F360964

General Info

Members Datasets Scaffolds Average Seq Length
249 187 498 159

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0054689|Ga0466970_0054689_536_1069
Length 177
Sequence MPKQTFVLNGKTVTVDVHDDVRVLWVLRDLLGVTGPKYGCGINVCKACTSHINGKAFNPCSVRVGDLKADDEVTTIEGLPKEWKKQRREERGDRDQDDRRRKGALHPMQQAWLDHDVAQCGYCQPGQIMAAVALVNKVRREGRKIREKDLDAIRNICRCGTYTRIREAIEQGARQMR

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
73 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
76 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
98 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
99 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
100 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
101 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
117 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
121 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
157 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
158 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
161 2643221561 Nocardioides sp. Root151 Isolate Unclassified
162 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
163 2643221576 Nocardioides sp. Root614 Isolate Unclassified
164 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
165 2643221590 Nocardioides sp. Root682 Isolate Unclassified
166 2643221617 Nocardioides sp. Root79 Isolate Unclassified
167 2643221620 Nocardioides sp. Root240 Isolate Unclassified
168 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
169 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
170 2643221696 Nocardioides sp. Root140 Isolate Unclassified
171 2643221711 Terrabacter sp. Root85 Isolate Unclassified
172 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
173 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
174 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
175 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
176 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
177 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
178 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
179 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
180 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
181 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
182 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
183 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
184 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
185 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
186 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
187 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.74
Metatranscriptomes 2.81
Isolates 12.45

