F360756

General Info

Members Datasets Scaffolds Average Seq Length
249 137 498 409

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10323880|Ga0157372_103238802
Length 455
Sequence LIPHKVHSIFSDDFRLTLISLGNSSKYDNSPYWTIPTLNLLLFETMRILYINHYAGSPRYGMEYRPYYLAREWVRMGNDVHIIGSSQSHIRSRQPQLAGQHRLDETIDGVQYTWFQTPKYSGNGIGRVRNMASFVSRLCFESKRIATSFNPDVVIASSTYPMDIWPAHRIAKMAGAKLVFEIHDLWPLTPMELGGMSRWHPFIMVLQAAEDDAYRHADTIASMLPKVHDYVESRGASRARLHIVPNGVDPCEWAAGGAELQPNVEVTLSAIRDAGNFVIGYAGTHGVSNSLHTLLDAAALMRDEKVAFVLVGGGPEKTGLQRRAQLEQSQNVHFIDLIAKEQIPALLRRFDIAYIGWQRQSLYRFGIAPNKLMDYMMAARPVLHAVEAGNDPVGEAGCGLTVAPENPAVVAQGIRNLLALSPADRQAMGLRGKRFVMNNHTYPILSERFLAACCS

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
16 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
17 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
22 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
23 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
24 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
30 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
31 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
32 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
33 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
34 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
35 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
36 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
37 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
38 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
39 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
40 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
41 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
42 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
43 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
44 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
45 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
46 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
47 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
48 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
49 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
50 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
51 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
52 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
55 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
56 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
57 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
58 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
59 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
60 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
61 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
62 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
63 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
64 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
65 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
66 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
67 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
68 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
69 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
70 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
71 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
72 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
73 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
74 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
75 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
76 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
77 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
78 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
79 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
80 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
81 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
82 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
