F361346
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 250 | 195 | 249 | 185 |
Family's Representative Sequence
| Representative Sequence | 3300005344|Ga0070661_100605626|Ga0070661_1006056262 |
| Length | 208 |
| Sequence | MKLIPTSLRDVVIVEPAVFGDERGWFMESYNDRRFNAALQERGLPPARPFVQDNHSCSARGVLRGLHYQLPPHPQGKLVRVAKGSAFDVAVDIRRGSPTFGHWVGVELTAQNHRQLWIPEGFAHGFVALEDDTHFLYKTTDFYAKDCEGAIRWDDPQIGIEWPGVGGMAPLVAPKDAAAGTLAEALAAGRVFDAGATLKATPGRPKLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 30 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 32 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 33 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 34 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 35 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 36 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 57 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 58 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 81 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 82 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 83 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 84 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 85 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 86 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 87 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 88 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 89 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 90 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 91 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 92 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 93 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 94 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 95 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 96 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 97 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 98 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 99 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 100 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 101 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 102 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 104 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 105 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 106 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 107 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 108 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 109 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 110 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 111 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 114 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 115 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 116 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 117 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 118 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 119 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 120 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 121 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 122 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 123 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 124 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 125 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 126 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 127 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 128 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 129 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 130 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 131 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 132 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 133 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 134 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 135 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 136 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 137 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 138 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 139 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 140 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 141 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 142 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 143 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 144 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 145 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 146 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 147 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 148 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 149 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 170 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 171 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 174 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 175 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 176 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 187 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 188 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 189 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 190 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 191 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 192 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 193 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 194 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 195 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.8 |