Biome Distribution

Category Percentage (%)
Aerial Root 1.2
Bulb 0
Endosphere 9.24
Nodule 0
Rhizoplane 4.82
Rhizosphere 73.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0054689 3300044765 Bacteria 2132
2 LJQas_1019691 3300000549 Bacteria 785
3 JGI25406J46586_10000526 3300003203 Bacteria 17888
4 JGI25406J46586_10005325 3300003203 Bacteria 5969
5 Ga0058863_11602952 3300004799 Bacteria 4783
6 Ga0070658_10735236 3300005327 Bacteria 857
7 Ga0070683_100057401 3300005329 Bacteria 3616
8 Ga0070683_100142089 3300005329 Bacteria 2274
9 Ga0070680_100027306 3300005336 Bacteria 4571
10 Ga0070680_100234845 3300005336 Bacteria 1549
11 Ga0070682_100056376 3300005337 Bacteria 2471
12 Ga0070660_100003114 3300005339 Bacteria 11388
13 Ga0070691_10286712 3300005341 Bacteria 895
14 Ga0070661_100117953 3300005344 Bacteria 1986
15 Ga0070661_101212881 3300005344 Bacteria 631
16 Ga0070692_10083685 3300005345 Bacteria 1723
17 Ga0070659_100020179 3300005366 Bacteria 5060
18 Ga0070667_100421931 3300005367 Bacteria 1216
19 Ga0070714_100982032 3300005435 Bacteria 821
20 Ga0070700_100685419 3300005441 Bacteria 813
21 Ga0070681_10046151 3300005458 Bacteria 4357
22 Ga0070681_10051675 3300005458 Bacteria 4099
23 Ga0070681_10150048 3300005458 Bacteria 2258
24 Ga0070679_100011414 3300005530 Bacteria 8465
25 Ga0070679_100199651 3300005530 Bacteria 1967
26 Ga0070684_100023082 3300005535 Bacteria 5196
27 Ga0070684_100047200 3300005535 Bacteria 3732
28 Ga0070684_100524398 3300005535 Bacteria 1098
29 Ga0068853_100227848 3300005539 Bacteria 1704
30 Ga0070693_100178715 3300005547 Bacteria 1365
31 Ga0070665_100736635 3300005548 Bacteria 999
32 Ga0068855_100420534 3300005563 Bacteria 1462
33 Ga0070664_100055843 3300005564 Bacteria 3355
34 Ga0070664_100084380 3300005564 Bacteria 2742
35 Ga0068857_100051855 3300005577 Bacteria 3641
36 Ga0068857_101228622 3300005577 Bacteria 726
37 Ga0068856_100031317 3300005614 Bacteria 5203
38 Ga0068856_100241450 3300005614 Bacteria 1822
39 Ga0068852_100025866 3300005616 Bacteria 4762
40 Ga0068852_101139057 3300005616 Bacteria 801
41 Ga0068860_100001165 3300005843 Bacteria 28787
42 Ga0081539_10000183 3300005985 Bacteria 148051
43 Ga0081539_10001638 3300005985 Bacteria 36478
44 Ga0075365_10028042 3300006038 Bacteria 3588
45 Ga0075365_10077152 3300006038 Bacteria 2251
46 Ga0075365_10250141 3300006038 Bacteria 1245
47 Ga0075365_10441201 3300006038 Bacteria 919
48 Ga0075368_10000452 3300006042 Bacteria 12112
49 Ga0075363_100042273 3300006048 Bacteria 2407
50 Ga0075363_100065379 3300006048 Bacteria 1966
51 Ga0075363_100672347 3300006048 Bacteria 624
52 Ga0075364_10048922 3300006051 Bacteria 2756
53 Ga0075367_10002191 3300006178 Bacteria 8806
54 Ga0075370_10060080 3300006353 Bacteria 2165
55 Ga0105240_10040788 3300009093 Bacteria 5932
56 Ga0105245_10278930 3300009098 Bacteria 1633
57 Ga0105245_10582299 3300009098 Bacteria 1144
58 Ga0105243_11124104 3300009148 Bacteria 795
59 Ga0105243_11985038 3300009148 Bacteria 616
60 Ga0105238_10027093 3300009551 Bacteria 5841
61 Ga0105239_10108790 3300010375 Bacteria 3071
62 Ga0105239_11311689 3300010375 Bacteria 835
63 Ga0105239_12417485 3300010375 Bacteria 612
64 Ga0157373_10467982 3300013100 Bacteria 908
65 Ga0157371_10119054 3300013102 Bacteria 1877
66 Ga0157370_10043839 3300013104 Bacteria 4303
67 Ga0157370_10062807 3300013104 Bacteria 3522
68 Ga0157369_10033419 3300013105 Bacteria 5653
69 Ga0157369_10616319 3300013105 Bacteria 1120
70 Ga0157369_11399522 3300013105 Bacteria 712
71 Ga0157369_11528190 3300013105 Bacteria 679
72 Ga0157372_10028877 3300013307 Bacteria 6053
73 Ga0163163_10961040 3300014325 Bacteria 918
74 Ga0163163_11400521 3300014325 Bacteria 761
75 Ga0206356_10821666 3300020070 Bacteria 1593