83 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
84 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
85 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
86 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
87 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
88 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
89 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
92 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
93 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
94 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
95 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
96 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
97 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
103 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
104 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
105 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
106 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
107 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
108 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
109 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
110 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
111 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
112 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
119 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
124 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
125 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
128 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
129 2643221556 Massilia sp. Root1485 Isolate Unclassified
130 2643221684 Massilia sp. Root133 Isolate Unclassified
131 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
132 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
133 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
134 2857553236 Duganella sp. R-74557 Isolate Unclassified
135 2919476304 Duganella sp. 3397 Isolate Unclassified
136 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
137 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.98
Metatranscriptomes 1.61
Isolates 4.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.8
Rhizoplane 3.21
Rhizosphere 90.76
Stem 0
Stem Tuber 0
Unclassified 4.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10323880 3300013307 Bacteria 1794
2 rootL2_10008121 3300003322 Bacteria 27005
3 rootL2_10023350 3300003322 Bacteria 20853
4 Ga0007410J51695_1051508 3300003574 Bacteria 3919
5 Ga0007409J51694_1010661 3300003575 Bacteria 7598
6 Ga0007416J51690_1008758 3300003577 Bacteria 11267
7 Ga0032354_1014295 3300003693 Bacteria 10928
8 Ga0070658_10014967 3300005327 Bacteria 6209
9 Ga0070659_100008224 3300005366 Bacteria 7618
10 Ga0070707_100164770 3300005468 Unclassified 2160
11 Ga0070699_100006305 3300005518 Bacteria 10347
12 Ga0070665_100172121 3300005548 Bacteria 2166
13 Ga0068855_100029331 3300005563 Bacteria 6579
14 Ga0068852_100045428 3300005616 Bacteria 3736
15 Ga0068860_100119314 3300005843 Bacteria 2525
16 Ga0075434_100185119 3300006871 Unclassified 2103
17 Ga0079104_1005913 3300006946 Bacteria 4755
18 Ga0105244_10058737 3300009036 Bacteria 1940
19 Ga0114129_10172023 3300009147 Unclassified 2952
20 Ga0105241_10009473 3300009174 Bacteria 7155
21 Ga0105242_10001583 3300009176 Bacteria 17891
22 Ga0157372_10021117 3300013307 Bacteria 7032
23 Ga0182006_1000029 3300015261 Bacteria 247579
24 Ga0182005_1000012 3300015265 Bacteria 396944
25 Ga0213872_10000978 3300021361 Bacteria 19957
26 Ga0213872_10044165 3300021361 Bacteria 2029
27 Ga0207705_10008062 3300025909 Bacteria 7721
28 Ga0207657_10002528 3300025919 Bacteria 19794
29 Ga0207686_10011808 3300025934 Bacteria 4791
30 Ga0207667_10001620 3300025949 Bacteria 28303
31 Ga0207698_10048550 3300026142 Bacteria 3224
32 Ga0209281_1003031 3300027111 Bacteria 5925
33 Ga0307515_10000180 3300028794 Bacteria 156173
34 Ga0316177_1110341 3300030731 Bacteria 6844
35 Ga0316180_1134049 3300030736 Bacteria 12015
36 Ga0316182_1348082 3300030745 Bacteria 2497
37 Ga0316182_1424482 3300030745 Bacteria 2040
38 Ga0307513_10033801 3300031456 Bacteria 5744
39 Ga0373928_0005504 3300035084 Bacteria 2422
40 Ga0373932_0004235 3300035112 Bacteria 3407
41 Ga0395899_0000725 3300037312 Bacteria 32983
42 Ga0395899_0002451 3300037312 Bacteria 15073
43 Ga0395899_0143024 3300037312 Bacteria 1701
44 Ga0395900_0006909 3300037418 Bacteria 11776
45 Ga0395900_0030011 3300037418 Bacteria 5580
46 Ga0395900_0145858 3300037418 Bacteria 2420
47 Ga0395905_0003380 3300037471 Bacteria 17096
48 Ga0395905_0096040 3300037471 Bacteria 2782
49 Ga0395901_0144634 3300038443 Bacteria 2499
50 Ga0436361_0401959 3300039447 Bacteria 5011
51 Ga0436361_0428529 3300039447 Bacteria 5123
52 Ga0436361_0563588 3300039447 Bacteria 97448
53 Ga0451577_0006484 3300042876 Bacteria 11657
54 Ga0466969_0000978 3300044656 Bacteria 15403
55 Ga0466972_0121392 3300044658 Bacteria 1232
56 Ga0453683_0026710 3300044673 Bacteria 3665
57 Ga0466965_0024043 3300044683 Bacteria 2946
58 Ga0466966_0024738 3300044684 Bacteria 3928
59 Ga0466966_0047142 3300044684 Bacteria 2749
60 Ga0466961_0069440 3300044693 Bacteria 2236
61 Ga0466961_0191195 3300044693 Bacteria 1268
62 Ga0466963_0167330 3300044694 Bacteria 1532
63 Ga0453684_0032854 3300044712 Bacteria 7248
64 Ga0466957_0082573 3300044842 Bacteria 2003
65 Ga0466959_0003388 3300045049 Bacteria 10416
66 Ga0466959_0121836 3300045049 Bacteria 1853
67 Ga0466967_0027375 3300045976 Bacteria 4741
68 Ga0495627_000007 3300046453 Bacteria 575915
69 Ga0495627_000255 3300046453 Bacteria 54602
70 Ga0495629_0007659 3300046459 Bacteria 7950
71 Ga0495629_0039293 3300046459 Bacteria 3330
72 Ga0495650_0018047 3300046471 Bacteria 3519
73 Ga0495582_0006022 3300046473 Bacteria 6760
74 Ga0495605_0000024 3300046474 Bacteria 236016
75 Ga0495605_0000236 3300046474 Bacteria 67212
76 Ga0495605_0030663 3300046474 Bacteria 2755
77 Ga0495584_0018274 3300046491 Bacteria 3564
78 Ga0495584_0025761 3300046491 Bacteria 2981
79 Ga0495585_0000699 3300046492 Bacteria 30438
80 Ga0495585_0004781 3300046492 Bacteria 8714
81 Ga0495594_0002110 3300046499 Bacteria 10356
82 Ga0495596_0003350 3300046500 Bacteria 8145
83 Ga0495596_0013245 3300046500 Bacteria 3505
84 Ga0495607_0002598 3300046501 Bacteria 14524
85 Ga0495607_0004489 3300046501 Bacteria 10240
86 Ga0495607_0005828 3300046501 Bacteria 8763
87 Ga0495607_0006249 3300046501 Bacteria 8402
88 Ga0495583_0001721 3300046506 Bacteria 21012
89 Ga0495583_0015638 3300046506 Bacteria 4116
90 Ga0495583_0027107 3300046506 Bacteria 2830
91 Ga0495606_0003596 3300046507 Bacteria 16329
92 Ga0495606_0004700 3300046507 Bacteria 13482
93 Ga0495616_0000567 3300046513 Bacteria 27995
94 Ga0495616_0002830 3300046513 Bacteria 11322
95 Ga0495616_0005264 3300046513 Bacteria 7982
96 Ga0495631_0006699 3300046518 Bacteria 5915
97 Ga0495631_0010465 3300046518 Bacteria 4586
98 Ga0495631_0023513 3300046518 Unclassified 2855
99 Ga0495631_0028165 3300046518 Bacteria 2564
100 Ga0495631_0055008 3300046518 Bacteria 1734
101 Ga0495632_0000203 3300046519 Bacteria 60607
102 Ga0495643_0001166 3300046522 Bacteria 25657
103 Ga0495643_0004586 3300046522 Bacteria 9620
104 Ga0495643_0006608 3300046522 Bacteria 7618
105 Ga0495644_0003515 3300046523 Bacteria 6198
106 Ga0495644_0005589 3300046523 Bacteria 4905
107 Ga0495644_0017548 3300046523 Bacteria 2736
108 Ga0495644_0029246 3300046523 Bacteria 2082
109 Ga0495648_0000290 3300046524 Bacteria 57025
110 Ga0495648_0005983 3300046524 Bacteria 9999
111 Ga0495648_0057774 3300046524 Unclassified 2324
112 Ga0495648_0059879 3300046524 Bacteria 2269
113 Ga0495648_0105094 3300046524 Bacteria 1549
114 Ga0495666_0000736 3300046526 Bacteria 15031
115 Ga0495666_0000824 3300046526 Bacteria 14342
116 Ga0495666_0012050 3300046526 Bacteria 4315
117 Ga0495666_0040991 3300046526 Bacteria 2243