| Metatranscriptomes | 0.8 |
| Isolates | 0.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.4 |
| Nodule | 0 |
| Rhizoplane | 4.8 |
| Rhizosphere | 78.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1009314 | 3300002705 | Bacteria | 2398 |
| 2 | rootL2_10063119 | 3300003322 | Bacteria | 10161 |
| 3 | rootL2_10132796 | 3300003322 | Bacteria | 1032 |
| 4 | rootH1_10051792 | 3300003323 | Bacteria | 3503 |
| 5 | rootH1_10087560 | 3300003323 | Bacteria | 1299 |
| 6 | Ga0065712_10159979 | 3300005290 | Bacteria | 1309 |
| 7 | Ga0065707_10082876 | 3300005295 | Bacteria | 11628 |
| 8 | Ga0070677_10061547 | 3300005333 | Bacteria | 1550 |
| 9 | Ga0070660_100669637 | 3300005339 | Unclassified | 869 |
| 10 | Ga0070660_100904617 | 3300005339 | Bacteria | 744 |
| 11 | Ga0070689_100002060 | 3300005340 | Bacteria | 13046 |
| 12 | Ga0070661_100605626 | 3300005344 | Bacteria | 886 |
| 13 | Ga0070675_100577249 | 3300005354 | Bacteria | 1018 |
| 14 | Ga0070671_100140962 | 3300005355 | Bacteria | 2034 |
| 15 | Ga0070671_100305011 | 3300005355 | Bacteria | 1356 |
| 16 | Ga0070673_100823885 | 3300005364 | Bacteria | 858 |
| 17 | Ga0070667_100130293 | 3300005367 | Bacteria | 2194 |
| 18 | Ga0070708_100755865 | 3300005445 | Bacteria | 914 |
| 19 | Ga0070678_100063705 | 3300005456 | Bacteria | 2729 |
| 20 | Ga0070662_100054100 | 3300005457 | Bacteria | 2908 |
| 21 | Ga0070681_10693377 | 3300005458 | Bacteria | 934 |
| 22 | Ga0068867_100341221 | 3300005459 | Bacteria | 1247 |
| 23 | Ga0070679_100292224 | 3300005530 | Bacteria | 1581 |
| 24 | Ga0070686_100172657 | 3300005544 | Bacteria | 1530 |
| 25 | Ga0070665_100167824 | 3300005548 | Bacteria | 2197 |
| 26 | Ga0070664_100601128 | 3300005564 | Bacteria | 1020 |
| 27 | Ga0070664_101521484 | 3300005564 | Bacteria | 633 |
| 28 | Ga0068852_101059859 | 3300005616 | Unclassified | 830 |
| 29 | Ga0068864_100139590 | 3300005618 | Bacteria | 2185 |
| 30 | Ga0068863_100223605 | 3300005841 | Bacteria | 1814 |
| 31 | Ga0068858_100787539 | 3300005842 | Bacteria | 927 |
| 32 | Ga0068858_101344283 | 3300005842 | Bacteria | 703 |
| 33 | Ga0068860_100472010 | 3300005843 | Bacteria | 1250 |
| 34 | Ga0075365_10002557 | 3300006038 | Bacteria | 8979 |
| 35 | Ga0097621_100074680 | 3300006237 | Bacteria | 2808 |
| 36 | Ga0097621_100802633 | 3300006237 | Bacteria | 872 |
| 37 | Ga0068871_100653701 | 3300006358 | Bacteria | 960 |
| 38 | Ga0075428_100005257 | 3300006844 | Bacteria | 14392 |
| 39 | Ga0075431_100000026 | 3300006847 | Bacteria | 75269 |
| 40 | Ga0075434_101084752 | 3300006871 | Bacteria | 814 |
| 41 | Ga0075429_100011857 | 3300006880 | Bacteria | 7558 |
| 42 | Ga0105244_10007915 | 3300009036 | Bacteria | 6699 |
| 43 | Ga0105250_10000032 | 3300009092 | Bacteria | 159642 |
| 44 | Ga0105240_10035076 | 3300009093 | Bacteria | 6469 |
| 45 | Ga0105240_10044246 | 3300009093 | Bacteria | 5660 |
| 46 | Ga0105240_10238173 | 3300009093 | Bacteria | 2111 |
| 47 | Ga0111539_10010596 | 3300009094 | Bacteria | 11608 |
| 48 | Ga0105245_10017141 | 3300009098 | Bacteria | 6320 |
| 49 | Ga0114129_10035870 | 3300009147 | Bacteria | 7003 |
| 50 | Ga0114129_10758835 | 3300009147 | Bacteria | 1241 |
| 51 | Ga0105242_10008561 | 3300009176 | Bacteria | 7856 |
| 52 | Ga0105248_10008012 | 3300009177 | Bacteria | 11606 |
| 53 | Ga0105248_11321206 | 3300009177 | Bacteria | 816 |
| 54 | Ga0105237_10050509 | 3300009545 | Bacteria | 4179 |
| 55 | Ga0105238_10041904 | 3300009551 | Bacteria | 4637 |
| 56 | Ga0105239_10318472 | 3300010375 | Bacteria | 1753 |
| 57 | Ga0157369_10020413 | 3300013105 | Bacteria | 7404 |
| 58 | Ga0157374_10052605 | 3300013296 | Bacteria | 3794 |
| 59 | Ga0157378_10094733 | 3300013297 | Bacteria | 2719 |
| 60 | Ga0163162_11180270 | 3300013306 | Unclassified | 868 |
| 61 | Ga0163162_12531272 | 3300013306 | Bacteria | 590 |
| 62 | Ga0157372_10950152 | 3300013307 | Bacteria | 996 |
| 63 | Ga0157375_11324299 | 3300013308 | Unclassified | 847 |
| 64 | Ga0163163_10177291 | 3300014325 | Bacteria | 2178 |
| 65 | Ga0157380_10323423 | 3300014326 | Bacteria | 1431 |
| 66 | Ga0157379_10000004 | 3300014968 | Bacteria | 173351 |
| 67 | Ga0213876_10029110 | 3300021384 | Bacteria | 2912 |
| 68 | Ga0209759_1010559 | 3300025256 | Bacteria | 2698 |
| 69 | Ga0209673_1006960 | 3300025273 | Bacteria | 5338 |
| 70 | Ga0207696_1000198 | 3300025711 | Bacteria | 92750 |
| 71 | Ga0207655_1008135 | 3300025728 | Bacteria | 6707 |
| 72 | Ga0207707_10744131 | 3300025912 | Bacteria | 820 |
| 73 | Ga0207695_10357899 | 3300025913 | Bacteria | 1346 |
| 74 | Ga0207695_10539155 | 3300025913 | Bacteria | 1048 |