76 Ga0206356_11558753 3300020070 Bacteria 1924
77 Ga0206351_10809484 3300020077 Bacteria 3071
78 Ga0206353_11681349 3300020082 Bacteria 728
79 Ga0206353_11985878 3300020082 Bacteria 3672
80 Ga0213876_10485346 3300021384 Bacteria 657
81 Ga0224712_10279361 3300022467 Bacteria 777
82 Ga0207705_10365535 3300025909 Bacteria 1113
83 Ga0207707_10205318 3300025912 Bacteria 1717
84 Ga0207707_10389318 3300025912 Bacteria 1198
85 Ga0207695_10482447 3300025913 Bacteria 1122
86 Ga0207660_10035740 3300025917 Bacteria 3451
87 Ga0207657_10007214 3300025919 Bacteria 11414
88 Ga0207649_10023667 3300025920 Bacteria 3560
89 Ga0207652_10140385 3300025921 Bacteria 2160
90 Ga0207694_10074022 3300025924 Bacteria 2666
91 Ga0207687_10429290 3300025927 Bacteria 1092
92 Ga0207690_10064734 3300025932 Bacteria 2497
93 Ga0207709_10298336 3300025935 Bacteria 1197
94 Ga0207661_10031604 3300025944 Bacteria 4092
95 Ga0207679_10109760 3300025945 Bacteria 2175
96 Ga0207667_10356958 3300025949 Bacteria 1490
97 Ga0207658_10364607 3300025986 Bacteria 1261
98 Ga0207708_10249824 3300026075 Bacteria 1429
99 Ga0207702_10158590 3300026078 Bacteria 2065
100 Ga0207698_10014439 3300026142 Bacteria 5250
101 Ga0207698_11663372 3300026142 Bacteria 654
102 Ga0209981_1018465 3300027378 Bacteria 988
103 Ga0209998_10070683 3300027717 Bacteria 834
104 Ga0209813_10036577 3300027866 Bacteria 1476
105 Ga0209813_10442861 3300027866 Bacteria 530
106 Ga0209974_10342011 3300027876 Bacteria 579
107 Ga0268264_10001735 3300028381 Bacteria 20047
108 Ga0314311_1098554 3300030733 Bacteria 1232
109 Ga0316181_1232856 3300030744 Bacteria 857
110 Ga0307513_10107623 3300031456 Bacteria 2791
111 Ga0307513_10181188 3300031456 Bacteria 1970
112 Ga0307408_100809629 3300031548 Bacteria 851
113 Ga0307413_10065962 3300031824 Bacteria 2257
114 Ga0307410_10589884 3300031852 Bacteria 926
115 Ga0326468_10009482 3300031889 Bacteria 966
116 Ga0307406_10558297 3300031901 Bacteria 938
117 Ga0307407_10503448 3300031903 Bacteria 888
118 Ga0307412_10183168 3300031911 Bacteria 1577
119 Ga0307409_100150418 3300031995 Bacteria 2020
120 Ga0307416_100296929 3300032002 Bacteria 1603
121 Ga0307414_10285428 3300032004 Bacteria 1389
122 Ga0307411_10252835 3300032005 Bacteria 1387
123 Ga0307415_100378111 3300032126 Bacteria 1202
124 Ga0307415_100725975 3300032126 Bacteria 899
125 Ga0373937_1100597 3300036401 Bacteria 743
126 Ga0395899_0767220 3300037312 Bacteria 599
127 Ga0395900_0088573 3300037418 Bacteria 3182
128 Ga0395900_1030588 3300037418 Bacteria 742
129 Ga0395900_1053922 3300037418 Bacteria 731
130 Ga0395898_0394801 3300037466 Bacteria 1319
131 Ga0395905_0134002 3300037471 Bacteria 2330
132 Ga0395905_0403010 3300037471 Bacteria 1263
133 Ga0395901_0026601 3300038443 Bacteria 5941
134 Ga0395901_0568133 3300038443 Bacteria 1147
135 Ga0436365_0254647 3300039437 Bacteria 860
136 Ga0451789_0620737 3300041443 Bacteria 839
137 Ga0451807_1494091 3300041486 Bacteria 701
138 Ga0439445_0092883 3300042004 Bacteria 851
139 Ga0439457_046542 3300042014 Bacteria 971
140 Ga0439434_0002406 3300042435 Bacteria 5436
141 Ga0439434_0024580 3300042435 Bacteria 1818
142 Ga0466969_0089217 3300044656 Bacteria 1463
143 Ga0466972_0134587 3300044658 Bacteria 1164
144 Ga0466966_0666554 3300044684 Bacteria 627
145 Ga0466961_0043363 3300044693 Bacteria 2882
146 Ga0466961_0096197 3300044693 Bacteria 1867
147 Ga0466963_0242919 3300044694 Bacteria 1263
148 Ga0466963_0720430 3300044694 Bacteria 704
149 Ga0466964_0289103 3300044706 Bacteria 822
150 Ga0466970_0001467 3300044765 Bacteria 11385
151 Ga0466970_0027332 3300044765 Bacteria 2994
152 Ga0466957_0052691 3300044842 Bacteria 2478
153 Ga0466957_0118716 3300044842 Bacteria 1684
154 Ga0466957_0142673 3300044842 Bacteria 1544