118 Ga0495642_0000550 3300046528 Bacteria 18877
119 Ga0495642_0001516 3300046528 Bacteria 10321
120 Ga0495642_0007889 3300046528 Bacteria 4078
121 Ga0495642_0044079 3300046528 Unclassified 1820
122 Ga0495652_0020211 3300046529 Bacteria 5919
123 Ga0495654_0023258 3300046530 Bacteria 3210
124 Ga0495654_0025081 3300046530 Bacteria 3074
125 Ga0495654_0053967 3300046530 Unclassified 1951
126 Ga0495665_0066163 3300046531 Bacteria 1907
127 Ga0495665_0117294 3300046531 Bacteria 1394
128 Ga0495586_0003616 3300046535 Bacteria 8284
129 Ga0495586_0014525 3300046535 Bacteria 4183
130 Ga0495586_0022089 3300046535 Bacteria 3395
131 Ga0495609_0000554 3300046538 Bacteria 29545
132 Ga0495609_0002030 3300046538 Bacteria 12756
133 Ga0495609_0008055 3300046538 Bacteria 5195
134 Ga0495597_0000219 3300046542 Bacteria 52473
135 Ga0495597_0002570 3300046542 Bacteria 11347
136 Ga0495597_0004754 3300046542 Bacteria 7347
137 Ga0495597_0012237 3300046542 Bacteria 4145
138 Ga0495622_0003018 3300046557 Bacteria 7982
139 Ga0495622_0004162 3300046557 Bacteria 6749
140 Ga0495622_0049315 3300046557 Bacteria 1954
141 Ga0495633_0002490 3300046558 Bacteria 12982
142 Ga0495633_0013352 3300046558 Bacteria 4332
143 Ga0495633_0024643 3300046558 Bacteria 2970
144 Ga0495633_0034679 3300046558 Bacteria 2425
145 Ga0495633_0059154 3300046558 Bacteria 1798
146 Ga0495656_0000016 3300046615 Bacteria 122424
147 Ga0495668_0001547 3300046616 Bacteria 21809
148 Ga0495668_0001603 3300046616 Bacteria 21205
149 Ga0495668_0049663 3300046616 Bacteria 2326
150 Ga0495611_0005643 3300046648 Bacteria 5337
151 Ga0495611_0063896 3300046648 Bacteria 1676
152 Ga0495625_0013638 3300046660 Bacteria 6520
153 Ga0495625_0026677 3300046660 Bacteria 4361
154 Ga0495625_0036332 3300046660 Bacteria 3622
155 Ga0495625_0078260 3300046660 Bacteria 2308
156 Ga0495659_0000027 3300046664 Bacteria 68298
157 Ga0495659_0008004 3300046664 Bacteria 3354
158 Ga0495661_0000882 3300046665 Bacteria 27670
159 Ga0495661_0000956 3300046665 Bacteria 26186
160 Ga0495661_0002000 3300046665 Bacteria 16087
161 Ga0495661_0019651 3300046665 Bacteria 4423
162 Ga0495661_0020417 3300046665 Bacteria 4323
163 Ga0495661_0023851 3300046665 Bacteria 3965
164 Ga0495661_0085880 3300046665 Bacteria 1802
165 Ga0495661_0115268 3300046665 Bacteria 1492
166 Ga0495588_0006180 3300046674 Bacteria 5379
167 Ga0495588_0016096 3300046674 Bacteria 3609
168 Ga0495588_0088722 3300046674 Unclassified 1619
169 Ga0495646_0048221 3300046680 Bacteria 2589
170 Ga0495613_0072338 3300046689 Bacteria 2513
171 Ga0495613_0198548 3300046689 Bacteria 1415
172 Ga0495624_0010731 3300046690 Bacteria 6312
173 Ga0495670_0000317 3300046691 Bacteria 22950
174 Ga0495670_0000845 3300046691 Bacteria 14804
175 Ga0495670_0027638 3300046691 Bacteria 2812
176 Ga0495671_0000812 3300046692 Bacteria 22323
177 Ga0495671_0023499 3300046692 Bacteria 3220
178 Ga0495649_0034084 3300046694 Bacteria 2802
179 Ga0495589_0000598 3300046794 Bacteria 24527
180 Ga0495589_0005703 3300046794 Bacteria 6563
181 Ga0495660_0000173 3300046810 Bacteria 69912
182 Ga0495660_0000285 3300046810 Bacteria 47026
183 Ga0495660_0001243 3300046810 Bacteria 17732
184 Ga0495660_0008898 3300046810 Bacteria 5867
185 Ga0495660_0043680 3300046810 Bacteria 2470
186 Ga0495581_0001884 3300047315 Bacteria 11734
187 Ga0495581_0005692 3300047315 Bacteria 7226
188 Ga0495581_0076409 3300047315 Bacteria 1937
189 Ga0495604_0115174 3300047317 Bacteria 1954
190 Ga0495636_0023567 3300047318 Bacteria 2492
191 Ga0495674_0048064 3300047319 Bacteria 3778
192 Ga0495672_0002856 3300047320 Bacteria 15354
193 Ga0495672_0012364 3300047320 Bacteria 5959
194 Ga0495676_0000100 3300047321 Bacteria 65339
195 Ga0495676_0056625 3300047321 Bacteria 3099
196 Ga0495680_0009597 3300047322 Bacteria 8691
197 Ga0495683_0012564 3300047323 Bacteria 4446
198 Ga0495683_0025800 3300047323 Bacteria 3010
199 Ga0495683_0056506 3300047323 Unclassified 1952
200 Ga0495687_000012 3300047443 Bacteria 391586
201 Ga0495687_000279 3300047443 Bacteria 67230
202 Ga0495687_050489 3300047443 Bacteria 1772
203 Ga0495675_0012826 3300047444 Bacteria 5280
204 Ga0495677_0000514 3300047445 Bacteria 16255
205 Ga0495677_0010667 3300047445 Bacteria 3366
206 Ga0495677_0014801 3300047445 Bacteria 2837
207 Ga0495677_0016666 3300047445 Bacteria 2666
208 Ga0495681_0000146 3300047470 Bacteria 59891
209 Ga0495681_0000251 3300047470 Bacteria 43835
210 Ga0495681_0015251 3300047470 Bacteria 4354
211 Ga0495681_0040130 3300047470 Bacteria 2281
212 Ga0495593_0010799 3300047673 Bacteria 5264
213 Ga0495593_0015877 3300047673 Bacteria 4254
214 Ga0495602_0027391 3300048088 Bacteria 5476
215 Ga0495614_0002132 3300048089 Bacteria 8759
216 Ga0495614_0050511 3300048089 Bacteria 1781
217 Ga0495626_0000038 3300048091 Bacteria 175936
218 Ga0495626_0000386 3300048091 Bacteria 45608
219 Ga0496102_0000343 3300048905 Bacteria 56826
220 Ga0496102_0000598 3300048905 Bacteria 37839
221 Ga0496102_0232326 3300048905 Bacteria 1739
222 Ga0496107_0170838 3300048910 Bacteria 1613
223 Ga0496110_0000070 3300048913 Bacteria 51596
224 Ga0496111_0030946 3300048914 Bacteria 3809
225 Ga0496115_0008818 3300048918 Bacteria 7472
226 Ga0496115_0010839 3300048918 Bacteria 6820
227 Ga0496122_0008999 3300048925 Bacteria 10612
228 Ga0496123_0003216 3300048926 Bacteria 18608
229 Ga0496124_0004425 3300048927 Bacteria 16389
230 Ga0496124_0088988 3300048927 Bacteria 2522
231 Ga0495678_000004 3300049459 Bacteria 532920
232 Ga0495678_001164 3300049459 Bacteria 21704
233 Ga0495678_010510 3300049459 Bacteria 4496
234 Ga0501047_0001396 3300049581 Bacteria 23683
235 Ga0501222_003482 3300049662 Bacteria 2148
236 Ga0501249_004407 3300049679 Bacteria 2860
237 Ga0501252_000053 3300049682 Bacteria 5883
238 Ga0501044_0143691 3300049823 Unclassified 2373
239 2547373796 2547132103 Bacteria 5115736
240 2643744926 2643221544 Bacteria 5886209
241 2643802816 2643221556 Bacteria 7251154
242 2644472321 2643221684 Bacteria 7145183
243 2843691428 2843690924 Bacteria 5169057
244 2846034437 2846033681 Bacteria 4377894
245 2846041539 2846037992 Bacteria 4526407
246 2857554716 2857553236 Bacteria 6166726
247 2919480110 2919476304 Bacteria 5888696
248 2998345459 2998344455 Bacteria 4222996
249 8047678583 8047673197 Bacteria 7395230
250 Ga0157372_10323880
251 rootL2_10008121
252 rootL2_10023350
253 Ga0007410J51695_1051508
254 Ga0007409J51694_1010661
255 Ga0007416J51690_1008758
256 Ga0032354_1014295
257 Ga0070658_10014967
258 Ga0070659_100008224
259 Ga0070707_100164770
260 Ga0070699_100006305
261 Ga0070665_100172121
262 Ga0068855_100029331
263 Ga0068852_100045428
264 Ga0068860_100119314
265 Ga0075434_100185119
266 Ga0079104_1005913
267 Ga0105244_10058737
268 Ga0114129_10172023
269 Ga0105241_10009473
270 Ga0105242_10001583
271 Ga0157372_10021117
272 Ga0182006_1000029
273 Ga0182005_1000012
274 Ga0213872_10000978
275 Ga0213872_10044165
276 Ga0207705_10008062
277 Ga0207657_10002528
278 Ga0207686_10011808
279 Ga0207667_10001620
280 Ga0207698_10048550
281 Ga0209281_1003031
282 Ga0307515_10000180
283 Ga0316177_1110341
284 Ga0316180_1134049
285 Ga0316182_1348082
286 Ga0316182_1424482
287 Ga0307513_10033801
288 Ga0373928_0005504
289 Ga0373932_0004235
290 Ga0395899_0000725
291 Ga0395899_0002451
292 Ga0395899_0143024
293 Ga0395900_0006909
294 Ga0395900_0030011
295 Ga0395900_0145858
296 Ga0395905_0003380
297 Ga0395905_0096040
298 Ga0395901_0144634
299 Ga0436361_0401959
300 Ga0436361_0428529
301 Ga0436361_0563588
302 Ga0451577_0006484
303 Ga0466969_0000978
304 Ga0466972_0121392
305 Ga0453683_0026710
306 Ga0466965_0024043
307 Ga0466966_0024738
308 Ga0466966_0047142
309 Ga0466961_0069440
310 Ga0466961_0191195
311 Ga0466963_0167330
312 Ga0453684_0032854
313 Ga0466957_0082573
314 Ga0466959_0003388
315 Ga0466959_0121836
316 Ga0466967_0027375
317 Ga0495627_000007
318 Ga0495627_000255
319 Ga0495629_0007659
320 Ga0495629_0039293
321 Ga0495650_0018047
322 Ga0495582_0006022
323 Ga0495605_0000024
324 Ga0495605_0000236
325 Ga0495605_0030663
326 Ga0495584_0018274
327 Ga0495584_0025761
328 Ga0495585_0000699
329 Ga0495585_0004781
330 Ga0495594_0002110
331 Ga0495596_0003350
332 Ga0495596_0013245
333 Ga0495607_0002598
334 Ga0495607_0004489
335 Ga0495607_0005828
336 Ga0495607_0006249
337 Ga0495583_0001721
338 Ga0495583_0015638
339 Ga0495583_0027107
340 Ga0495606_0003596
341 Ga0495606_0004700
342 Ga0495616_0000567
343 Ga0495616_0002830
344 Ga0495616_0005264
345 Ga0495631_0006699
346 Ga0495631_0010465
347 Ga0495631_0023513
348 Ga0495631_0028165
349 Ga0495631_0055008
350 Ga0495632_0000203
351 Ga0495643_0001166
352 Ga0495643_0004586
353 Ga0495643_0006608
354 Ga0495644_0003515
355 Ga0495644_0005589
356 Ga0495644_0017548
357 Ga0495644_0029246
358 Ga0495648_0000290
359 Ga0495648_0005983
360 Ga0495648_0057774
361 Ga0495648_0059879
362 Ga0495648_0105094
363 Ga0495666_0000736
364 Ga0495666_0000824
365 Ga0495666_0012050
366 Ga0495666_0040991
367 Ga0495642_0000550
368 Ga0495642_0001516
369 Ga0495642_0007889
370 Ga0495642_0044079
371 Ga0495652_0020211
372 Ga0495654_0023258
373 Ga0495654_0025081
374 Ga0495654_0053967
375 Ga0495665_0066163
376 Ga0495665_0117294
377 Ga0495586_0003616
378 Ga0495586_0014525
379 Ga0495586_0022089
380 Ga0495609_0000554
381 Ga0495609_0002030
382 Ga0495609_0008055
383 Ga0495597_0000219
384 Ga0495597_0002570
385 Ga0495597_0004754
386 Ga0495597_0012237
387 Ga0495622_0003018
388 Ga0495622_0004162
389 Ga0495622_0049315
390 Ga0495633_0002490
391 Ga0495633_0013352
392 Ga0495633_0024643
393 Ga0495633_0034679
394 Ga0495633_0059154
395 Ga0495656_0000016
396 Ga0495668_0001547
397 Ga0495668_0001603
398 Ga0495668_0049663
399 Ga0495611_0005643
400 Ga0495611_0063896
401 Ga0495625_0013638
402 Ga0495625_0026677
403 Ga0495625_0036332
404 Ga0495625_0078260
405 Ga0495659_0000027
406 Ga0495659_0008004
407 Ga0495661_0000882
408 Ga0495661_0000956
409 Ga0495661_0002000
410 Ga0495661_0019651
411 Ga0495661_0020417
412 Ga0495661_0023851
413 Ga0495661_0085880
414 Ga0495661_0115268
415 Ga0495588_0006180
416 Ga0495588_0016096
417 Ga0495588_0088722
418 Ga0495646_0048221
419 Ga0495613_0072338
420 Ga0495613_0198548
421 Ga0495624_0010731
422 Ga0495670_0000317
423 Ga0495670_0000845
424 Ga0495670_0027638
425 Ga0495671_0000812
426 Ga0495671_0023499
427 Ga0495649_0034084
428 Ga0495589_0000598
429 Ga0495589_0005703
430 Ga0495660_0000173
431 Ga0495660_0000285
432 Ga0495660_0001243
433 Ga0495660_0008898
434 Ga0495660_0043680
435 Ga0495581_0001884
436 Ga0495581_0005692
437 Ga0495581_0076409
438 Ga0495604_0115174
439 Ga0495636_0023567
440 Ga0495674_0048064
441 Ga0495672_0002856
442 Ga0495672_0012364
443 Ga0495676_0000100
444 Ga0495676_0056625
445 Ga0495680_0009597
446 Ga0495683_0012564
447 Ga0495683_0025800
448 Ga0495683_0056506
449 Ga0495687_000012
450 Ga0495687_000279
451 Ga0495687_050489
452 Ga0495675_0012826
453 Ga0495677_0000514
454 Ga0495677_0010667
455 Ga0495677_0014801
456 Ga0495677_0016666
457 Ga0495681_0000146
458 Ga0495681_0000251
459 Ga0495681_0015251
460 Ga0495681_0040130
461 Ga0495593_0010799
462 Ga0495593_0015877
463 Ga0495602_0027391
464 Ga0495614_0002132
465 Ga0495614_0050511
466 Ga0495626_0000038
467 Ga0495626_0000386
468 Ga0496102_0000343
469 Ga0496102_0000598
470 Ga0496102_0232326
471 Ga0496107_0170838
472 Ga0496110_0000070
473 Ga0496111_0030946
474 Ga0496115_0008818
475 Ga0496115_0010839
476 Ga0496122_0008999
477 Ga0496123_0003216
478 Ga0496124_0004425
479 Ga0496124_0088988
480 Ga0495678_000004
481 Ga0495678_001164
482 Ga0495678_010510
483 Ga0501047_0001396
484 Ga0501222_003482
485 Ga0501249_004407
486 Ga0501252_000053
487 Ga0501044_0143691
488 2547373796
489 2643744926
490 2643802816
491 2644472321
492 2843691428
493 2846034437
494 2846041539
495 2857554716
496 2919480110
497 2998345459
498 8047678583

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

271

435

0.83

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

276

420

0.83

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

292

451

0.81

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

60

247

0.81

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

60

252

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8105 232 393
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.7875 232 393
6tvp-assembly1.cif.gz_B structure of mycobacterium smegmatis alpha-maltose-1-phosphate synthase glgm 0.7796 1 408
5d01-assembly1.cif.gz_B crystal structure of bsha from b. subtilis complexed with n-acetylglucosaminyl-malate 0.7761 2 408
3mbo-assembly1.cif.gz_B crystal structure of the glycosyltransferase babsha bound with udp and l-malate 0.7655 2 408
ID Description Score Start End Superfamily
af_Q2G1J7_226_391_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8776 234 393 3.40.50.2000
af_Q84QB1_230_385_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8673 231 392 3.40.50.2000
af_Q2G0L3_321_481_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8647 236 393 3.40.50.2000
4x6lA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8536 231 393 3.40.50.2000
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8531 232 393 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7S7AXF3-F1-model_v4 Glycosyltransferase 0.9881 234 407 GO:0009103
GO:0016757
GO:0045226
AF-A0A366G054-F1-model_v4 Glycosyl transferase family 1 0.9674 199 407 GO:0016757
AF-A0A3S0WZP6-F1-model_v4 Glycosyltransferase WbuB 0.9656 1 407 GO:0016757
AF-A0A354DEB0-F1-model_v4 Glycosyltransferase WbuB 0.9645 1 241 GO:0016740
AF-A0A7S7AXF3-F1-model_v4 Glycosyltransferase 0.9608 234 407 GO:0009103
GO:0016757
GO:0045226

Map