| 75 | Ga0207671_10006366 | 3300025914 | Bacteria | 10529 |
| 76 | Ga0207660_10173601 | 3300025917 | Bacteria | 1670 |
| 77 | Ga0207652_10294543 | 3300025921 | Bacteria | 1464 |
| 78 | Ga0207694_10565985 | 3300025924 | Bacteria | 955 |
| 79 | Ga0207659_10139785 | 3300025926 | Bacteria | 1879 |
| 80 | Ga0207644_10035499 | 3300025931 | Bacteria | 3494 |
| 81 | Ga0207644_10073533 | 3300025931 | Bacteria | 2507 |
| 82 | Ga0207706_10007872 | 3300025933 | Bacteria | 9835 |
| 83 | Ga0207686_10296943 | 3300025934 | Bacteria | 1198 |
| 84 | Ga0207704_10814776 | 3300025938 | Unclassified | 780 |
| 85 | Ga0207711_10014090 | 3300025941 | Bacteria | 6643 |
| 86 | Ga0207711_10821791 | 3300025941 | Bacteria | 865 |
| 87 | Ga0207679_10556678 | 3300025945 | Bacteria | 1029 |
| 88 | Ga0207658_10310694 | 3300025986 | Bacteria | 1361 |
| 89 | Ga0207677_10121510 | 3300026023 | Bacteria | 1965 |
| 90 | Ga0207703_10361196 | 3300026035 | Bacteria | 1339 |
| 91 | Ga0207703_11067382 | 3300026035 | Bacteria | 775 |
| 92 | Ga0207641_10344705 | 3300026088 | Bacteria | 1418 |
| 93 | Ga0207676_10149793 | 3300026095 | Bacteria | 2008 |
| 94 | Ga0207683_10176640 | 3300026121 | Bacteria | 1936 |
| 95 | Ga0207683_11201005 | 3300026121 | Bacteria | 703 |
| 96 | Ga0207428_10006633 | 3300027907 | Bacteria | 10640 |
| 97 | Ga0265334_10010337 | 3300028573 | Bacteria | 3942 |
| 98 | Ga0307515_10000011 | 3300028794 | Bacteria | 633903 |
| 99 | Ga0265338_10019812 | 3300028800 | Bacteria | 7110 |
| 100 | Ga0265338_10028372 | 3300028800 | Bacteria | 5583 |
| 101 | Ga0307511_10048354 | 3300030521 | Bacteria | 3462 |
| 102 | Ga0265330_10006689 | 3300031235 | Bacteria | 5686 |
| 103 | Ga0265320_10324425 | 3300031240 | Bacteria | 681 |
| 104 | Ga0265325_10000866 | 3300031241 | Bacteria | 21795 |
| 105 | Ga0265329_10010931 | 3300031242 | Bacteria | 3318 |
| 106 | Ga0265340_10357674 | 3300031247 | Bacteria | 645 |
| 107 | Ga0265339_10008694 | 3300031249 | Bacteria | 6443 |
| 108 | Ga0265331_10016697 | 3300031250 | Bacteria | 3847 |
| 109 | Ga0265313_10000441 | 3300031595 | Bacteria | 44042 |
| 110 | Ga0265313_10022470 | 3300031595 | Bacteria | 3420 |
| 111 | Ga0265314_10118234 | 3300031711 | Bacteria | 1673 |
| 112 | Ga0265342_10012376 | 3300031712 | Bacteria | 5783 |
| 113 | Ga0316576_11024603 | 3300031727 | Bacteria | 587 |
| 114 | Ga0307405_10150418 | 3300031731 | Bacteria | 1636 |
| 115 | Ga0307405_10616242 | 3300031731 | Bacteria | 888 |
| 116 | Ga0316577_10088325 | 3300031733 | Unclassified | 1735 |
| 117 | Ga0307410_10302151 | 3300031852 | Bacteria | 1263 |
| 118 | Ga0307412_10545508 | 3300031911 | Bacteria | 973 |
| 119 | Ga0307412_10981536 | 3300031911 | Bacteria | 745 |
| 120 | Ga0307409_100610879 | 3300031995 | Bacteria | 1079 |
| 121 | Ga0307416_100447595 | 3300032002 | Bacteria | 1343 |
| 122 | Ga0307416_100846018 | 3300032002 | Bacteria | 1013 |
| 123 | Ga0316596_1017149 | 3300033541 | Bacteria | 1819 |
| 124 | Ga0373932_0052126 | 3300035112 | Bacteria | 1217 |
| 125 | Ga0373939_0000219 | 3300035114 | Bacteria | 15660 |
| 126 | Ga0373960_0004077 | 3300035121 | Bacteria | 3338 |
| 127 | Ga0373962_0024580 | 3300035242 | Bacteria | 1612 |
| 128 | Ga0316574_0598238 | 3300035398 | Bacteria | 682 |
| 129 | Ga0373931_0000827 | 3300035691 | Bacteria | 12984 |
| 130 | Ga0373927_0110387 | 3300035695 | Bacteria | 1792 |
| 131 | Ga0316584_0195319 | 3300036712 | Bacteria | 1495 |
| 132 | Ga0316584_0291827 | 3300036712 | Bacteria | 1183 |
| 133 | Ga0395898_0001226 | 3300037466 | Bacteria | 38522 |
| 134 | Ga0395898_0004063 | 3300037466 | Bacteria | 16073 |
| 135 | Ga0395898_0026035 | 3300037466 | Bacteria | 5890 |
| 136 | Ga0395898_0544843 | 3300037466 | Bacteria | 1102 |
| 137 | Ga0395901_0165476 | 3300038443 | Bacteria | 2322 |
| 138 | Ga0395901_0414679 | 3300038443 | Bacteria | 1382 |
| 139 | Ga0400490_49683 | 3300038726 | Bacteria | 41099 |
| 140 | Ga0400490_50693 | 3300038726 | Bacteria | 47921 |
| 141 | Ga0400491_02776 | 3300038727 | Bacteria | 10180 |
| 142 | Ga0400491_05283 | 3300038727 | Unclassified | 2217 |
| 143 | Ga0400485_22198 | 3300038735 | Unclassified | 1559 |
| 144 | Ga0400488_39530 | 3300038741 | Bacteria | 1232 |
| 145 | Ga0400488_57088 | 3300038741 | Bacteria | 2536 |
| 146 | Ga0400486_14578 | 3300038742 | Bacteria | 10776 |
| 147 | Ga0400483_004432 | 3300039062 | Bacteria | 6682 |
| 148 | Ga0400483_080037 | 3300039062 | Bacteria | 4135 |
| 149 | Ga0400483_104977 | 3300039062 | Bacteria | 14907 |
| 150 | Ga0400483_107450 | 3300039062 | Bacteria | 1042 |
| 151 | Ga0400483_206539 | 3300039062 | Bacteria | 9124 |
| 152 | Ga0400487_04053 | 3300039110 | Bacteria | 1660 |
| 153 | Ga0400487_34970 | 3300039110 | Bacteria | 222491 |
| 154 | Ga0436365_1395598 | 3300039437 | Bacteria | 6649 |
| 155 | Ga0439461_0009399 | 3300041410 | Bacteria | 1773 |
| 156 | Ga0451833_0649033 | 3300041491 | Unclassified | 991 |
| 157 | Ga0451835_0789812 | 3300041492 | Bacteria | 1067 |
| 158 | Ga0451855_1330784 | 3300041511 | Unclassified | 705 |
| 159 | Ga0451853_3887589 | 3300041512 | Bacteria | 2553 |