155 Ga0466960_0017368 3300044901 Bacteria 3136
156 Ga0466958_0624831 3300045836 Bacteria 701
157 Ga0466967_0058612 3300045976 Bacteria 3404
158 Ga0466967_0463051 3300045976 Bacteria 1240
159 Ga0466967_1295779 3300045976 Bacteria 726
160 Ga0495645_0790105 3300046543 Bacteria 570
161 Ga0495634_0269281 3300046642 Bacteria 1037
162 Ga0495646_0100030 3300046680 Bacteria 1664
163 Ga0495624_0099445 3300046690 Bacteria 1791
164 Ga0495581_0437229 3300047315 Bacteria 762
165 Ga0495636_0213868 3300047318 Bacteria 883
166 Ga0495672_0394950 3300047320 Bacteria 634
167 Ga0495676_0246017 3300047321 Bacteria 1222
168 Ga0495685_059323 3300047447 Bacteria 1291
169 Ga0495614_0006523 3300048089 Bacteria 5234
170 Ga0496100_0395607 3300048903 Bacteria 1051
171 Ga0496101_0005119 3300048904 Bacteria 8334
172 Ga0496102_0339225 3300048905 Bacteria 1415
173 Ga0496105_0002398 3300048908 Bacteria 13561
174 Ga0496107_0308205 3300048910 Bacteria 1178
175 Ga0496108_0596965 3300048911 Bacteria 962
176 Ga0496109_0336341 3300048912 Bacteria 1426
177 Ga0496111_0567671 3300048914 Bacteria 832
178 Ga0496113_0615834 3300048916 Bacteria 869
179 Ga0496114_0070131 3300048917 Bacteria 2943
180 Ga0501031_0076178 3300049568 Bacteria 2184
181 Ga0501032_0255519 3300049569 Bacteria 1137
182 Ga0501034_0194438 3300049571 Bacteria 1990
183 Ga0501036_0095855 3300049572 Bacteria 2508
184 Ga0501036_1315556 3300049572 Bacteria 587
185 Ga0501038_0267346 3300049574 Bacteria 1349
186 Ga0501039_0027785 3300049575 Bacteria 4351
187 Ga0501041_0183719 3300049577 Bacteria 1309
188 Ga0501047_0056964 3300049581 Bacteria 3780
189 Ga0501067_0001269 3300049583 Bacteria 13734
190 Ga0501067_0064991 3300049583 Bacteria 2020
191 Ga0501067_0088497 3300049583 Bacteria 1719
192 Ga0501068_0017045 3300049584 Bacteria 4198
193 Ga0501068_0679617 3300049584 Bacteria 673
194 Ga0501069_0059469 3300049585 Bacteria 2132
195 Ga0501069_0073221 3300049585 Bacteria 1921
196 Ga0501069_0679684 3300049585 Bacteria 620
197 Ga0501070_0057952 3300049586 Bacteria 3211
198 Ga0501070_0126035 3300049586 Bacteria 2116
199 Ga0501070_0509236 3300049586 Bacteria 966
200 Ga0501070_0579020 3300049586 Bacteria 896
201 Ga0501071_0383973 3300049587 Bacteria 1071
202 Ga0501072_0064853 3300049588 Bacteria 2880
203 Ga0501074_0108018 3300049590 Bacteria 1992
204 Ga0501076_0036851 3300049592 Bacteria 3834
205 Ga0501080_0001119 3300049742 Bacteria 22084
206 Ga0501080_0027119 3300049742 Bacteria 5327
207 Ga0501045_0444913 3300049824 Bacteria 963
208 nmdc:mga03n38_32751_c1 3300050490 Bacteria 2205
209 nmdc:mga00v17_227825_c1 3300050491 Bacteria 1207
210 nmdc:mga0yw44_12480_c1 3300050492 Bacteria 4431
211 nmdc:mga0yw44_809018_c1 3300050492 Bacteria 636
212 nmdc:mga06z11_46254_c1 3300050494 Bacteria 2205
213 nmdc:mga04h51_480567_c1 3300050495 Bacteria 529
214 nmdc:mga07m45_157252_c1 3300050496 Bacteria 1319
215 Ga0500644_0058231 3300053088 Bacteria 1351
216 Ga0500641_0066669 3300053096 Bacteria 1508
217 Ga0500655_126194 3300053133 Bacteria 545
218 Ga0501084_0254838 3300054114 Bacteria 1481
219 2616692932 2616644814 Bacteria 11555299
220 2643827219 2643221561 Bacteria 4984412
221 2643853079 2643221567 Bacteria 4163945
222 2643891357 2643221576 Bacteria 5214352
223 2643947117 2643221587 Bacteria 7586415
224 2643960405 2643221590 Bacteria 5214697
225 2644102042 2643221617 Bacteria 5139111
226 2644115265 2643221620 Bacteria 5134593
227 2644135568 2643221624 Bacteria 4384879
228 2644433412 2643221677 Bacteria 7584031
229 2644533954 2643221696 Bacteria 5431823
230 2644609361 2643221711 Bacteria 4865335
231 2774392434 2773857762 Bacteria 5971770
232 2774392899 2773857762 Bacteria 5971770
233 2774397211 2773857762 Bacteria 5971770
234 2795783084 2795385470 Bacteria 8317180
