317 Ga0105248_10179619
318 Ga0105239_10368011
319 Ga0157371_10038899
320 Ga0157369_10030381
321 Ga0157369_10147503
322 Ga0157375_10031764
323 Ga0163163_10465860
324 Ga0157376_10151542
325 Ga0157376_10816838
326 Ga0213874_10025272
327 Ga0213876_10027150
328 Ga0213876_10069655
329 Ga0213875_10000091
330 Ga0213875_10000882
331 Ga0213875_10000968
332 Ga0213875_10003873
333 Ga0213875_10009302
334 Ga0213875_10013811
335 Ga0207426_1007226
336 Ga0207699_10108479
337 Ga0207699_10194492
338 Ga0207654_10415074
339 Ga0207707_10036441
340 Ga0207695_10139130
341 Ga0207663_10054413
342 Ga0207662_10396398
343 Ga0207652_10085098
344 Ga0207652_10309562
345 Ga0207646_10280157
346 Ga0207700_10032606
347 Ga0207700_10266949
348 Ga0207664_10108011
349 Ga0207664_10125715
350 Ga0207644_10315168
351 Ga0207690_10187416
352 Ga0207661_10439114
353 Ga0207667_10053724
354 Ga0207667_10278751
355 Ga0207667_10586307
356 Ga0207708_10387079
357 Ga0207702_10025250
358 Ga0207702_10062330
359 Ga0207702_10280136
360 Ga0207674_10093118
361 Ga0207674_10757256
362 Ga0207675_100769963
363 Ga0207698_10024303
364 Ga0268266_10030189
365 Ga0268266_10120853
366 Ga0268264_10328048
367 Ga0268264_10334473
368 Ga0265334_10027047
369 Ga0265342_10137991
370 Ga0373930_0011413
371 Ga0373938_0007993
372 Ga0373934_0008575
373 Ga0373939_0005410
374 Ga0373941_0077869
375 Ga0373953_0116813
376 Ga0373954_0018037
377 Ga0373957_0103259
378 Ga0373942_0070778
379 Ga0373924_0179998
380 Ga0373931_0025828
381 Ga0373935_0020663
382 Ga0373935_0109007
383 Ga0373935_0321983
384 Ga0373927_0020264
385 Ga0373927_0091647
386 Ga0373933_0203856
387 Ga0373933_0334576
388 Ga0373947_0020510
389 Ga0373937_0022533
390 Ga0373937_0033807
391 Ga0373937_0041410
392 Ga0373937_0049646
393 Ga0373937_0149526
394 Ga0373937_0442131
395 Ga0373925_0189388
396 Ga0395900_0022139
397 Ga0395900_0034833
398 Ga0395898_0036006
399 Ga0436364_0128168
400 Ga0436364_0256383
401 Ga0436364_0321868
402 Ga0436364_0469598
403 Ga0436364_0542842
404 Ga0436364_0602614
405 Ga0436364_0695470
406 Ga0436364_0747384
407 Ga0436364_1042367
408 Ga0436364_1372039
409 Ga0395901_0001419
410 Ga0395901_0047949
411 Ga0436365_0091301
412 Ga0436365_0924262
413 Ga0436365_1140021
414 Ga0436365_1588513
415 Ga0436365_1777588
416 Ga0436360_0109128
417 Ga0436360_0335065
418 Ga0436360_1084422
419 Ga0436361_0894365
420 Ga0436363_0139606
421 Ga0436363_1606372
422 Ga0436362_0061391
423 Ga0436362_0578887
424 Ga0436362_0991490
425 Ga0466963_0011430
426 Ga0466963_0278157
427 Ga0466957_0271060
428 Ga0495592_0012641
429 Ga0495592_0014226
430 Ga0495629_0133509
431 Ga0495651_0139340
432 Ga0495580_0435622
433 Ga0495584_0108868
434 Ga0495594_0066627
435 Ga0495628_0207673
436 Ga0495628_0359539
437 Ga0495637_0103859
438 Ga0495652_0037972
439 Ga0495652_0351045
440 Ga0495640_0026456
441 Ga0495640_0330385
442 Ga0495586_0049332
443 Ga0495586_0118301
444 Ga0495645_0003461
445 Ga0495645_0256797
446 Ga0495667_0047603
447 Ga0495635_0027104
448 Ga0495635_0060520
449 Ga0495657_0050031
450 Ga0495599_0028655
451 Ga0495599_0228217
452 Ga0495613_0168836
453 Ga0495600_0101731
454 Ga0495600_0123528
455 Ga0495680_0081063
456 Ga0495675_0016977
457 Ga0495675_0160412
458 Ga0495684_0015267
459 Ga0495684_0347230
460 Ga0495602_0002687
461 Ga0495602_0113949
462 Ga0496101_0037267
463 Ga0496103_0151872
464 Ga0496104_0005700
465 Ga0496105_0030908
466 Ga0496106_0027037
467 Ga0496106_0116129
468 Ga0496108_0228222
469 Ga0496109_0105349
470 Ga0496109_0429256
471 Ga0496110_0014959
472 Ga0496112_0067763
473 Ga0496115_0004038
474 Ga0496119_0025848
475 Ga0501033_0510488
476 Ga0501034_0004514
477 Ga0501034_0007135
478 Ga0501040_0654014
479 Ga0501043_0438220
480 Ga0501047_0219907
481 Ga0501047_0392603
482 Ga0501068_0002416
483 Ga0501080_0440964
484 Ga0501035_0458638
485 nmdc:mga05p37_74166_c1
486 nmdc:mga09592_3754_c1
487 nmdc:mga06r32_3943_c1
488 nmdc:mga08y16_89827_c1
489 nmdc:mga0n895_1247_c1
490 nmdc:mga0rr50_33705_c1
491 nmdc:mga0a205_4846_c1
492 nmdc:mga0a205_91909_c1
493 Ga0495601_0002502
494 Ga0495601_0005858
495 Ga0495612_0001948
496 Ga0495595_0042913
497 Ga0495619_0035827
498 Ga0495619_0060749
499 Ga0495619_0129271
500 Ga0500595_030724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

33

253

0.84

PF12146

Hydrolase_4

Serine aminopeptidase, S33

90

253

0.79

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

16

259

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.8073 3 259
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.7864 5 120
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.7857 3 259
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.7855 4 120
2d0d-assembly1.cif.gz_A-2 crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant 0.7826 7 259
ID Description Score Start End Superfamily
af_A4HVP2_208_397_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8517 201 260 3.40.50.1820
1j1iA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7784 3 259 3.40.50.1820
af_Q54CU1_1_267_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7743 18 125 3.40.50.1820
3bdiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7737 2 259 3.40.50.1820
af_E9QD39_49_328_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7714 5 259 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A6A7MBC6-F1-model_v4 Alpha/beta fold hydrolase 0.9825 1 260 GO:0016020
GO:0016787
AF-A0A6A7MBC6-F1-model_v4 Alpha/beta fold hydrolase 0.9788 1 260 GO:0016020
GO:0016787
AF-A0A383BR82-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9462 117 260
AF-A0A383BR82-F1-model_v4 AB hydrolase-1 domain-containing protein 0.94 117 260
AF-A0A2E6DQ76-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9378 1 260

Map