| 160 | Ga0439431_0001739 | 3300041997 | Bacteria | 4799 |
| 161 | Ga0439448_0126687 | 3300042005 | Bacteria | 878 |
| 162 | Ga0439454_022346 | 3300042011 | Bacteria | 942 |
| 163 | Ga0439455_0074923 | 3300042012 | Bacteria | 913 |
| 164 | Ga0450912_013050 | 3300042116 | Bacteria | 739 |
| 165 | Ga0450898_077028 | 3300042134 | Bacteria | 674 |
| 166 | Ga0439446_0038170 | 3300042156 | Bacteria | 1408 |
| 167 | Ga0439458_0020083 | 3300042157 | Bacteria | 1542 |
| 168 | Ga0439434_0022630 | 3300042435 | Bacteria | 1889 |
| 169 | Ga0451577_0011170 | 3300042876 | Bacteria | 8518 |
| 170 | Ga0451577_0263418 | 3300042876 | Bacteria | 1561 |
| 171 | Ga0451577_0275075 | 3300042876 | Bacteria | 1525 |
| 172 | Ga0466969_0000093 | 3300044656 | Bacteria | 46242 |
| 173 | Ga0466969_0026637 | 3300044656 | Bacteria | 2963 |
| 174 | Ga0466972_0000433 | 3300044658 | Bacteria | 21713 |
| 175 | Ga0466966_0037967 | 3300044684 | Bacteria | 3104 |
| 176 | Ga0466966_0073078 | 3300044684 | Bacteria | 2146 |
| 177 | Ga0466966_0092113 | 3300044684 | Bacteria | 1881 |
| 178 | Ga0466961_0029750 | 3300044693 | Bacteria | 3509 |
| 179 | Ga0466961_0054294 | 3300044693 | Bacteria | 2555 |
| 180 | Ga0466961_0249984 | 3300044693 | Bacteria | 1089 |
| 181 | Ga0466963_0079641 | 3300044694 | Bacteria | 2216 |
| 182 | Ga0466964_0015364 | 3300044706 | Bacteria | 2912 |
| 183 | Ga0466964_0145733 | 3300044706 | Bacteria | 1093 |
| 184 | Ga0453684_0147945 | 3300044712 | Bacteria | 2795 |
| 185 | Ga0453684_0178451 | 3300044712 | Unclassified | 2495 |
| 186 | Ga0466968_0041959 | 3300044735 | Bacteria | 1933 |
| 187 | Ga0466970_0205808 | 3300044765 | Bacteria | 1095 |
| 188 | Ga0466959_0000027 | 3300045049 | Bacteria | 114262 |
| 189 | Ga0466959_0073924 | 3300045049 | Bacteria | 2465 |
| 190 | Ga0451576_0048122 | 3300045051 | Bacteria | 4481 |
| 191 | Ga0451576_0346044 | 3300045051 | Bacteria | 1556 |
| 192 | Ga0451576_0515970 | 3300045051 | Bacteria | 1255 |
| 193 | Ga0466958_0025546 | 3300045836 | Bacteria | 3483 |
| 194 | Ga0466967_0057250 | 3300045976 | Bacteria | 3440 |
| 195 | Ga0495591_008118 | 3300046458 | Bacteria | 4339 |
| 196 | Ga0495607_0150383 | 3300046501 | Bacteria | 1192 |
| 197 | Ga0495583_0000173 | 3300046506 | Bacteria | 109405 |
| 198 | Ga0495606_0008230 | 3300046507 | Bacteria | 9108 |
| 199 | Ga0495606_0016805 | 3300046507 | Bacteria | 5560 |
| 200 | Ga0495632_0028924 | 3300046519 | Bacteria | 2890 |
| 201 | Ga0495637_0000801 | 3300046520 | Bacteria | 20905 |
| 202 | Ga0495637_0000929 | 3300046520 | Bacteria | 18749 |
| 203 | Ga0495666_0000223 | 3300046526 | Bacteria | 24132 |
| 204 | Ga0495597_0006033 | 3300046542 | Bacteria | 6314 |
| 205 | Ga0495668_0057933 | 3300046616 | Bacteria | 2138 |
| 206 | Ga0495625_0009443 | 3300046660 | Bacteria | 8161 |
| 207 | Ga0495657_0318193 | 3300046675 | Bacteria | 925 |
| 208 | Ga0495649_0000136 | 3300046694 | Bacteria | 64021 |
| 209 | Ga0495649_0001320 | 3300046694 | Bacteria | 18917 |
| 210 | Ga0495589_0002209 | 3300046794 | Bacteria | 10952 |
| 211 | Ga0495660_0001190 | 3300046810 | Bacteria | 18276 |
| 212 | Ga0495604_0033586 | 3300047317 | Bacteria | 4061 |
| 213 | Ga0495680_0002585 | 3300047322 | Bacteria | 18426 |
| 214 | Ga0495680_0791222 | 3300047322 | Bacteria | 620 |
| 215 | Ga0495679_001851 | 3300047446 | Bacteria | 11436 |
| 216 | Ga0495681_0000304 | 3300047470 | Bacteria | 39427 |
| 217 | Ga0495684_0014354 | 3300047471 | Bacteria | 6095 |
| 218 | Ga0496101_0570497 | 3300048904 | Bacteria | 895 |
| 219 | Ga0496104_0170143 | 3300048907 | Bacteria | 2089 |
| 220 | Ga0496105_0052949 | 3300048908 | Bacteria | 3352 |
| 221 | Ga0496105_0065503 | 3300048908 | Bacteria | 2999 |
| 222 | Ga0496108_0119725 | 3300048911 | Bacteria | 2257 |
| 223 | Ga0496108_0319228 | 3300048911 | Bacteria | 1354 |
| 224 | Ga0496109_0110549 | 3300048912 | Bacteria | 2555 |
| 225 | Ga0496109_0448029 | 3300048912 | Bacteria | 1219 |
| 226 | Ga0496110_0119376 | 3300048913 | Bacteria | 2375 |
| 227 | Ga0496110_0625956 | 3300048913 | Bacteria | 975 |
| 228 | Ga0496112_0006393 | 3300048915 | Bacteria | 10342 |
| 229 | Ga0496113_0079999 | 3300048916 | Bacteria | 2502 |
| 230 | Ga0495678_009803 | 3300049459 | Bacteria | 4704 |
| 231 | Ga0501312_072097 | 3300049528 | Bacteria | 614 |
| 232 | Ga0501046_0383802 | 3300049580 | Bacteria | 1016 |
| 233 | nmdc:mga05p37_3119_c1 | 3300050507 | Bacteria | 19270 |
| 234 | nmdc:mga09592_1540_c1 | 3300050508 | Bacteria | 18541 |
| 235 | nmdc:mga0qj67_228202_c1 | 3300050509 | Bacteria | 1511 |
| 236 | nmdc:mga06r32_354_c1 | 3300050510 | Bacteria | 38365 |
| 237 | nmdc:mga08y16_2466_c1 | 3300050511 | Bacteria | 18996 |
| 238 | nmdc:mga0n895_835911_c1 | 3300050512 | Bacteria | 909 |
| 239 | nmdc:mga0a205_814154_c1 | 3300050515 | Bacteria | 782 |
| 240 | Ga0500578_0121059 | 3300053086 | Bacteria | 1645 |
| 241 | Ga0500646_0042865 | 3300053090 | Bacteria | 1280 |
| 242 | Ga0500608_058988 | 3300053122 | Bacteria | 1837 |
| 243 | Ga0500568_0034053 | 3300053139 | Bacteria | 2086 |
| 244 | Ga0500588_0099316 | 3300053146 | Bacteria | 1001 |