235 2809196221 2808606439 Bacteria 5952208
236 2809196428 2808606439 Bacteria 5952208
237 2812331510 2811994874 Bacteria 5367947
238 2812351621 2811994878 Bacteria 5992952
239 2816511029 2816332139 Bacteria 9138787
240 2819666196 2818991458 Bacteria 4794049
241 2866553554 2866552031 Bacteria 5824618
242 2870786814 2870782633 Bacteria 9624083
243 2891970774 2891968417 Bacteria 5821697
244 2918501746 2918501144 Bacteria 8668083
245 2984577767 2984576629 Bacteria 4248407
246 2984595358 2984592036 Bacteria 3670284
247 2990260534 2990256926 Bacteria 4252839
248 8033685823 8033684223 Bacteria 6906479
249 8054472346 8054472261 Bacteria 7464355
250 Ga0466970_0054689
251 LJQas_1019691
252 JGI25406J46586_10000526
253 JGI25406J46586_10005325
254 Ga0058863_11602952
255 Ga0070658_10735236
256 Ga0070683_100057401
257 Ga0070683_100142089
258 Ga0070680_100027306
259 Ga0070680_100234845
260 Ga0070682_100056376
261 Ga0070660_100003114
262 Ga0070691_10286712
263 Ga0070661_100117953
264 Ga0070661_101212881
265 Ga0070692_10083685
266 Ga0070659_100020179
267 Ga0070667_100421931
268 Ga0070714_100982032
269 Ga0070700_100685419
270 Ga0070681_10046151
271 Ga0070681_10051675
272 Ga0070681_10150048
273 Ga0070679_100011414
274 Ga0070679_100199651
275 Ga0070684_100023082
276 Ga0070684_100047200
277 Ga0070684_100524398
278 Ga0068853_100227848
279 Ga0070693_100178715
280 Ga0070665_100736635
281 Ga0068855_100420534
282 Ga0070664_100055843
283 Ga0070664_100084380
284 Ga0068857_100051855
285 Ga0068857_101228622
286 Ga0068856_100031317
287 Ga0068856_100241450
288 Ga0068852_100025866
289 Ga0068852_101139057
290 Ga0068860_100001165
291 Ga0081539_10000183
292 Ga0081539_10001638
293 Ga0075365_10028042
294 Ga0075365_10077152
295 Ga0075365_10250141
296 Ga0075365_10441201
297 Ga0075368_10000452
298 Ga0075363_100042273
299 Ga0075363_100065379
300 Ga0075363_100672347
301 Ga0075364_10048922
302 Ga0075367_10002191
303 Ga0075370_10060080
304 Ga0105240_10040788
305 Ga0105245_10278930
306 Ga0105245_10582299
307 Ga0105243_11124104
308 Ga0105243_11985038
309 Ga0105238_10027093
310 Ga0105239_10108790
311 Ga0105239_11311689
312 Ga0105239_12417485
313 Ga0157373_10467982
314 Ga0157371_10119054
315 Ga0157370_10043839
316 Ga0157370_10062807
317 Ga0157369_10033419
318 Ga0157369_10616319
319 Ga0157369_11399522
320 Ga0157369_11528190
321 Ga0157372_10028877
322 Ga0163163_10961040
323 Ga0163163_11400521
324 Ga0206356_10821666
325 Ga0206356_11558753
326 Ga0206351_10809484
327 Ga0206353_11681349
328 Ga0206353_11985878
329 Ga0213876_10485346
330 Ga0224712_10279361
331 Ga0207705_10365535
332 Ga0207707_10205318
333 Ga0207707_10389318
334 Ga0207695_10482447
335 Ga0207660_10035740
336 Ga0207657_10007214
337 Ga0207649_10023667
338 Ga0207652_10140385
339 Ga0207694_10074022
340 Ga0207687_10429290
341 Ga0207690_10064734
342 Ga0207709_10298336
343 Ga0207661_10031604
344 Ga0207679_10109760
345 Ga0207667_10356958
346 Ga0207658_10364607
347 Ga0207708_10249824
348 Ga0207702_10158590
349 Ga0207698_10014439
350 Ga0207698_11663372
351 Ga0209981_1018465
352 Ga0209998_10070683
353 Ga0209813_10036577
354 Ga0209813_10442861
355 Ga0209974_10342011
356 Ga0268264_10001735
357 Ga0314311_1098554
358 Ga0316181_1232856
359 Ga0307513_10107623
360 Ga0307513_10181188
361 Ga0307408_100809629
362 Ga0307413_10065962
363 Ga0307410_10589884
364 Ga0326468_10009482
365 Ga0307406_10558297
366 Ga0307407_10503448
367 Ga0307412_10183168
368 Ga0307409_100150418
369 Ga0307416_100296929
370 Ga0307414_10285428
371 Ga0307411_10252835
372 Ga0307415_100378111
373 Ga0307415_100725975
374 Ga0373937_1100597
375 Ga0395899_0767220
376 Ga0395900_0088573
377 Ga0395900_1030588
378 Ga0395900_1053922
379 Ga0395898_0394801
380 Ga0395905_0134002
381 Ga0395905_0403010
382 Ga0395901_0026601
383 Ga0395901_0568133
384 Ga0436365_0254647
385 Ga0451789_0620737
386 Ga0451807_1494091
387 Ga0439445_0092883
388 Ga0439457_046542
389 Ga0439434_0002406
390 Ga0439434_0024580
391 Ga0466969_0089217
392 Ga0466972_0134587
393 Ga0466966_0666554
394 Ga0466961_0043363
395 Ga0466961_0096197
396 Ga0466963_0242919
397 Ga0466963_0720430
398 Ga0466964_0289103
399 Ga0466970_0001467
400 Ga0466970_0027332
401 Ga0466957_0052691
402 Ga0466957_0118716
403 Ga0466957_0142673
404 Ga0466960_0017368
405 Ga0466958_0624831
406 Ga0466967_0058612
407 Ga0466967_0463051
408 Ga0466967_1295779
409 Ga0495645_0790105
410 Ga0495634_0269281
411 Ga0495646_0100030
412 Ga0495624_0099445
413 Ga0495581_0437229
414 Ga0495636_0213868
415 Ga0495672_0394950
416 Ga0495676_0246017
417 Ga0495685_059323
418 Ga0495614_0006523
419 Ga0496100_0395607
420 Ga0496101_0005119
421 Ga0496102_0339225
422 Ga0496105_0002398
423 Ga0496107_0308205
424 Ga0496108_0596965
425 Ga0496109_0336341
426 Ga0496111_0567671
427 Ga0496113_0615834
428 Ga0496114_0070131
429 Ga0501031_0076178
430 Ga0501032_0255519
431 Ga0501034_0194438
432 Ga0501036_0095855
433 Ga0501036_1315556
434 Ga0501038_0267346
435 Ga0501039_0027785
436 Ga0501041_0183719
437 Ga0501047_0056964
438 Ga0501067_0001269
439 Ga0501067_0064991
440 Ga0501067_0088497
441 Ga0501068_0017045
442 Ga0501068_0679617
443 Ga0501069_0059469
444 Ga0501069_0073221
445 Ga0501069_0679684
446 Ga0501070_0057952
447 Ga0501070_0126035
448 Ga0501070_0509236
449 Ga0501070_0579020
450 Ga0501071_0383973
451 Ga0501072_0064853
452 Ga0501074_0108018
453 Ga0501076_0036851
454 Ga0501080_0001119
455 Ga0501080_0027119
456 Ga0501045_0444913
457 nmdc:mga03n38_32751_c1
458 nmdc:mga00v17_227825_c1
459 nmdc:mga0yw44_12480_c1
460 nmdc:mga0yw44_809018_c1
461 nmdc:mga06z11_46254_c1
462 nmdc:mga04h51_480567_c1
463 nmdc:mga07m45_157252_c1
464 Ga0500644_0058231
465 Ga0500641_0066669
466 Ga0500655_126194
467 Ga0501084_0254838
468 2616692932
469 2643827219
470 2643853079
471 2643891357
472 2643947117
473 2643960405
474 2644102042
475 2644115265
476 2644135568
477 2644433412
478 2644533954
479 2644609361
480 2774392434
481 2774392899
482 2774397211
483 2795783084
484 2809196221
485 2809196428
486 2812331510
487 2812351621
488 2816511029
489 2819666196
490 2866553554
491 2870786814
492 2891970774
493 2918501746
494 2984577767
495 2984595358
496 2990260534
497 8033685823
498 8054472346

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

6

78

0.82

PF01799

Fer2_2

[2Fe-2S] binding domain

94

170

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9123 2 155
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9091 2 155
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9061 2 156
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9056 3 155
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.895 1 155
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.936 2 77 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9345 2 75 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9269 2 77 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9216 1 77 3.10.20.30
1alo001 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9131 1 74 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A2C8WZ40-F1-model_v4 deleted 0.9688 1 156
AF-A0A1I6SDU1-F1-model_v4 Isoquinoline 1-oxidoreductase, alpha subunit 0.9684 1 156 GO:0016903
GO:0046872
GO:0051537
AF-A0A2T0M0E3-F1-model_v4 Isoquinoline 1-oxidoreductase alpha subunit 0.9679 1 156 GO:0016903
GO:0046872
GO:0051537
AF-A0A840NDH4-F1-model_v4 Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) 0.9677 1 156 GO:0016491
GO:0046872
GO:0051536
AF-A0A5N0UTQ5-F1-model_v4 (2Fe-2S)-binding protein 0.9677 1 156 GO:0016491
GO:0046872
GO:0051536

Map