F361346

General Info

Members Datasets Scaffolds Average Seq Length
250 195 249 185

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100605626|Ga0070661_1006056262
Length 208
Sequence MKLIPTSLRDVVIVEPAVFGDERGWFMESYNDRRFNAALQERGLPPARPFVQDNHSCSARGVLRGLHYQLPPHPQGKLVRVAKGSAFDVAVDIRRGSPTFGHWVGVELTAQNHRQLWIPEGFAHGFVALEDDTHFLYKTTDFYAKDCEGAIRWDDPQIGIEWPGVGGMAPLVAPKDAAAGTLAEALAAGRVFDAGATLKATPGRPKLP

Samples

Sample ID Description Type Environment
1 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
85 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
104 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
105 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
106 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
107 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
114 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
115 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
116 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
117 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
118 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
119 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
122 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
123 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
124 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
127 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
128 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
129 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
130 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
131 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
132 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
133 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
134 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
177 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
187 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
188 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
191 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
192 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0.8
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.4
Nodule 0
Rhizoplane 4.8
Rhizosphere 78.8
Stem 0
Stem Tuber 0
Unclassified 12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1009314 3300002705 Bacteria 2398
2 rootL2_10063119 3300003322 Bacteria 10161
3 rootL2_10132796 3300003322 Bacteria 1032
4 rootH1_10051792 3300003323 Bacteria 3503
5 rootH1_10087560 3300003323 Bacteria 1299
6 Ga0065712_10159979 3300005290 Bacteria 1309
7 Ga0065707_10082876 3300005295 Bacteria 11628
8 Ga0070677_10061547 3300005333 Bacteria 1550
9 Ga0070660_100669637 3300005339 Unclassified 869
10 Ga0070660_100904617 3300005339 Bacteria 744
11 Ga0070689_100002060 3300005340 Bacteria 13046
12 Ga0070661_100605626 3300005344 Bacteria 886
13 Ga0070675_100577249 3300005354 Bacteria 1018
14 Ga0070671_100140962 3300005355 Bacteria 2034
15 Ga0070671_100305011 3300005355 Bacteria 1356
16 Ga0070673_100823885 3300005364 Bacteria 858
17 Ga0070667_100130293 3300005367 Bacteria 2194
18 Ga0070708_100755865 3300005445 Bacteria 914
19 Ga0070678_100063705 3300005456 Bacteria 2729
20 Ga0070662_100054100 3300005457 Bacteria 2908
21 Ga0070681_10693377 3300005458 Bacteria 934
22 Ga0068867_100341221 3300005459 Bacteria 1247
23 Ga0070679_100292224 3300005530 Bacteria 1581
24 Ga0070686_100172657 3300005544 Bacteria 1530
25 Ga0070665_100167824 3300005548 Bacteria 2197
26 Ga0070664_100601128 3300005564 Bacteria 1020
27 Ga0070664_101521484 3300005564 Bacteria 633
28 Ga0068852_101059859 3300005616 Unclassified 830
29 Ga0068864_100139590 3300005618 Bacteria 2185
30 Ga0068863_100223605 3300005841 Bacteria 1814
31 Ga0068858_100787539 3300005842 Bacteria 927
32 Ga0068858_101344283 3300005842 Bacteria 703
33 Ga0068860_100472010 3300005843 Bacteria 1250
34 Ga0075365_10002557 3300006038 Bacteria 8979