| 245 | Ga0500589_064873 | 3300053147 | Bacteria | 1666 |
| 246 | Ga0500590_002480 | 3300053148 | Bacteria | 8208 |
| 247 | Ga0500616_0017070 | 3300053153 | Bacteria | 4121 |
| 248 | Ga0500661_002687 | 3300055283 | Bacteria | 3363 |
| 249 | Ga0466962_0161246 | 3300061719 | Bacteria | 1090 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038727 | Ga0400491_05283 | Ga0400491_05283_65_559 | 150 |
| 2 | 3300042012 | Ga0439455_0074923 | Ga0439455_0074923_12_542 | 168 |
| 3 | 3300049528 | Ga0501312_072097 | Ga0501312_072097_24_554 | 168 |
| 4 | 3300044656 | Ga0466969_0026637 | Ga0466969_0026637_23_568 | 169 |
| 5 | 3300045051 | Ga0451576_0515970 | Ga0451576_0515970_16_534 | 170 |
| 6 | 3300021384 | Ga0213876_10029110 | Ga0213876_100291103 | 175 |
| 7 | 3300039062 | Ga0400483_107450 | Ga0400483_107450_204_761 | 175 |
| 8 | 3300039437 | Ga0436365_1395598 | Ga0436365_1395598_4950_5516 | 175 |
| 9 | iso_pu_bacteria | 2916699645 | 2916700831 | 175 |
| 10 | 3300005458 | Ga0070681_10693377 | Ga0070681_106933771 | 176 |
| 11 | 3300025273 | Ga0209673_1006960 | Ga0209673_10069602 | 176 |
| 12 | 3300025912 | Ga0207707_10744131 | Ga0207707_107441312 | 176 |
| 13 | 3300031727 | Ga0316576_11024603 | Ga0316576_110246031 | 176 |
| 14 | 3300033541 | Ga0316596_1017149 | Ga0316596_10171492 | 176 |
| 15 | 3300035398 | Ga0316574_0598238 | Ga0316574_0598238_92_658 | 176 |
| 16 | 3300036712 | Ga0316584_0195319 | Ga0316584_0195319_453_1013 | 176 |
| 17 | 3300036712 | Ga0316584_0291827 | Ga0316584_0291827_568_1125 | 176 |
| 18 | 3300038726 | Ga0400490_49683 | Ga0400490_49683_38166_38738 | 176 |
| 19 | 3300038726 | Ga0400490_50693 | Ga0400490_50693_20401_20973 | 176 |
| 20 | 3300038727 | Ga0400491_02776 | Ga0400491_02776_195_767 | 176 |
| 21 | 3300038735 | Ga0400485_22198 | Ga0400485_22198_219_797 | 176 |
| 22 | 3300038741 | Ga0400488_39530 | Ga0400488_39530_314_886 | 176 |
| 23 | 3300038741 | Ga0400488_57088 | Ga0400488_57088_898_1470 | 176 |
| 24 | 3300038742 | Ga0400486_14578 | Ga0400486_14578_3315_3893 | 176 |
| 25 | 3300039062 | Ga0400483_004432 | Ga0400483_004432_4829_5401 | 176 |
| 26 | 3300039062 | Ga0400483_080037 | Ga0400483_080037_3563_4123 | 176 |
| 27 | 3300039062 | Ga0400483_104977 | Ga0400483_104977_8349_8921 | 176 |
| 28 | 3300039062 | Ga0400483_206539 | Ga0400483_206539_6772_7332 | 176 |
| 29 | 3300039110 | Ga0400487_04053 | Ga0400487_04053_112_684 | 176 |
| 30 | 3300039110 | Ga0400487_34970 | Ga0400487_34970_192681_193253 | 176 |
| 31 | 3300005290 | Ga0065712_10159979 | Ga0065712_101599792 | 177 |
| 32 | 3300005364 | Ga0070673_100823885 | Ga0070673_1008238851 | 177 |
| 33 | 3300005564 | Ga0070664_101521484 | Ga0070664_1015214841 | 177 |
| 34 | 3300006038 | Ga0075365_10002557 | Ga0075365_100025577 | 177 |
| 35 | 3300006237 | Ga0097621_100802633 | Ga0097621_1008026331 | 177 |
| 36 | 3300006358 | Ga0068871_100653701 | Ga0068871_1006537012 | 177 |
| 37 | 3300009176 | Ga0105242_10008561 | Ga0105242_100085615 | 177 |
| 38 | 3300013297 | Ga0157378_10094733 | Ga0157378_100947333 | 177 |
| 39 | 3300025926 | Ga0207659_10139785 | Ga0207659_101397852 | 177 |
| 40 | 3300025934 | Ga0207686_10296943 | Ga0207686_102969432 | 177 |
| 41 | 3300026121 | Ga0207683_11201005 | Ga0207683_112010052 | 177 |
| 42 | 3300028573 | Ga0265334_10010337 | Ga0265334_100103372 | 177 |
| 43 | 3300028800 | Ga0265338_10019812 | Ga0265338_100198123 | 177 |
| 44 | 3300031240 | Ga0265320_10324425 | Ga0265320_103244251 | 177 |
| 45 | 3300031595 | Ga0265313_10022470 | Ga0265313_100224702 | 177 |
| 46 | 3300031733 | Ga0316577_10088325 | Ga0316577_100883252 | 177 |
| 47 | 3300053146 | Ga0500588_0099316 | Ga0500588_0099316_309_854 | 177 |
| 48 | 3300005295 | Ga0065707_10082876 | Ga0065707_100828767 | 178 |
| 49 | 3300005333 | Ga0070677_10061547 | Ga0070677_100615472 | 178 |
| 50 | 3300005339 | Ga0070660_100669637 | Ga0070660_1006696372 | 178 |
| 51 | 3300005340 | Ga0070689_100002060 | Ga0070689_10000206011 | 178 |
| 52 | 3300005354 | Ga0070675_100577249 | Ga0070675_1005772492 | 178 |
| 53 | 3300005355 | Ga0070671_100305011 | Ga0070671_1003050112 | 178 |
| 54 | 3300005367 | Ga0070667_100130293 | Ga0070667_1001302932 | 178 |
| 55 | 3300005459 | Ga0068867_100341221 | Ga0068867_1003412212 | 178 |
| 56 | 3300005530 | Ga0070679_100292224 | Ga0070679_1002922242 | 178 |
| 57 | 3300005544 | Ga0070686_100172657 | Ga0070686_1001726572 | 178 |
| 58 | 3300005548 | Ga0070665_100167824 | Ga0070665_1001678242 | 178 |
| 59 | 3300005564 | Ga0070664_100601128 | Ga0070664_1006011282 | 178 |
| 60 | 3300005616 | Ga0068852_101059859 | Ga0068852_1010598592 | 178 |
| 61 | 3300005842 | Ga0068858_100787539 | Ga0068858_1007875392 | 178 |
| 62 | 3300005842 | Ga0068858_101344283 | Ga0068858_1013442832 | 178 |
| 63 | 3300005843 | Ga0068860_100472010 | Ga0068860_1004720102 | 178 |
| 64 | 3300006237 | Ga0097621_100074680 | Ga0097621_1000746803 | 178 |
| 65 | 3300006844 | Ga0075428_100005257 | Ga0075428_1000052576 | 178 |
| 66 | 3300006847 | Ga0075431_100000026 | Ga0075431_1000000264 | 178 |
| 67 | 3300006880 | Ga0075429_100011857 | Ga0075429_1000118573 | 178 |
| 68 | 3300009036 | Ga0105244_10007915 | Ga0105244_100079152 | 178 |
| 69 | 3300009092 | Ga0105250_10000032 | Ga0105250_1000003285 | 178 |
| 70 | 3300009093 | Ga0105240_10035076 | Ga0105240_100350767 | 178 |
| 71 | 3300009093 | Ga0105240_10238173 | Ga0105240_102381733 | 178 |
| 72 | 3300009098 | Ga0105245_10017141 | Ga0105245_100171413 | 178 |
| 73 | 3300009177 | Ga0105248_11321206 | Ga0105248_113212062 | 178 |
| 74 | 3300010375 | Ga0105239_10318472 | Ga0105239_103184722 | 178 |
| 75 | 3300013105 | Ga0157369_10020413 | Ga0157369_100204135 | 178 |
| 76 | 3300013296 | Ga0157374_10052605 | Ga0157374_100526055 | 178 |
| 77 | 3300013306 | Ga0163162_11180270 | Ga0163162_111802701 | 178 |
| 78 | 3300013306 | Ga0163162_12531272 | Ga0163162_125312721 | 178 |
| 79 | 3300013307 | Ga0157372_10950152 | Ga0157372_109501522 | 178 |
| 80 | 3300013308 | Ga0157375_11324299 | Ga0157375_113242991 | 178 |
| 81 | 3300014325 | Ga0163163_10177291 | Ga0163163_101772912 | 178 |
| 82 | 3300014326 | Ga0157380_10323423 | Ga0157380_103234232 | 178 |
| 83 | 3300014968 | Ga0157379_10000004 | Ga0157379_1000000484 | 178 |
| 84 | 3300025711 | Ga0207696_1000198 | Ga0207696_100019811 | 178 |
| 85 | 3300025728 | Ga0207655_1008135 | Ga0207655_10081357 | 178 |
| 86 | 3300025913 | Ga0207695_10357899 | Ga0207695_103578992 | 178 |
| 87 | 3300025917 | Ga0207660_10173601 | Ga0207660_101736012 | 178 |
| 88 | 3300025921 | Ga0207652_10294543 | Ga0207652_102945432 | 178 |
| 89 | 3300025924 | Ga0207694_10565985 | Ga0207694_105659852 | 178 |
| 90 | 3300025931 | Ga0207644_10073533 | Ga0207644_100735333 | 178 |
| 91 | 3300025938 | Ga0207704_10814776 | Ga0207704_108147761 | 178 |
| 92 | 3300025941 | Ga0207711_10821791 | Ga0207711_108217912 | 178 |
| 93 | 3300025945 | Ga0207679_10556678 | Ga0207679_105566782 | 178 |
| 94 | 3300025986 | Ga0207658_10310694 | Ga0207658_103106942 | 178 |
| 95 | 3300026023 | Ga0207677_10121510 | Ga0207677_101215102 | 178 |
| 96 | 3300026035 | Ga0207703_10361196 | Ga0207703_103611962 | 178 |
| 97 | 3300026035 | Ga0207703_11067382 | Ga0207703_110673822 | 178 |
| 98 | 3300027907 | Ga0207428_10006633 | Ga0207428_100066332 | 178 |
| 99 | 3300028800 | Ga0265338_10028372 | Ga0265338_100283722 | 178 |
| 100 | 3300031235 | Ga0265330_10006689 | Ga0265330_100066895 | 178 |
| 101 | 3300031241 | Ga0265325_10000866 | Ga0265325_100008662 | 178 |
| 102 | 3300031242 | Ga0265329_10010931 | Ga0265329_100109312 | 178 |
| 103 | 3300031247 | Ga0265340_10357674 | Ga0265340_103576741 | 178 |
| 104 | 3300031249 | Ga0265339_10008694 | Ga0265339_100086945 | 178 |
| 105 | 3300031250 | Ga0265331_10016697 | Ga0265331_100166975 | 178 |
| 106 | 3300031595 | Ga0265313_10000441 | Ga0265313_100004415 | 178 |
| 107 | 3300031711 | Ga0265314_10118234 | Ga0265314_101182342 | 178 |
| 108 | 3300031712 | Ga0265342_10012376 | Ga0265342_100123766 | 178 |
| 109 | 3300037466 | Ga0395898_0026035 | Ga0395898_0026035_4487_5035 | 178 |
| 110 | 3300037466 | Ga0395898_0544843 | Ga0395898_0544843_228_776 | 178 |
| 111 | 3300038443 | Ga0395901_0414679 | Ga0395901_0414679_704_1252 | 178 |
| 112 | 3300041491 | Ga0451833_0649033 | Ga0451833_0649033_179_730 | 178 |
| 113 | 3300041492 | Ga0451835_0789812 | Ga0451835_0789812_306_854 | 178 |
| 114 | 3300041511 | Ga0451855_1330784 | Ga0451855_1330784_27_575 | 178 |
| 115 | 3300041512 | Ga0451853_3887589 | Ga0451853_3887589_985_1533 | 178 |
| 116 | 3300042876 | Ga0451577_0275075 | Ga0451577_0275075_633_1181 | 178 |
| 117 | 3300044712 | Ga0453684_0178451 | Ga0453684_0178451_1500_2048 | 178 |
| 118 | 3300046458 | Ga0495591_008118 | Ga0495591_008118_526_1089 | 178 |
| 119 | 3300046501 | Ga0495607_0150383 | Ga0495607_0150383_477_1040 | 178 |
| 120 | 3300046507 | Ga0495606_0016805 | Ga0495606_0016805_56_619 | 178 |
| 121 | 3300046519 | Ga0495632_0028924 | Ga0495632_0028924_102_665 | 178 |
| 122 | 3300046520 | Ga0495637_0000801 | Ga0495637_0000801_5806_6369 | 178 |
| 123 | 3300046520 | Ga0495637_0000929 | Ga0495637_0000929_4988_5551 | 178 |
| 124 | 3300046526 | Ga0495666_0000223 | Ga0495666_0000223_5580_6143 | 178 |
| 125 | 3300046542 | Ga0495597_0006033 | Ga0495597_0006033_1720_2283 | 178 |
| 126 | 3300046675 | Ga0495657_0318193 | Ga0495657_0318193_332_880 | 178 |
| 127 | 3300046694 | Ga0495649_0001320 | Ga0495649_0001320_5047_5610 | 178 |
| 128 | 3300046810 | Ga0495660_0001190 | Ga0495660_0001190_4882_5445 | 178 |
| 129 | 3300047317 | Ga0495604_0033586 | Ga0495604_0033586_2863_3426 | 178 |
| 130 | 3300047322 | Ga0495680_0002585 | Ga0495680_0002585_12214_12777 | 178 |
| 131 | 3300047322 | Ga0495680_0791222 | Ga0495680_0791222_33_581 | 178 |
| 132 | 3300047446 | Ga0495679_001851 | Ga0495679_001851_9089_9655 | 178 |
| 133 | 3300047470 | Ga0495681_0000304 | Ga0495681_0000304_21783_22346 | 178 |
| 134 | 3300047471 | Ga0495684_0014354 | Ga0495684_0014354_2474_3037 | 178 |
| 135 | 3300048908 | Ga0496105_0065503 | Ga0496105_0065503_2144_2692 | 178 |
| 136 | 3300048911 | Ga0496108_0319228 | Ga0496108_0319228_170_718 | 178 |
| 137 | 3300048912 | Ga0496109_0448029 | Ga0496109_0448029_433_981 | 178 |