35 Ga0097621_100074680 3300006237 Bacteria 2808
36 Ga0097621_100802633 3300006237 Bacteria 872
37 Ga0068871_100653701 3300006358 Bacteria 960
38 Ga0075428_100005257 3300006844 Bacteria 14392
39 Ga0075431_100000026 3300006847 Bacteria 75269
40 Ga0075434_101084752 3300006871 Bacteria 814
41 Ga0075429_100011857 3300006880 Bacteria 7558
42 Ga0105244_10007915 3300009036 Bacteria 6699
43 Ga0105250_10000032 3300009092 Bacteria 159642
44 Ga0105240_10035076 3300009093 Bacteria 6469
45 Ga0105240_10044246 3300009093 Bacteria 5660
46 Ga0105240_10238173 3300009093 Bacteria 2111
47 Ga0111539_10010596 3300009094 Bacteria 11608
48 Ga0105245_10017141 3300009098 Bacteria 6320
49 Ga0114129_10035870 3300009147 Bacteria 7003
50 Ga0114129_10758835 3300009147 Bacteria 1241
51 Ga0105242_10008561 3300009176 Bacteria 7856
52 Ga0105248_10008012 3300009177 Bacteria 11606
53 Ga0105248_11321206 3300009177 Bacteria 816
54 Ga0105237_10050509 3300009545 Bacteria 4179
55 Ga0105238_10041904 3300009551 Bacteria 4637
56 Ga0105239_10318472 3300010375 Bacteria 1753
57 Ga0157369_10020413 3300013105 Bacteria 7404
58 Ga0157374_10052605 3300013296 Bacteria 3794
59 Ga0157378_10094733 3300013297 Bacteria 2719
60 Ga0163162_11180270 3300013306 Unclassified 868
61 Ga0163162_12531272 3300013306 Bacteria 590
62 Ga0157372_10950152 3300013307 Bacteria 996
63 Ga0157375_11324299 3300013308 Unclassified 847
64 Ga0163163_10177291 3300014325 Bacteria 2178
65 Ga0157380_10323423 3300014326 Bacteria 1431
66 Ga0157379_10000004 3300014968 Bacteria 173351
67 Ga0213876_10029110 3300021384 Bacteria 2912
68 Ga0209759_1010559 3300025256 Bacteria 2698
69 Ga0209673_1006960 3300025273 Bacteria 5338
70 Ga0207696_1000198 3300025711 Bacteria 92750
71 Ga0207655_1008135 3300025728 Bacteria 6707
72 Ga0207707_10744131 3300025912 Bacteria 820
73 Ga0207695_10357899 3300025913 Bacteria 1346
74 Ga0207695_10539155 3300025913 Bacteria 1048
75 Ga0207671_10006366 3300025914 Bacteria 10529
76 Ga0207660_10173601 3300025917 Bacteria 1670
77 Ga0207652_10294543 3300025921 Bacteria 1464
78 Ga0207694_10565985 3300025924 Bacteria 955
79 Ga0207659_10139785 3300025926 Bacteria 1879
80 Ga0207644_10035499 3300025931 Bacteria 3494
81 Ga0207644_10073533 3300025931 Bacteria 2507
82 Ga0207706_10007872 3300025933 Bacteria 9835
83 Ga0207686_10296943 3300025934 Bacteria 1198
84 Ga0207704_10814776 3300025938 Unclassified 780
85 Ga0207711_10014090 3300025941 Bacteria 6643
86 Ga0207711_10821791 3300025941 Bacteria 865
87 Ga0207679_10556678 3300025945 Bacteria 1029
88 Ga0207658_10310694 3300025986 Bacteria 1361
89 Ga0207677_10121510 3300026023 Bacteria 1965
90 Ga0207703_10361196 3300026035 Bacteria 1339
91 Ga0207703_11067382 3300026035 Bacteria 775
92 Ga0207641_10344705 3300026088 Bacteria 1418
93 Ga0207676_10149793 3300026095 Bacteria 2008
94 Ga0207683_10176640 3300026121 Bacteria 1936
95 Ga0207683_11201005 3300026121 Bacteria 703
96 Ga0207428_10006633 3300027907 Bacteria 10640
97 Ga0265334_10010337 3300028573 Bacteria 3942
98 Ga0307515_10000011 3300028794 Bacteria 633903
99 Ga0265338_10019812 3300028800 Bacteria 7110
100 Ga0265338_10028372 3300028800 Bacteria 5583
101 Ga0307511_10048354 3300030521 Bacteria 3462
102 Ga0265330_10006689 3300031235 Bacteria 5686
103 Ga0265320_10324425 3300031240 Bacteria 681
104 Ga0265325_10000866 3300031241 Bacteria 21795
105 Ga0265329_10010931 3300031242 Bacteria 3318
106 Ga0265340_10357674 3300031247 Bacteria 645
107 Ga0265339_10008694 3300031249 Bacteria 6443
108 Ga0265331_10016697 3300031250 Bacteria 3847
109 Ga0265313_10000441 3300031595 Bacteria 44042
110 Ga0265313_10022470 3300031595 Bacteria 3420
111 Ga0265314_10118234 3300031711 Bacteria 1673
112 Ga0265342_10012376 3300031712 Bacteria 5783
113 Ga0316576_11024603 3300031727 Bacteria 587
114 Ga0307405_10150418 3300031731 Bacteria 1636
115 Ga0307405_10616242 3300031731 Bacteria 888
116 Ga0316577_10088325 3300031733 Unclassified 1735
117 Ga0307410_10302151 3300031852 Bacteria 1263
118 Ga0307412_10545508 3300031911 Bacteria 973
119 Ga0307412_10981536 3300031911 Bacteria 745
120 Ga0307409_100610879 3300031995 Bacteria 1079
121 Ga0307416_100447595 3300032002 Bacteria 1343
122 Ga0307416_100846018 3300032002 Bacteria 1013
123 Ga0316596_1017149 3300033541 Bacteria 1819
124 Ga0373932_0052126 3300035112 Bacteria 1217
125 Ga0373939_0000219 3300035114 Bacteria 15660
126 Ga0373960_0004077 3300035121 Bacteria 3338
127 Ga0373962_0024580 3300035242 Bacteria 1612
128 Ga0316574_0598238 3300035398 Bacteria 682
129 Ga0373931_0000827 3300035691 Bacteria 12984
130 Ga0373927_0110387 3300035695 Bacteria 1792
131 Ga0316584_0195319 3300036712 Bacteria 1495
132 Ga0316584_0291827 3300036712 Bacteria 1183
133 Ga0395898_0001226 3300037466 Bacteria 38522
134 Ga0395898_0004063 3300037466 Bacteria 16073
135 Ga0395898_0026035 3300037466 Bacteria 5890
136 Ga0395898_0544843 3300037466 Bacteria 1102
137 Ga0395901_0165476 3300038443 Bacteria 2322
138 Ga0395901_0414679 3300038443 Bacteria 1382
139 Ga0400490_49683 3300038726 Bacteria 41099
140 Ga0400490_50693 3300038726 Bacteria 47921
141 Ga0400491_02776 3300038727 Bacteria 10180
142 Ga0400491_05283 3300038727 Unclassified 2217
143 Ga0400485_22198 3300038735 Unclassified 1559
144 Ga0400488_39530 3300038741 Bacteria 1232
145 Ga0400488_57088 3300038741 Bacteria 2536
146 Ga0400486_14578 3300038742 Bacteria 10776
147 Ga0400483_004432 3300039062 Bacteria 6682
148 Ga0400483_080037 3300039062 Bacteria 4135
149 Ga0400483_104977 3300039062 Bacteria 14907
150 Ga0400483_107450 3300039062 Bacteria 1042
151 Ga0400483_206539 3300039062 Bacteria 9124
152 Ga0400487_04053 3300039110 Bacteria 1660
153 Ga0400487_34970 3300039110 Bacteria 222491
154 Ga0436365_1395598 3300039437 Bacteria 6649
155 Ga0439461_0009399 3300041410 Bacteria 1773
156 Ga0451833_0649033 3300041491 Unclassified 991
157 Ga0451835_0789812 3300041492 Bacteria 1067
158 Ga0451855_1330784 3300041511 Unclassified 705
159 Ga0451853_3887589 3300041512 Bacteria 2553
160 Ga0439431_0001739 3300041997 Bacteria 4799
161 Ga0439448_0126687 3300042005 Bacteria 878
162 Ga0439454_022346 3300042011 Bacteria 942
163 Ga0439455_0074923 3300042012 Bacteria 913
164 Ga0450912_013050 3300042116 Bacteria 739
165 Ga0450898_077028 3300042134 Bacteria 674
166 Ga0439446_0038170 3300042156 Bacteria 1408
167 Ga0439458_0020083 3300042157 Bacteria 1542
168 Ga0439434_0022630 3300042435 Bacteria 1889
169 Ga0451577_0011170 3300042876 Bacteria 8518
170 Ga0451577_0263418 3300042876 Bacteria 1561
171 Ga0451577_0275075 3300042876 Bacteria 1525
172 Ga0466969_0000093 3300044656 Bacteria 46242
173 Ga0466969_0026637 3300044656 Bacteria 2963
174 Ga0466972_0000433 3300044658 Bacteria 21713
175 Ga0466966_0037967 3300044684 Bacteria 3104
176 Ga0466966_0073078 3300044684 Bacteria 2146
177 Ga0466966_0092113 3300044684 Bacteria 1881
178 Ga0466961_0029750 3300044693 Bacteria 3509
179 Ga0466961_0054294 3300044693 Bacteria 2555
180 Ga0466961_0249984 3300044693 Bacteria 1089
181 Ga0466963_0079641 3300044694 Bacteria 2216
182 Ga0466964_0015364 3300044706 Bacteria 2912
183 Ga0466964_0145733 3300044706 Bacteria 1093
184 Ga0453684_0147945 3300044712 Bacteria 2795
185 Ga0453684_0178451 3300044712 Unclassified 2495
186 Ga0466968_0041959 3300044735 Bacteria 1933
187 Ga0466970_0205808 3300044765 Bacteria 1095
188 Ga0466959_0000027 3300045049 Bacteria 114262
189 Ga0466959_0073924 3300045049 Bacteria 2465
190 Ga0451576_0048122 3300045051 Bacteria 4481
191 Ga0451576_0346044 3300045051 Bacteria 1556
192 Ga0451576_0515970 3300045051 Bacteria 1255
193 Ga0466958_0025546 3300045836 Bacteria 3483
194 Ga0466967_0057250 3300045976 Bacteria 3440
195 Ga0495591_008118 3300046458 Bacteria 4339
196 Ga0495607_0150383 3300046501 Bacteria 1192
197 Ga0495583_0000173 3300046506 Bacteria 109405
198 Ga0495606_0008230 3300046507 Bacteria 9108
199 Ga0495606_0016805 3300046507 Bacteria 5560
200 Ga0495632_0028924 3300046519 Bacteria 2890
201 Ga0495637_0000801 3300046520 Bacteria 20905
202 Ga0495637_0000929 3300046520 Bacteria 18749
203 Ga0495666_0000223 3300046526 Bacteria 24132
204 Ga0495597_0006033 3300046542 Bacteria 6314
205 Ga0495668_0057933 3300046616 Bacteria 2138
206 Ga0495625_0009443 3300046660 Bacteria 8161
207 Ga0495657_0318193 3300046675 Bacteria 925
208 Ga0495649_0000136 3300046694 Bacteria 64021
209 Ga0495649_0001320 3300046694 Bacteria 18917
210 Ga0495589_0002209 3300046794 Bacteria 10952
211 Ga0495660_0001190 3300046810 Bacteria 18276
212 Ga0495604_0033586 3300047317 Bacteria 4061
213 Ga0495680_0002585 3300047322 Bacteria 18426
214 Ga0495680_0791222 3300047322 Bacteria 620
215 Ga0495679_001851 3300047446 Bacteria 11436
216 Ga0495681_0000304 3300047470 Bacteria 39427
217 Ga0495684_0014354 3300047471 Bacteria 6095
218 Ga0496101_0570497 3300048904 Bacteria 895
219 Ga0496104_0170143 3300048907 Bacteria 2089
220 Ga0496105_0052949 3300048908 Bacteria 3352
221 Ga0496105_0065503 3300048908 Bacteria 2999
222 Ga0496108_0119725 3300048911 Bacteria 2257
223 Ga0496108_0319228 3300048911 Bacteria 1354
224 Ga0496109_0110549 3300048912 Bacteria 2555
225 Ga0496109_0448029 3300048912 Bacteria 1219
226 Ga0496110_0119376 3300048913 Bacteria 2375
227 Ga0496110_0625956 3300048913 Bacteria 975
228 Ga0496112_0006393 3300048915 Bacteria 10342
229 Ga0496113_0079999 3300048916 Bacteria 2502
230 Ga0495678_009803 3300049459 Bacteria 4704
231 Ga0501312_072097 3300049528 Bacteria 614
232 Ga0501046_0383802 3300049580 Bacteria 1016
233 nmdc:mga05p37_3119_c1 3300050507 Bacteria 19270
234 nmdc:mga09592_1540_c1 3300050508 Bacteria 18541
235 nmdc:mga0qj67_228202_c1 3300050509 Bacteria 1511
236 nmdc:mga06r32_354_c1 3300050510 Bacteria 38365
237 nmdc:mga08y16_2466_c1 3300050511 Bacteria 18996
238 nmdc:mga0n895_835911_c1 3300050512 Bacteria 909
239 nmdc:mga0a205_814154_c1 3300050515 Bacteria 782
240 Ga0500578_0121059 3300053086 Bacteria 1645
241 Ga0500646_0042865 3300053090 Bacteria 1280
242 Ga0500608_058988 3300053122 Bacteria 1837
243 Ga0500568_0034053 3300053139 Bacteria 2086
244 Ga0500588_0099316 3300053146 Bacteria 1001
245 Ga0500589_064873 3300053147 Bacteria 1666
246 Ga0500590_002480 3300053148 Bacteria 8208
247 Ga0500616_0017070 3300053153 Bacteria 4121
248 Ga0500661_002687 3300055283 Bacteria 3363
249 Ga0466962_0161246 3300061719 Bacteria 1090

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038727 Ga0400491_05283 Ga0400491_05283_65_559 150
2 3300042012 Ga0439455_0074923 Ga0439455_0074923_12_542 168
3 3300049528 Ga0501312_072097 Ga0501312_072097_24_554 168
4 3300044656 Ga0466969_0026637 Ga0466969_0026637_23_568 169
5 3300045051 Ga0451576_0515970 Ga0451576_0515970_16_534 170
6 3300021384 Ga0213876_10029110 Ga0213876_100291103 175
7 3300039062 Ga0400483_107450 Ga0400483_107450_204_761 175
8 3300039437 Ga0436365_1395598 Ga0436365_1395598_4950_5516 175
9 iso_pu_bacteria 2916699645 2916700831 175
10 3300005458 Ga0070681_10693377 Ga0070681_106933771 176
11 3300025273 Ga0209673_1006960 Ga0209673_10069602 176
12 3300025912 Ga0207707_10744131 Ga0207707_107441312 176
13 3300031727 Ga0316576_11024603 Ga0316576_110246031 176
14 3300033541 Ga0316596_1017149 Ga0316596_10171492 176
15 3300035398 Ga0316574_0598238 Ga0316574_0598238_92_658 176
16 3300036712 Ga0316584_0195319 Ga0316584_0195319_453_1013 176
17 3300036712 Ga0316584_0291827 Ga0316584_0291827_568_1125 176
18 3300038726 Ga0400490_49683 Ga0400490_49683_38166_38738 176
19 3300038726 Ga0400490_50693 Ga0400490_50693_20401_20973 176
20 3300038727 Ga0400491_02776 Ga0400491_02776_195_767 176
21 3300038735 Ga0400485_22198 Ga0400485_22198_219_797 176
22 3300038741 Ga0400488_39530 Ga0400488_39530_314_886 176
23 3300038741 Ga0400488_57088 Ga0400488_57088_898_1470 176
24 3300038742 Ga0400486_14578 Ga0400486_14578_3315_3893 176
25 3300039062 Ga0400483_004432 Ga0400483_004432_4829_5401 176
26 3300039062 Ga0400483_080037 Ga0400483_080037_3563_4123 176
27 3300039062 Ga0400483_104977 Ga0400483_104977_8349_8921 176
28 3300039062 Ga0400483_206539 Ga0400483_206539_6772_7332 176
29 3300039110 Ga0400487_04053 Ga0400487_04053_112_684 176
30 3300039110 Ga0400487_34970 Ga0400487_34970_192681_193253 176
31 3300005290 Ga0065712_10159979 Ga0065712_101599792 177
32 3300005364 Ga0070673_100823885 Ga0070673_1008238851 177
33 3300005564 Ga0070664_101521484 Ga0070664_1015214841 177
34 3300006038 Ga0075365_10002557 Ga0075365_100025577 177
35 3300006237 Ga0097621_100802633 Ga0097621_1008026331 177
36 3300006358 Ga0068871_100653701 Ga0068871_1006537012 177
37 3300009176 Ga0105242_10008561 Ga0105242_100085615 177
38 3300013297 Ga0157378_10094733 Ga0157378_100947333 177
39 3300025926 Ga0207659_10139785 Ga0207659_101397852 177
40 3300025934 Ga0207686_10296943 Ga0207686_102969432 177
41 3300026121 Ga0207683_11201005 Ga0207683_112010052 177
42 3300028573 Ga0265334_10010337 Ga0265334_100103372 177
43 3300028800 Ga0265338_10019812 Ga0265338_100198123 177
44 3300031240 Ga0265320_10324425 Ga0265320_103244251 177
45 3300031595 Ga0265313_10022470 Ga0265313_100224702 177
46 3300031733 Ga0316577_10088325 Ga0316577_100883252 177
47 3300053146 Ga0500588_0099316 Ga0500588_0099316_309_854 177
48 3300005295 Ga0065707_10082876 Ga0065707_100828767 178
49 3300005333 Ga0070677_10061547 Ga0070677_100615472 178
50 3300005339 Ga0070660_100669637 Ga0070660_1006696372 178
51 3300005340 Ga0070689_100002060 Ga0070689_10000206011 178
52 3300005354 Ga0070675_100577249 Ga0070675_1005772492 178
53 3300005355 Ga0070671_100305011 Ga0070671_1003050112 178
54 3300005367 Ga0070667_100130293 Ga0070667_1001302932 178
55 3300005459 Ga0068867_100341221 Ga0068867_1003412212 178
56 3300005530 Ga0070679_100292224 Ga0070679_1002922242 178
57 3300005544 Ga0070686_100172657 Ga0070686_1001726572 178
58 3300005548 Ga0070665_100167824 Ga0070665_1001678242 178
59 3300005564 Ga0070664_100601128 Ga0070664_1006011282 178
60 3300005616 Ga0068852_101059859 Ga0068852_1010598592 178
61 3300005842 Ga0068858_100787539 Ga0068858_1007875392 178
62 3300005842 Ga0068858_101344283 Ga0068858_1013442832 178
63 3300005843 Ga0068860_100472010 Ga0068860_1004720102 178
64 3300006237 Ga0097621_100074680 Ga0097621_1000746803 178
65 3300006844 Ga0075428_100005257 Ga0075428_1000052576 178
66 3300006847 Ga0075431_100000026 Ga0075431_1000000264 178
67 3300006880 Ga0075429_100011857 Ga0075429_1000118573 178
68 3300009036 Ga0105244_10007915 Ga0105244_100079152 178
69 3300009092 Ga0105250_10000032 Ga0105250_1000003285 178
70 3300009093 Ga0105240_10035076 Ga0105240_100350767 178
71 3300009093 Ga0105240_10238173 Ga0105240_102381733 178
72 3300009098 Ga0105245_10017141 Ga0105245_100171413 178
73 3300009177 Ga0105248_11321206 Ga0105248_113212062 178
74 3300010375 Ga0105239_10318472 Ga0105239_103184722 178
75 3300013105 Ga0157369_10020413 Ga0157369_100204135 178
76 3300013296 Ga0157374_10052605 Ga0157374_100526055 178
77 3300013306 Ga0163162_11180270 Ga0163162_111802701 178
78 3300013306 Ga0163162_12531272 Ga0163162_125312721 178
79 3300013307 Ga0157372_10950152 Ga0157372_109501522 178
80 3300013308 Ga0157375_11324299 Ga0157375_113242991 178
81 3300014325 Ga0163163_10177291 Ga0163163_101772912 178
82 3300014326 Ga0157380_10323423 Ga0157380_103234232 178
83 3300014968 Ga0157379_10000004 Ga0157379_1000000484 178
84 3300025711 Ga0207696_1000198 Ga0207696_100019811 178
85 3300025728 Ga0207655_1008135 Ga0207655_10081357 178
86 3300025913 Ga0207695_10357899 Ga0207695_103578992 178
87 3300025917 Ga0207660_10173601 Ga0207660_101736012 178
88 3300025921 Ga0207652_10294543 Ga0207652_102945432 178
89 3300025924 Ga0207694_10565985 Ga0207694_105659852 178
90 3300025931 Ga0207644_10073533 Ga0207644_100735333 178
91 3300025938 Ga0207704_10814776 Ga0207704_108147761 178
92 3300025941 Ga0207711_10821791 Ga0207711_108217912 178
93 3300025945 Ga0207679_10556678 Ga0207679_105566782 178
94 3300025986 Ga0207658_10310694 Ga0207658_103106942 178
95 3300026023 Ga0207677_10121510 Ga0207677_101215102 178
96 3300026035 Ga0207703_10361196 Ga0207703_103611962 178
97 3300026035 Ga0207703_11067382 Ga0207703_110673822 178
98 3300027907 Ga0207428_10006633 Ga0207428_100066332 178
99 3300028800 Ga0265338_10028372 Ga0265338_100283722 178
100 3300031235 Ga0265330_10006689 Ga0265330_100066895 178
101 3300031241 Ga0265325_10000866 Ga0265325_100008662 178
102 3300031242 Ga0265329_10010931 Ga0265329_100109312 178
103 3300031247 Ga0265340_10357674 Ga0265340_103576741 178
104 3300031249 Ga0265339_10008694 Ga0265339_100086945 178
105 3300031250 Ga0265331_10016697 Ga0265331_100166975 178
106 3300031595 Ga0265313_10000441 Ga0265313_100004415 178
107 3300031711 Ga0265314_10118234 Ga0265314_101182342 178
108 3300031712 Ga0265342_10012376 Ga0265342_100123766 178
109 3300037466 Ga0395898_0026035 Ga0395898_0026035_4487_5035 178
110 3300037466 Ga0395898_0544843 Ga0395898_0544843_228_776 178
111 3300038443 Ga0395901_0414679 Ga0395901_0414679_704_1252 178
112 3300041491 Ga0451833_0649033 Ga0451833_0649033_179_730 178
113 3300041492 Ga0451835_0789812 Ga0451835_0789812_306_854 178
114 3300041511 Ga0451855_1330784 Ga0451855_1330784_27_575 178
115 3300041512 Ga0451853_3887589 Ga0451853_3887589_985_1533 178
116 3300042876 Ga0451577_0275075 Ga0451577_0275075_633_1181 178
117 3300044712 Ga0453684_0178451 Ga0453684_0178451_1500_2048 178
118 3300046458 Ga0495591_008118 Ga0495591_008118_526_1089 178
119 3300046501 Ga0495607_0150383 Ga0495607_0150383_477_1040 178
120 3300046507 Ga0495606_0016805 Ga0495606_0016805_56_619 178
121 3300046519 Ga0495632_0028924 Ga0495632_0028924_102_665 178
122 3300046520 Ga0495637_0000801 Ga0495637_0000801_5806_6369 178
123 3300046520 Ga0495637_0000929 Ga0495637_0000929_4988_5551 178
124 3300046526 Ga0495666_0000223 Ga0495666_0000223_5580_6143 178
125 3300046542 Ga0495597_0006033 Ga0495597_0006033_1720_2283 178
126 3300046675 Ga0495657_0318193 Ga0495657_0318193_332_880 178
127 3300046694 Ga0495649_0001320 Ga0495649_0001320_5047_5610 178
128 3300046810 Ga0495660_0001190 Ga0495660_0001190_4882_5445 178
129 3300047317 Ga0495604_0033586 Ga0495604_0033586_2863_3426 178
130 3300047322 Ga0495680_0002585 Ga0495680_0002585_12214_12777 178
131 3300047322 Ga0495680_0791222 Ga0495680_0791222_33_581 178
132 3300047446 Ga0495679_001851 Ga0495679_001851_9089_9655 178
133 3300047470 Ga0495681_0000304 Ga0495681_0000304_21783_22346 178
134 3300047471 Ga0495684_0014354 Ga0495684_0014354_2474_3037 178
135 3300048908 Ga0496105_0065503 Ga0496105_0065503_2144_2692 178
136 3300048911 Ga0496108_0319228 Ga0496108_0319228_170_718 178
137 3300048912 Ga0496109_0448029 Ga0496109_0448029_433_981 178
138 3300048913 Ga0496110_0119376 Ga0496110_0119376_357_905 178
139 3300049459 Ga0495678_009803 Ga0495678_009803_2252_2815 178
140 3300049580 Ga0501046_0383802 Ga0501046_0383802_35_583 178
141 3300050507 nmdc:mga05p37_3119_c1 nmdc:mga05p37_3119_c1_4279_4827 178
142 3300050508 nmdc:mga09592_1540_c1 nmdc:mga09592_1540_c1_11391_11939 178
143 3300050509 nmdc:mga0qj67_228202_c1 nmdc:mga0qj67_228202_c1_942_1490 178
144 3300050510 nmdc:mga06r32_354_c1 nmdc:mga06r32_354_c1_1194_1742 178
145 3300050511 nmdc:mga08y16_2466_c1 nmdc:mga08y16_2466_c1_9128_9676 178
146 3300050515 nmdc:mga0a205_814154_c1 nmdc:mga0a205_814154_c1_34_582 178
147 3300053090 Ga0500646_0042865 Ga0500646_0042865_687_1235 178
148 3300053139 Ga0500568_0034053 Ga0500568_0034053_281_829 178
149 3300053153 Ga0500616_0017070 Ga0500616_0017070_2684_3232 178
150 3300005456 Ga0070678_100063705 Ga0070678_1000637052 179
151 3300009093 Ga0105240_10044246 Ga0105240_100442462 179
152 3300009545 Ga0105237_10050509 Ga0105237_100505092 179
153 3300009551 Ga0105238_10041904 Ga0105238_100419042 179
154 3300025913 Ga0207695_10539155 Ga0207695_105391552 179
155 3300025914 Ga0207671_10006366 Ga0207671_1000636610 179
156 3300026121 Ga0207683_10176640 Ga0207683_101766402 179
157 3300031911 Ga0307412_10545508 Ga0307412_105455082 179
158 3300032002 Ga0307416_100447595 Ga0307416_1004475952 179
159 3300041410 Ga0439461_0009399 Ga0439461_0009399_1127_1690 179
160 3300041997 Ga0439431_0001739 Ga0439431_0001739_3123_3686 179
161 3300042116 Ga0450912_013050 Ga0450912_013050_68_631 179
162 3300042157 Ga0439458_0020083 Ga0439458_0020083_18_581 179
163 3300042435 Ga0439434_0022630 Ga0439434_0022630_371_934 179
164 3300044656 Ga0466969_0000093 Ga0466969_0000093_4877_5452 179
165 3300044684 Ga0466966_0037967 Ga0466966_0037967_547_1122 179
166 3300044693 Ga0466961_0029750 Ga0466961_0029750_2296_2871 179
167 3300044765 Ga0466970_0205808 Ga0466970_0205808_462_1037 179
168 3300045049 Ga0466959_0073924 Ga0466959_0073924_724_1299 179
169 3300045051 Ga0451576_0048122 Ga0451576_0048122_728_1300 179
170 3300061719 Ga0466962_0161246 Ga0466962_0161246_289_864 179
171 3300003322 rootL2_10132796 rootL2_101327962 180
172 3300003323 rootH1_10051792 rootH1_100517922 180
173 3300003323 rootH1_10087560 rootH1_100875602 180
174 3300005339 Ga0070660_100904617 Ga0070660_1009046171 180
175 3300005344 Ga0070661_100605626 Ga0070661_1006056262 180
176 3300005355 Ga0070671_100140962 Ga0070671_1001409623 180
177 3300005445 Ga0070708_100755865 Ga0070708_1007558652 180
178 3300005457 Ga0070662_100054100 Ga0070662_1000541002 180
179 3300005618 Ga0068864_100139590 Ga0068864_1001395903 180
180 3300005841 Ga0068863_100223605 Ga0068863_1002236052 180
181 3300006871 Ga0075434_101084752 Ga0075434_1010847522 180
182 3300009094 Ga0111539_10010596 Ga0111539_1001059610 180
183 3300009147 Ga0114129_10035870 Ga0114129_100358703 180
184 3300009147 Ga0114129_10758835 Ga0114129_107588352 180
185 3300009177 Ga0105248_10008012 Ga0105248_1000801210 180
186 3300025931 Ga0207644_10035499 Ga0207644_100354993 180
187 3300025933 Ga0207706_10007872 Ga0207706_100078724 180
188 3300025941 Ga0207711_10014090 Ga0207711_100140906 180
189 3300026088 Ga0207641_10344705 Ga0207641_103447052 180
190 3300026095 Ga0207676_10149793 Ga0207676_101497932 180
191 3300028794 Ga0307515_10000011 Ga0307515_10000011440 180
192 3300031731 Ga0307405_10150418 Ga0307405_101504182 180
193 3300031731 Ga0307405_10616242 Ga0307405_106162422 180
194 3300031852 Ga0307410_10302151 Ga0307410_103021512 180
195 3300031911 Ga0307412_10981536 Ga0307412_109815361 180
196 3300031995 Ga0307409_100610879 Ga0307409_1006108792 180
197 3300032002 Ga0307416_100846018 Ga0307416_1008460181 180
198 3300035112 Ga0373932_0052126 Ga0373932_0052126_171_722 180
199 3300035695 Ga0373927_0110387 Ga0373927_0110387_172_714 180
200 3300037466 Ga0395898_0001226 Ga0395898_0001226_23756_24325 180
201 3300037466 Ga0395898_0004063 Ga0395898_0004063_12870_13412 180
202 3300038443 Ga0395901_0165476 Ga0395901_0165476_1253_1795 180
203 3300042005 Ga0439448_0126687 Ga0439448_0126687_289_855 180
204 3300042011 Ga0439454_022346 Ga0439454_022346_276_827 180
205 3300042134 Ga0450898_077028 Ga0450898_077028_51_602 180
206 3300042156 Ga0439446_0038170 Ga0439446_0038170_159_710 180
207 3300042876 Ga0451577_0011170 Ga0451577_0011170_5648_6232 180
208 3300042876 Ga0451577_0263418 Ga0451577_0263418_284_832 180
209 3300044658 Ga0466972_0000433 Ga0466972_0000433_1936_2532 180
210 3300044684 Ga0466966_0073078 Ga0466966_0073078_589_1167 180
211 3300044684 Ga0466966_0092113 Ga0466966_0092113_1106_1672 180
212 3300044693 Ga0466961_0054294 Ga0466961_0054294_1049_1627 180
213 3300044693 Ga0466961_0249984 Ga0466961_0249984_284_880 180
214 3300044694 Ga0466963_0079641 Ga0466963_0079641_649_1227 180
215 3300044706 Ga0466964_0015364 Ga0466964_0015364_2218_2796 180
216 3300044706 Ga0466964_0145733 Ga0466964_0145733_156_722 180
217 3300044712 Ga0453684_0147945 Ga0453684_0147945_875_1456 180
218 3300044735 Ga0466968_0041959 Ga0466968_0041959_1170_1736 180
219 3300045049 Ga0466959_0000027 Ga0466959_0000027_87331_87909 180
220 3300045836 Ga0466958_0025546 Ga0466958_0025546_589_1167 180
221 3300045976 Ga0466967_0057250 Ga0466967_0057250_716_1294 180
222 3300046506 Ga0495583_0000173 Ga0495583_0000173_65705_66247 180
223 3300046507 Ga0495606_0008230 Ga0495606_0008230_2188_2730 180
224 3300046616 Ga0495668_0057933 Ga0495668_0057933_951_1493 180
225 3300046660 Ga0495625_0009443 Ga0495625_0009443_3937_4479 180
226 3300046694 Ga0495649_0000136 Ga0495649_0000136_20781_21323 180
227 3300046794 Ga0495589_0002209 Ga0495589_0002209_1403_1945 180
228 3300048904 Ga0496101_0570497 Ga0496101_0570497_48_620 180
229 3300048907 Ga0496104_0170143 Ga0496104_0170143_963_1535 180
230 3300048908 Ga0496105_0052949 Ga0496105_0052949_543_1115 180
231 3300048911 Ga0496108_0119725 Ga0496108_0119725_992_1564 180
232 3300048912 Ga0496109_0110549 Ga0496109_0110549_1940_2512 180
233 3300048913 Ga0496110_0625956 Ga0496110_0625956_87_635 180
234 3300048915 Ga0496112_0006393 Ga0496112_0006393_4051_4623 180
235 3300048916 Ga0496113_0079999 Ga0496113_0079999_815_1387 180
236 3300050512 nmdc:mga0n895_835911_c1 nmdc:mga0n895_835911_c1_196_762 180
237 3300053086 Ga0500578_0121059 Ga0500578_0121059_13_555 180
238 3300053122 Ga0500608_058988 Ga0500608_058988_492_1034 180
239 3300053147 Ga0500589_064873 Ga0500589_064873_699_1241 180
240 3300053148 Ga0500590_002480 Ga0500590_002480_7368_7931 180
241 3300055283 Ga0500661_002687 Ga0500661_002687_386_928 180
242 3300035114 Ga0373939_0000219 Ga0373939_0000219_163_720 181
243 3300035121 Ga0373960_0004077 Ga0373960_0004077_173_730 181
244 3300035242 Ga0373962_0024580 Ga0373962_0024580_86_643 181
245 3300035691 Ga0373931_0000827 Ga0373931_0000827_151_708 181
246 3300002705 JGI25156J39149_1009314 JGI25156J39149_10093143 182
247 3300003322 rootL2_10063119 rootL2_100631198 182
248 3300025256 Ga0209759_1010559 Ga0209759_10105592 182
249 3300030521 Ga0307511_10048354 Ga0307511_100483542 182
250 3300045051 Ga0451576_0346044 Ga0451576_0346044_570_1133 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

5

184

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9855 3 178
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9806 1 180
6din-assembly1.cif.gz_A-2 high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase 0.9804 2 182
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9799 1 182
1upi-assembly1.cif.gz_A mycobacterium tuberculosis rmlc epimerase (rv3465) 0.9748 4 180
ID Description Score Start End Superfamily
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9766 1 182 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.974 4 180 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9713 4 180 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9598 1 177 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9506 3 180 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2A2I1K6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9953 4 179 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A630SW49-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9952 4 145 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A192C831-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9941 4 152 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A3C0JH15-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9932 4 157 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-T1X4U2-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9931 4 180 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Feature Viewer

pLDDT pTM Quality
96.76 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map