| 138 | 3300048913 | Ga0496110_0119376 | Ga0496110_0119376_357_905 | 178 |
| 139 | 3300049459 | Ga0495678_009803 | Ga0495678_009803_2252_2815 | 178 |
| 140 | 3300049580 | Ga0501046_0383802 | Ga0501046_0383802_35_583 | 178 |
| 141 | 3300050507 | nmdc:mga05p37_3119_c1 | nmdc:mga05p37_3119_c1_4279_4827 | 178 |
| 142 | 3300050508 | nmdc:mga09592_1540_c1 | nmdc:mga09592_1540_c1_11391_11939 | 178 |
| 143 | 3300050509 | nmdc:mga0qj67_228202_c1 | nmdc:mga0qj67_228202_c1_942_1490 | 178 |
| 144 | 3300050510 | nmdc:mga06r32_354_c1 | nmdc:mga06r32_354_c1_1194_1742 | 178 |
| 145 | 3300050511 | nmdc:mga08y16_2466_c1 | nmdc:mga08y16_2466_c1_9128_9676 | 178 |
| 146 | 3300050515 | nmdc:mga0a205_814154_c1 | nmdc:mga0a205_814154_c1_34_582 | 178 |
| 147 | 3300053090 | Ga0500646_0042865 | Ga0500646_0042865_687_1235 | 178 |
| 148 | 3300053139 | Ga0500568_0034053 | Ga0500568_0034053_281_829 | 178 |
| 149 | 3300053153 | Ga0500616_0017070 | Ga0500616_0017070_2684_3232 | 178 |
| 150 | 3300005456 | Ga0070678_100063705 | Ga0070678_1000637052 | 179 |
| 151 | 3300009093 | Ga0105240_10044246 | Ga0105240_100442462 | 179 |
| 152 | 3300009545 | Ga0105237_10050509 | Ga0105237_100505092 | 179 |
| 153 | 3300009551 | Ga0105238_10041904 | Ga0105238_100419042 | 179 |
| 154 | 3300025913 | Ga0207695_10539155 | Ga0207695_105391552 | 179 |
| 155 | 3300025914 | Ga0207671_10006366 | Ga0207671_1000636610 | 179 |
| 156 | 3300026121 | Ga0207683_10176640 | Ga0207683_101766402 | 179 |
| 157 | 3300031911 | Ga0307412_10545508 | Ga0307412_105455082 | 179 |
| 158 | 3300032002 | Ga0307416_100447595 | Ga0307416_1004475952 | 179 |
| 159 | 3300041410 | Ga0439461_0009399 | Ga0439461_0009399_1127_1690 | 179 |
| 160 | 3300041997 | Ga0439431_0001739 | Ga0439431_0001739_3123_3686 | 179 |
| 161 | 3300042116 | Ga0450912_013050 | Ga0450912_013050_68_631 | 179 |
| 162 | 3300042157 | Ga0439458_0020083 | Ga0439458_0020083_18_581 | 179 |
| 163 | 3300042435 | Ga0439434_0022630 | Ga0439434_0022630_371_934 | 179 |
| 164 | 3300044656 | Ga0466969_0000093 | Ga0466969_0000093_4877_5452 | 179 |
| 165 | 3300044684 | Ga0466966_0037967 | Ga0466966_0037967_547_1122 | 179 |
| 166 | 3300044693 | Ga0466961_0029750 | Ga0466961_0029750_2296_2871 | 179 |
| 167 | 3300044765 | Ga0466970_0205808 | Ga0466970_0205808_462_1037 | 179 |
| 168 | 3300045049 | Ga0466959_0073924 | Ga0466959_0073924_724_1299 | 179 |
| 169 | 3300045051 | Ga0451576_0048122 | Ga0451576_0048122_728_1300 | 179 |
| 170 | 3300061719 | Ga0466962_0161246 | Ga0466962_0161246_289_864 | 179 |
| 171 | 3300003322 | rootL2_10132796 | rootL2_101327962 | 180 |
| 172 | 3300003323 | rootH1_10051792 | rootH1_100517922 | 180 |
| 173 | 3300003323 | rootH1_10087560 | rootH1_100875602 | 180 |
| 174 | 3300005339 | Ga0070660_100904617 | Ga0070660_1009046171 | 180 |
| 175 | 3300005344 | Ga0070661_100605626 | Ga0070661_1006056262 | 180 |
| 176 | 3300005355 | Ga0070671_100140962 | Ga0070671_1001409623 | 180 |
| 177 | 3300005445 | Ga0070708_100755865 | Ga0070708_1007558652 | 180 |
| 178 | 3300005457 | Ga0070662_100054100 | Ga0070662_1000541002 | 180 |
| 179 | 3300005618 | Ga0068864_100139590 | Ga0068864_1001395903 | 180 |
| 180 | 3300005841 | Ga0068863_100223605 | Ga0068863_1002236052 | 180 |
| 181 | 3300006871 | Ga0075434_101084752 | Ga0075434_1010847522 | 180 |
| 182 | 3300009094 | Ga0111539_10010596 | Ga0111539_1001059610 | 180 |
| 183 | 3300009147 | Ga0114129_10035870 | Ga0114129_100358703 | 180 |
| 184 | 3300009147 | Ga0114129_10758835 | Ga0114129_107588352 | 180 |
| 185 | 3300009177 | Ga0105248_10008012 | Ga0105248_1000801210 | 180 |
| 186 | 3300025931 | Ga0207644_10035499 | Ga0207644_100354993 | 180 |
| 187 | 3300025933 | Ga0207706_10007872 | Ga0207706_100078724 | 180 |
| 188 | 3300025941 | Ga0207711_10014090 | Ga0207711_100140906 | 180 |
| 189 | 3300026088 | Ga0207641_10344705 | Ga0207641_103447052 | 180 |
| 190 | 3300026095 | Ga0207676_10149793 | Ga0207676_101497932 | 180 |
| 191 | 3300028794 | Ga0307515_10000011 | Ga0307515_10000011440 | 180 |
| 192 | 3300031731 | Ga0307405_10150418 | Ga0307405_101504182 | 180 |
| 193 | 3300031731 | Ga0307405_10616242 | Ga0307405_106162422 | 180 |
| 194 | 3300031852 | Ga0307410_10302151 | Ga0307410_103021512 | 180 |
| 195 | 3300031911 | Ga0307412_10981536 | Ga0307412_109815361 | 180 |
| 196 | 3300031995 | Ga0307409_100610879 | Ga0307409_1006108792 | 180 |
| 197 | 3300032002 | Ga0307416_100846018 | Ga0307416_1008460181 | 180 |
| 198 | 3300035112 | Ga0373932_0052126 | Ga0373932_0052126_171_722 | 180 |
| 199 | 3300035695 | Ga0373927_0110387 | Ga0373927_0110387_172_714 | 180 |
| 200 | 3300037466 | Ga0395898_0001226 | Ga0395898_0001226_23756_24325 | 180 |
| 201 | 3300037466 | Ga0395898_0004063 | Ga0395898_0004063_12870_13412 | 180 |
| 202 | 3300038443 | Ga0395901_0165476 | Ga0395901_0165476_1253_1795 | 180 |
| 203 | 3300042005 | Ga0439448_0126687 | Ga0439448_0126687_289_855 | 180 |
| 204 | 3300042011 | Ga0439454_022346 | Ga0439454_022346_276_827 | 180 |
| 205 | 3300042134 | Ga0450898_077028 | Ga0450898_077028_51_602 | 180 |
| 206 | 3300042156 | Ga0439446_0038170 | Ga0439446_0038170_159_710 | 180 |
| 207 | 3300042876 | Ga0451577_0011170 | Ga0451577_0011170_5648_6232 | 180 |
| 208 | 3300042876 | Ga0451577_0263418 | Ga0451577_0263418_284_832 | 180 |
| 209 | 3300044658 | Ga0466972_0000433 | Ga0466972_0000433_1936_2532 | 180 |
| 210 | 3300044684 | Ga0466966_0073078 | Ga0466966_0073078_589_1167 | 180 |
| 211 | 3300044684 | Ga0466966_0092113 | Ga0466966_0092113_1106_1672 | 180 |
| 212 | 3300044693 | Ga0466961_0054294 | Ga0466961_0054294_1049_1627 | 180 |
| 213 | 3300044693 | Ga0466961_0249984 | Ga0466961_0249984_284_880 | 180 |
| 214 | 3300044694 | Ga0466963_0079641 | Ga0466963_0079641_649_1227 | 180 |
| 215 | 3300044706 | Ga0466964_0015364 | Ga0466964_0015364_2218_2796 | 180 |
| 216 | 3300044706 | Ga0466964_0145733 | Ga0466964_0145733_156_722 | 180 |
| 217 | 3300044712 | Ga0453684_0147945 | Ga0453684_0147945_875_1456 | 180 |
| 218 | 3300044735 | Ga0466968_0041959 | Ga0466968_0041959_1170_1736 | 180 |
| 219 | 3300045049 | Ga0466959_0000027 | Ga0466959_0000027_87331_87909 | 180 |
| 220 | 3300045836 | Ga0466958_0025546 | Ga0466958_0025546_589_1167 | 180 |
| 221 | 3300045976 | Ga0466967_0057250 | Ga0466967_0057250_716_1294 | 180 |
| 222 | 3300046506 | Ga0495583_0000173 | Ga0495583_0000173_65705_66247 | 180 |
| 223 | 3300046507 | Ga0495606_0008230 | Ga0495606_0008230_2188_2730 | 180 |
| 224 | 3300046616 | Ga0495668_0057933 | Ga0495668_0057933_951_1493 | 180 |
| 225 | 3300046660 | Ga0495625_0009443 | Ga0495625_0009443_3937_4479 | 180 |
| 226 | 3300046694 | Ga0495649_0000136 | Ga0495649_0000136_20781_21323 | 180 |
| 227 | 3300046794 | Ga0495589_0002209 | Ga0495589_0002209_1403_1945 | 180 |
| 228 | 3300048904 | Ga0496101_0570497 | Ga0496101_0570497_48_620 | 180 |
| 229 | 3300048907 | Ga0496104_0170143 | Ga0496104_0170143_963_1535 | 180 |
| 230 | 3300048908 | Ga0496105_0052949 | Ga0496105_0052949_543_1115 | 180 |
| 231 | 3300048911 | Ga0496108_0119725 | Ga0496108_0119725_992_1564 | 180 |
| 232 | 3300048912 | Ga0496109_0110549 | Ga0496109_0110549_1940_2512 | 180 |
| 233 | 3300048913 | Ga0496110_0625956 | Ga0496110_0625956_87_635 | 180 |
| 234 | 3300048915 | Ga0496112_0006393 | Ga0496112_0006393_4051_4623 | 180 |
| 235 | 3300048916 | Ga0496113_0079999 | Ga0496113_0079999_815_1387 | 180 |
| 236 | 3300050512 | nmdc:mga0n895_835911_c1 | nmdc:mga0n895_835911_c1_196_762 | 180 |
| 237 | 3300053086 | Ga0500578_0121059 | Ga0500578_0121059_13_555 | 180 |
| 238 | 3300053122 | Ga0500608_058988 | Ga0500608_058988_492_1034 | 180 |
| 239 | 3300053147 | Ga0500589_064873 | Ga0500589_064873_699_1241 | 180 |
| 240 | 3300053148 | Ga0500590_002480 | Ga0500590_002480_7368_7931 | 180 |
| 241 | 3300055283 | Ga0500661_002687 | Ga0500661_002687_386_928 | 180 |
| 242 | 3300035114 | Ga0373939_0000219 | Ga0373939_0000219_163_720 | 181 |
| 243 | 3300035121 | Ga0373960_0004077 | Ga0373960_0004077_173_730 | 181 |
| 244 | 3300035242 | Ga0373962_0024580 | Ga0373962_0024580_86_643 | 181 |
| 245 | 3300035691 | Ga0373931_0000827 | Ga0373931_0000827_151_708 | 181 |
| 246 | 3300002705 | JGI25156J39149_1009314 | JGI25156J39149_10093143 | 182 |
| 247 | 3300003322 | rootL2_10063119 | rootL2_100631198 | 182 |
| 248 | 3300025256 | Ga0209759_1010559 | Ga0209759_10105592 | 182 |
| 249 | 3300030521 | Ga0307511_10048354 | Ga0307511_100483542 | 182 |
| 250 | 3300045051 | Ga0451576_0346044 | Ga0451576_0346044_570_1133 | 182 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dzt-assembly1.cif.gz_B | rmlc from salmonella typhimurium | 0.9855 | 3 | 178 |
| 2ixk-assembly1.cif.gz_B | rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) | 0.9806 | 1 | 180 |
| 6din-assembly1.cif.gz_A-2 | high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase | 0.9804 | 2 | 182 |
| 2ixh-assembly1.cif.gz_A | rmlc p aeruginosa with dtdp-rhamnose | 0.9799 | 1 | 182 |
| 1upi-assembly1.cif.gz_A | mycobacterium tuberculosis rmlc epimerase (rv3465) | 0.9748 | 4 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6dinA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9766 | 1 | 182 | 2.60.120.10 |
| 2ixcB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.974 | 4 | 180 | 2.60.120.10 |
| 2c0zA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9713 | 4 | 180 | 2.60.120.10 |
| 5buvB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9598 | 1 | 177 | 2.60.120.10 |
| 1epzA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9506 | 3 | 180 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2A2I1K6-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9953 | 4 | 179 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A630SW49-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9952 | 4 | 145 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A192C831-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9941 | 4 | 152 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A3C0JH15-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9932 | 4 | 157 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-T1X4U2-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9931 | 4 | 180 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar