F360285

General Info

Members Datasets Scaffolds Average Seq Length
248 113 496 438

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_66119_c1|nmdc:mga0qj67_66119_c1_1082_2518
Length 478
Sequence MLPASRTEGEGFAIPTFALVPSDVAGFLEELWAFQSILHDCFARSEPRAHFFDYMVGQFSKLERKSIEPMALQVEGGTIRGLQRFISDVRWDEAQMVWNYHQLVAEEMGEPDGVLMFDESGFVKKGKDSVGVARQYCGTLGKVENCQVGVFAAYASRQGYALVDQRLFLPEVWFTDAYAARRTTCHLPNELCFQSKPRLAATMLQAIAHEGLLPFKYVVADCLYGNSPDFLDAVDACVGVTTFVAIPSETRCWLQRPRTEDKTYTYKGDVRTKRVVVAPTNAPSSVAALAANLPASSWYQRTVSEGTKGPIAYAFARQRVTLCKEGLPDRTVWLVIKRTVGANPVYSYYISNAPASTPWRTFVWLSGVRWAIEQCFEESKTELGMDHYEVRKYPGWHHHMLTTMLAHFFLWHLKLRQCTRELWSYHLGTRHISNSSSVRQRSVNPSSIAGEYFLYLTSKRLAYGLIHCRNAWFASTKL

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
13 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
36 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
37 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
38 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
39 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
40 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
41 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
42 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
43 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
44 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
45 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
46 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
47 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
48 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
49 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
50 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
51 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
52 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
53 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
54 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
55 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
56 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
57 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
58 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
62 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
63 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
64 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
76 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
77 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
78 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
79 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
82 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
83 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
84 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
85 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
86 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
87 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
88 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
91 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
92 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
93 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
94 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
95 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
96 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
104 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
112 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
113 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 91.94
Stem 0
Stem Tuber 0
Unclassified 23.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_66119_c1 3300050509 Bacteria 2879
2 2214809109 2209111006 Bacteria 1989
3 ARcpr5oldR_c001697 3300000041 Bacteria 2154
4 ARSoilYngRDRAFT_c00405 3300000042 Bacteria 5625
5 ARcpr5yngRDRAFT_c000420 3300000043 Bacteria 5588
6 ARcpr5yngRDRAFT_c000948 3300000043 Bacteria 3355
7 ARSoilOldRDRAFT_c001553 3300000044 Bacteria 2134
8 ARCol0oldRDRAFT_c01107 3300000045 Bacteria 1990
9 ARCol0yngRDRAFT_1000720 3300000652 Bacteria 3258
10 JGI25406J46586_10042430 3300003203 Bacteria 1593
11 JGI25407J50210_10017910 3300003373 Bacteria 1841
12 JGI25405J52794_10009894 3300003911 Bacteria 1808
13 JGI25405J52794_10009923 3300003911 Bacteria 1805
14 JGI25405J52794_10013540 3300003911 Bacteria 1583
15 JGI25405J52794_10014703 3300003911 Bacteria 1532
16 JGI25405J52794_10019422 3300003911 Bacteria 1363
17 Ga0065717_1000065 3300005276 Unclassified 3429
18 Ga0065716_1002354 3300005277 Bacteria 1841
19 Ga0065704_10078423 3300005289 Bacteria 4434
20 Ga0070705_100056393 3300005440 Bacteria 2313
21 Ga0070678_100172218 3300005456 Bacteria 1764
22 Ga0070706_100116120 3300005467 Bacteria 2493
23 Ga0074259_11279882 3300005507 Bacteria 1534
24 Ga0081455_10002351 3300005937 Bacteria 22577
25 Ga0081455_10022886 3300005937 Bacteria 5827
26 Ga0081455_10023302 3300005937 Bacteria 5764
27 Ga0081455_10029572 3300005937 Bacteria 4994
28 Ga0081455_10037012 3300005937 Bacteria 4338
29 Ga0081455_10038361 3300005937 Unclassified 4243
30 Ga0081455_10045626 3300005937 Unclassified 3812
31 Ga0081455_10073368 3300005937 Bacteria 2830
32 Ga0081455_10099365 3300005937 Bacteria 2341
33 Ga0081455_10167595 3300005937 Bacteria 1677
34 Ga0081538_10059685 3300005981 Unclassified 2201
35 Ga0081540_1013093 3300005983 Bacteria 5416
36 Ga0081540_1040831 3300005983 Bacteria 2413
37 Ga0081540_1040928 3300005983 Bacteria 2409
38 Ga0081539_10011036 3300005985 Bacteria 7225
39 Ga0081539_10013210 3300005985 Bacteria 6247
40 Ga0081539_10043442 3300005985 Bacteria 2605
41 Ga0081539_10052052 3300005985 Unclassified 2303
42 Ga0081539_10076075 3300005985 Bacteria 1780
43 Ga0075432_10032009 3300006058 Bacteria 1822
44 Ga0075427_10002557 3300006194 Unclassified 2452
45 Ga0075427_10003050 3300006194 Bacteria 2285
46 Ga0075427_10004871 3300006194 Bacteria 1897
47 Ga0075427_10006693 3300006194 Bacteria 1677
48 Ga0075428_100123007 3300006844 Bacteria 2824
49 Ga0075428_100164964 3300006844 Bacteria 2403
50 Ga0075428_100191224 3300006844 Unclassified 2213
51 Ga0075428_100221040 3300006844 Bacteria 2045
52 Ga0075430_100043414 3300006846 Unclassified 3799
53 Ga0075430_100065685 3300006846 Bacteria 3047
54 Ga0075430_100080370 3300006846 Unclassified 2731
55 Ga0075430_100096181 3300006846 Bacteria 2475
56 Ga0075430_100103131 3300006846 Bacteria 2381
57 Ga0075430_100129024 3300006846 Bacteria 2107
58 Ga0075431_100056848 3300006847 Bacteria 4035
59 Ga0075431_100176479 3300006847 Bacteria 2194
60 Ga0075431_100195928 3300006847 Bacteria 2068
61 Ga0075431_100237180 3300006847 Bacteria 1856
62 Ga0075431_100261890 3300006847 Bacteria 1754
63 Ga0075431_100311416 3300006847 Bacteria 1589
64 Ga0075431_100333435 3300006847 Bacteria 1528
65 Ga0075431_100343252 3300006847 Bacteria 1502
66 Ga0075433_10109620 3300006852 Bacteria 2449
67 Ga0075433_10118525 3300006852 Bacteria 2349
68 Ga0075433_10179510 3300006852 Bacteria 1884
69 Ga0075433_10235742 3300006852 Bacteria 1624
70 Ga0075434_100154750 3300006871 Bacteria 2312
71 Ga0075434_100206569 3300006871 Unclassified 1984
72 Ga0075429_100054154 3300006880 Bacteria 3490
73 Ga0075429_100056779 3300006880 Bacteria 3408
74 Ga0075429_100205347 3300006880 Unclassified 1726
75 Ga0075429_100229018 3300006880 Bacteria 1628
76 Ga0075435_100135790 3300007076 Unclassified 2060
77 Ga0075435_100143345 3300007076 Unclassified 2005
78 Ga0111539_10019760 3300009094 Bacteria 8307
79 Ga0111539_10022841 3300009094 Bacteria 7682
80 Ga0111539_10103730 3300009094 Bacteria 3337
81 Ga0111539_10257721 3300009094 Unclassified 2031
82 Ga0111539_10284992 3300009094 Bacteria 1922
83 Ga0111539_10288195 3300009094 Bacteria 1911
84 Ga0114129_10162300 3300009147 Bacteria 3051
85 Ga0114129_10168156 3300009147 Bacteria 2991
86 Ga0114129_10227795 3300009147 Bacteria 2511
87 Ga0114129_10314184 3300009147 Bacteria 2085
88 Ga0114129_10327921 3300009147 Bacteria 2033
89 Ga0114129_10341208 3300009147 Bacteria 1987
90 Ga0114129_10397090 3300009147 Bacteria 1818
91 Ga0105249_10255200 3300009553 Unclassified 1740
92 Ga0157340_1000221 3300012473 Bacteria 2088
93 Ga0157344_1000443 3300012476 Bacteria 1608
94 Ga0157328_1000213 3300012478 Bacteria 2088
95 Ga0157346_1000329 3300012480 Bacteria 2030
96 Ga0157320_1000013 3300012481 Bacteria 4431
97 Ga0157318_1000070 3300012482 Bacteria 3103
98 Ga0157337_1000110 3300012483 Unclassified 3658
99 Ga0157325_1000380 3300012485 Bacteria 1845
100 Ga0157321_1000136 3300012487 Bacteria 3212
101 Ga0157343_1000259 3300012488 Bacteria 1994
102 Ga0157322_1000049 3300012490 Bacteria 2356
103 Ga0157329_1000320 3300012491 Unclassified 1729
104 Ga0157335_1000157 3300012492 Unclassified 2752
105 Ga0157341_1000513 3300012494 Bacteria 1989
106 Ga0157323_1000388 3300012495 Bacteria 1941
107 Ga0157319_1000375 3300012497 Bacteria 2066
108 Ga0157347_1001479 3300012502 Unclassified 1852
109 Ga0157313_1000219 3300012503 Bacteria 2635
110 Ga0157324_1000242 3300012506 Unclassified 2541
111 Ga0157342_1000851 3300012507 Unclassified 2069
112 Ga0157316_1000624 3300012510 Bacteria 1922
113 Ga0157327_1000545 3300012512 Bacteria 2054
114 Ga0157338_1002096 3300012515 Bacteria 1528
115 Ga0207683_10211755 3300026121 Bacteria 1764
116 Ga0207428_10040757 3300027907 Unclassified 3763
117 Ga0207428_10105915 3300027907 Unclassified 2168
118 Ga0207428_10123664 3300027907 Unclassified 1982
119 Ga0207428_10153053 3300027907 Bacteria 1755
120 Ga0207428_10176851 3300027907 Bacteria 1614
121 Ga0207428_10177906 3300027907 Bacteria 1608
122 Ga0207428_10178497 3300027907 Bacteria 1605
123 Ga0307408_100163657 3300031548 Unclassified 1769
124 Ga0316575_10029932 3300031665 Bacteria 2127
125 Ga0316579_10035943 3300031691 Bacteria 2284
126 Ga0316576_10177966 3300031727 Bacteria 1604
127 Ga0316576_10200305 3300031727 Bacteria 1504
128 Ga0316578_10100194 3300031728 Bacteria 1736
129 Ga0316578_10102915 3300031728 Bacteria 1712
130 Ga0316578_10110062 3300031728 Unclassified 1654
131 Ga0316578_10114786 3300031728 Bacteria 1618
132 Ga0307405_10141472 3300031731 Bacteria 1678
133 Ga0316577_10055363 3300031733 Bacteria 2213
134 Ga0316577_10061652 3300031733 Unclassified 2093
135 Ga0316577_10066552 3300031733 Bacteria 2011
136 Ga0316577_10085564 3300031733 Unclassified 1764
137 Ga0316577_10090465 3300031733 Bacteria 1713
138 Ga0316577_10114106 3300031733 Unclassified 1516
139 Ga0307413_10147364 3300031824 Unclassified 1635
140 Ga0307406_10069284 3300031901 Unclassified 2306
141 Ga0307407_10112462 3300031903 Bacteria 1711
142 Ga0307412_10138041 3300031911 Unclassified 1781
143 Ga0307409_100224369 3300031995 Unclassified 1698
144 Ga0307416_100302307 3300032002 Unclassified 1591
145 Ga0307416_100325537 3300032002 Unclassified 1541
146 Ga0307414_10233320 3300032004 Unclassified 1518
147 Ga0307411_10126218 3300032005 Unclassified 1861
148 Ga0316580_10028550 3300032139 Bacteria 1724
149 Ga0316574_0114466 3300035398 Bacteria 1729
150 Ga0316582_0089749 3300036647 Unclassified 2021
151 Ga0316582_0089961 3300036647 Unclassified 2019
152 Ga0316582_0105515 3300036647 Bacteria 1870
153 Ga0316582_0106570 3300036647 Bacteria 1861
154 Ga0316582_0119308 3300036647 Bacteria 1763
155 Ga0316582_0121747 3300036647 Bacteria 1746
156 Ga0316582_0131738 3300036647 Bacteria 1680
157 Ga0316582_0155589 3300036647 Unclassified 1547
158 Ga0316584_0114403 3300036712 Bacteria 2018
159 Ga0316584_0145274 3300036712 Bacteria 1767
160 Ga0316584_0162491 3300036712 Unclassified 1659
161 Ga0316584_0188262 3300036712 Bacteria 1526
162 Ga0316581_0030284 3300037588 Bacteria 1628
163 Ga0395901_0318474 3300038443 Bacteria 1610
164 Ga0400484_02976 3300038725 Bacteria 1509
165 Ga0400484_04647 3300038725 Bacteria 2197
166 Ga0400484_25941 3300038725 Bacteria 2086
167 Ga0400490_46866 3300038726 Bacteria 1906
168 Ga0400490_57330 3300038726 Bacteria 1923
169 Ga0400491_23290 3300038727 Bacteria 1732
170 Ga0400485_18548 3300038735 Bacteria 1751
171 Ga0400488_03826 3300038741 Bacteria 4814
172 Ga0400488_22002 3300038741 Bacteria 3753
173 Ga0400488_51713 3300038741 Bacteria 1623
174 Ga0400488_54167 3300038741 Bacteria 1704
175 Ga0400486_20300 3300038742 Bacteria 6826
176 Ga0400483_009914 3300039062 Bacteria 3825
177 Ga0400483_110801 3300039062 Bacteria 2001
178 Ga0400483_114223 3300039062 Bacteria 2669
179 Ga0400483_214805 3300039062 Bacteria 2415
180 Ga0400483_275369 3300039062 Bacteria 2282
181 Ga0400483_283440 3300039062 Bacteria 1725
182 Ga0400489_74473 3300039093 Bacteria 26130
183 Ga0400489_74789 3300039093 Bacteria 1675
184 Ga0436362_0623447 3300039453 Bacteria 2107
185 Ga0439448_0020638 3300042005 Bacteria 2040
186 Ga0439448_0046021 3300042005 Bacteria 1421
187 Ga0439463_030955 3300042016 Unclassified 1350
188 Ga0439444_0004733 3300042437 Bacteria 1991
189 Ga0439464_0024167 3300042439 Bacteria 1680
190 Ga0439460_0045535 3300042461 Bacteria 1301
191 Ga0439440_0028603 3300042993 Unclassified 1302
192 Ga0466969_0027241 3300044656 Unclassified 2927
193 Ga0466966_0105209 3300044684 Bacteria 1742
194 Ga0466957_0122884 3300044842 Bacteria 1656
195 Ga0466960_0014280 3300044901 Bacteria 3395
196 Ga0466959_0091344 3300045049 Bacteria 2186
197 Ga0466958_0115336 3300045836 Bacteria 1679
198 Ga0501072_0107062 3300049588 Bacteria 2224
199 Ga0501075_0116070 3300049591 Unclassified 2035
200 Ga0501077_0079645 3300049593 Unclassified 2076
201 Ga0501035_0123600 3300049822 Bacteria 2260
202 Ga0501045_0167007 3300049824 Bacteria 1639
203 nmdc:mga05p37_107845_c1 3300050507 Bacteria 3426
204 nmdc:mga05p37_146558_c1 3300050507 Bacteria 2045
205 nmdc:mga05p37_213007_c1 3300050507 Bacteria 2335
206 nmdc:mga05p37_262847_c1 3300050507 Bacteria 2065
207 nmdc:mga05p37_346603_c1 3300050507 Bacteria 1750
208 nmdc:mga05p37_416049_c1 3300050507 Unclassified 1566
209 nmdc:mga05p37_432498_c1 3300050507 Bacteria 1529
210 nmdc:mga09592_118568_c1 3300050508 Unclassified 2272
211 nmdc:mga09592_181043_c1 3300050508 Bacteria 1823
212 nmdc:mga09592_201061_c1 3300050508 Unclassified 1726
213 nmdc:mga09592_218231_c1 3300050508 Bacteria 1653
214 nmdc:mga09592_230497_c1 3300050508 Bacteria 1605
215 nmdc:mga09592_243428_c1 3300050508 Bacteria 1559
216 nmdc:mga09592_281078_c1 3300050508 Bacteria 1444
217 nmdc:mga0qj67_171493_c1 3300050509 Bacteria 1762
218 nmdc:mga0qj67_208730_c1 3300050509 Unclassified 1587
219 nmdc:mga0qj67_23983_c1 3300050509 Bacteria 4700
220 nmdc:mga0qj67_34169_c1 3300050509 Bacteria 3971
221 nmdc:mga0qj67_43035_c1 3300050509 Unclassified 3556
222 nmdc:mga0qj67_45521_c1 3300050509 Bacteria 3463
223 nmdc:mga0qj67_48501_c1 3300050509 Bacteria 3355
224 nmdc:mga0qj67_52973_c1 3300050509 Bacteria 3212
225 nmdc:mga0qj67_96903_c1 3300050509 Unclassified 2375
226 nmdc:mga06r32_122795_c1 3300050510 Bacteria 2563
227 nmdc:mga06r32_252403_c1 3300050510 Bacteria 1752
228 nmdc:mga06r32_259467_c1 3300050510 Unclassified 1726
229 nmdc:mga06r32_277879_c1 3300050510 Bacteria 1662
230 nmdc:mga06r32_310831_c1 3300050510 Bacteria 1562
231 nmdc:mga06r32_310833_c1 3300050510 Bacteria 1562
232 nmdc:mga06r32_337961_c1 3300050510 Bacteria 1491
233 nmdc:mga06r32_46601_c1 3300050510 Bacteria 4137
234 nmdc:mga08y16_239941_c1 3300050511 Bacteria 1874
235 nmdc:mga08y16_264694_c1 3300050511 Bacteria 1775
236 nmdc:mga08y16_283473_c1 3300050511 Bacteria 1709
237 nmdc:mga08y16_369810_c1 3300050511 Unclassified 1471
238 nmdc:mga08y16_65828_c1 3300050511 Unclassified 3783
239 nmdc:mga0n895_138673_c1 3300050512 Unclassified 2460
240 nmdc:mga0n895_151462_c1 3300050512 Bacteria 2350
241 nmdc:mga0n895_169146_c1 3300050512 Bacteria 2218
242 nmdc:mga0a205_125600_c1 3300050515 Unclassified 2465
243 nmdc:mga0a205_168528_c1 3300050515 Bacteria 2086
244 nmdc:mga0a205_173256_c1 3300050515 Bacteria 2054
245 nmdc:mga0a205_232411_c1 3300050515 Bacteria 1727
246 nmdc:mga0a205_290096_c1 3300050515 Unclassified 1511
247 nmdc:mga0a205_94228_c1 3300050515 Bacteria 2893
248 Ga0530510_0039054 3300061734 Unclassified 3427
249 nmdc:mga0qj67_66119_c1
250 2214809109
251 ARcpr5oldR_c001697
252 ARSoilYngRDRAFT_c00405
253 ARcpr5yngRDRAFT_c000420
254 ARcpr5yngRDRAFT_c000948
255 ARSoilOldRDRAFT_c001553
256 ARCol0oldRDRAFT_c01107
257 ARCol0yngRDRAFT_1000720
258 JGI25406J46586_10042430
259 JGI25407J50210_10017910
260 JGI25405J52794_10009894
261 JGI25405J52794_10009923
262 JGI25405J52794_10013540
263 JGI25405J52794_10014703
264 JGI25405J52794_10019422
265 Ga0065717_1000065
266 Ga0065716_1002354
267 Ga0065704_10078423
268 Ga0070705_100056393
269 Ga0070678_100172218
270 Ga0070706_100116120
271 Ga0074259_11279882
272 Ga0081455_10002351
273 Ga0081455_10022886
274 Ga0081455_10023302
275 Ga0081455_10029572
276 Ga0081455_10037012
277 Ga0081455_10038361
278 Ga0081455_10045626
279 Ga0081455_10073368
280 Ga0081455_10099365
281 Ga0081455_10167595
282 Ga0081538_10059685
283 Ga0081540_1013093
284 Ga0081540_1040831
285 Ga0081540_1040928
286 Ga0081539_10011036
287 Ga0081539_10013210
288 Ga0081539_10043442
289 Ga0081539_10052052
290 Ga0081539_10076075
291 Ga0075432_10032009
292 Ga0075427_10002557
293 Ga0075427_10003050
294 Ga0075427_10004871
295 Ga0075427_10006693
296 Ga0075428_100123007
297 Ga0075428_100164964
298 Ga0075428_100191224
299 Ga0075428_100221040
300 Ga0075430_100043414
301 Ga0075430_100065685
302 Ga0075430_100080370
303 Ga0075430_100096181
304 Ga0075430_100103131
305 Ga0075430_100129024
306 Ga0075431_100056848
307 Ga0075431_100176479
308 Ga0075431_100195928
309 Ga0075431_100237180
310 Ga0075431_100261890
311 Ga0075431_100311416
312 Ga0075431_100333435
313 Ga0075431_100343252
314 Ga0075433_10109620
315 Ga0075433_10118525
316 Ga0075433_10179510
317 Ga0075433_10235742
318 Ga0075434_100154750
319 Ga0075434_100206569
320 Ga0075429_100054154
321 Ga0075429_100056779
322 Ga0075429_100205347
323 Ga0075429_100229018
324 Ga0075435_100135790
325 Ga0075435_100143345
326 Ga0111539_10019760
327 Ga0111539_10022841
328 Ga0111539_10103730
329 Ga0111539_10257721
330 Ga0111539_10284992
331 Ga0111539_10288195
332 Ga0114129_10162300
333 Ga0114129_10168156
334 Ga0114129_10227795
335 Ga0114129_10314184
336 Ga0114129_10327921
337 Ga0114129_10341208
338 Ga0114129_10397090
339 Ga0105249_10255200
340 Ga0157340_1000221
341 Ga0157344_1000443
342 Ga0157328_1000213
343 Ga0157346_1000329
344 Ga0157320_1000013
345 Ga0157318_1000070
346 Ga0157337_1000110
347 Ga0157325_1000380
348 Ga0157321_1000136
349 Ga0157343_1000259
350 Ga0157322_1000049
351 Ga0157329_1000320
352 Ga0157335_1000157
353 Ga0157341_1000513
354 Ga0157323_1000388
355 Ga0157319_1000375
356 Ga0157347_1001479
357 Ga0157313_1000219
358 Ga0157324_1000242
359 Ga0157342_1000851
360 Ga0157316_1000624
361 Ga0157327_1000545
362 Ga0157338_1002096
363 Ga0207683_10211755
364 Ga0207428_10040757
365 Ga0207428_10105915
366 Ga0207428_10123664
367 Ga0207428_10153053
368 Ga0207428_10176851
369 Ga0207428_10177906
370 Ga0207428_10178497
371 Ga0307408_100163657
372 Ga0316575_10029932
373 Ga0316579_10035943
374 Ga0316576_10177966
375 Ga0316576_10200305
376 Ga0316578_10100194
377 Ga0316578_10102915
378 Ga0316578_10110062
379 Ga0316578_10114786
380 Ga0307405_10141472
381 Ga0316577_10055363
382 Ga0316577_10061652
383 Ga0316577_10066552
384 Ga0316577_10085564
385 Ga0316577_10090465
386 Ga0316577_10114106
387 Ga0307413_10147364
388 Ga0307406_10069284
389 Ga0307407_10112462
390 Ga0307412_10138041
391 Ga0307409_100224369
392 Ga0307416_100302307
393 Ga0307416_100325537
394 Ga0307414_10233320
395 Ga0307411_10126218
396 Ga0316580_10028550
397 Ga0316574_0114466
398 Ga0316582_0089749
399 Ga0316582_0089961
400 Ga0316582_0105515
401 Ga0316582_0106570
402 Ga0316582_0119308
403 Ga0316582_0121747
404 Ga0316582_0131738
405 Ga0316582_0155589
406 Ga0316584_0114403
407 Ga0316584_0145274
408 Ga0316584_0162491
409 Ga0316584_0188262
410 Ga0316581_0030284
411 Ga0395901_0318474
412 Ga0400484_02976
413 Ga0400484_04647
414 Ga0400484_25941
415 Ga0400490_46866
416 Ga0400490_57330
417 Ga0400491_23290
418 Ga0400485_18548
419 Ga0400488_03826
420 Ga0400488_22002
421 Ga0400488_51713
422 Ga0400488_54167
423 Ga0400486_20300
424 Ga0400483_009914
425 Ga0400483_110801
426 Ga0400483_114223
427 Ga0400483_214805
428 Ga0400483_275369
429 Ga0400483_283440
430 Ga0400489_74473
431 Ga0400489_74789
432 Ga0436362_0623447
433 Ga0439448_0020638
434 Ga0439448_0046021
435 Ga0439463_030955
436 Ga0439444_0004733
437 Ga0439464_0024167
438 Ga0439460_0045535
439 Ga0439440_0028603
440 Ga0466969_0027241
441 Ga0466966_0105209
442 Ga0466957_0122884
443 Ga0466960_0014280
444 Ga0466959_0091344
445 Ga0466958_0115336
446 Ga0501072_0107062
447 Ga0501075_0116070
448 Ga0501077_0079645
449 Ga0501035_0123600
450 Ga0501045_0167007
451 nmdc:mga05p37_107845_c1
452 nmdc:mga05p37_146558_c1
453 nmdc:mga05p37_213007_c1
454 nmdc:mga05p37_262847_c1
455 nmdc:mga05p37_346603_c1
456 nmdc:mga05p37_416049_c1
457 nmdc:mga05p37_432498_c1
458 nmdc:mga09592_118568_c1
459 nmdc:mga09592_181043_c1
460 nmdc:mga09592_201061_c1
461 nmdc:mga09592_218231_c1
462 nmdc:mga09592_230497_c1
463 nmdc:mga09592_243428_c1
464 nmdc:mga09592_281078_c1
465 nmdc:mga0qj67_171493_c1
466 nmdc:mga0qj67_208730_c1
467 nmdc:mga0qj67_23983_c1
468 nmdc:mga0qj67_34169_c1
469 nmdc:mga0qj67_43035_c1
470 nmdc:mga0qj67_45521_c1
471 nmdc:mga0qj67_48501_c1
472 nmdc:mga0qj67_52973_c1
473 nmdc:mga0qj67_96903_c1
474 nmdc:mga06r32_122795_c1
475 nmdc:mga06r32_252403_c1
476 nmdc:mga06r32_259467_c1
477 nmdc:mga06r32_277879_c1
478 nmdc:mga06r32_310831_c1
479 nmdc:mga06r32_310833_c1
480 nmdc:mga06r32_337961_c1
481 nmdc:mga06r32_46601_c1
482 nmdc:mga08y16_239941_c1
483 nmdc:mga08y16_264694_c1
484 nmdc:mga08y16_283473_c1
485 nmdc:mga08y16_369810_c1
486 nmdc:mga08y16_65828_c1
487 nmdc:mga0n895_138673_c1
488 nmdc:mga0n895_151462_c1
489 nmdc:mga0n895_169146_c1
490 nmdc:mga0a205_125600_c1
491 nmdc:mga0a205_168528_c1
492 nmdc:mga0a205_173256_c1
493 nmdc:mga0a205_232411_c1
494 nmdc:mga0a205_290096_c1
495 nmdc:mga0a205_94228_c1
496 Ga0530510_0039054

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13546

DDE_5

DDE superfamily endonuclease

37

310

0.94

PF01609

DDE_Tnp_1

Transposase DDE domain

195

409

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dm0-assembly1.cif.gz_A-2 tn5 transposase: 20mer outside end 2 mn complex 0.6517 28 411
3ecp-assembly1.cif.gz_A-2 crystal structure of tn5 transposase complexed with 5' phosphorylated transposon end dna 0.6374 28 414
1muh-assembly1.cif.gz_A-2 crystal structure of tn5 transposase complexed with transposon end dna 0.6249 30 410
1mus-assembly1.cif.gz_A-2 crystal structure of tn5 transposase complexed with resolved outside end dna 0.6197 28 418
1b7e-assembly1.cif.gz_A-2 transposase inhibitor 0.6075 94 410
ID Description Score Start End Superfamily
1b7eA01 Alpha Beta;Alpha-Beta Complex;Transposase Inhibitor Protein From Tn5; Chain A, domain 1;Transposase Inhibitor Protein From Tn5; Chain A, domain 1 0.6499 93 384 3.90.350.10
1b7eA01 Alpha Beta;Alpha-Beta Complex;Transposase Inhibitor Protein From Tn5; Chain A, domain 1;Transposase Inhibitor Protein From Tn5; Chain A, domain 1 0.6318 93 384 3.90.350.10
af_P03835_124_352_3.90.350.10 Alpha Beta;Alpha-Beta Complex;Transposase Inhibitor Protein From Tn5; Chain A, domain 1;Transposase Inhibitor Protein From Tn5; Chain A, domain 1 0.6182 111 406 3.90.350.10
af_P03835_124_352_3.90.350.10 Alpha Beta;Alpha-Beta Complex;Transposase Inhibitor Protein From Tn5; Chain A, domain 1;Transposase Inhibitor Protein From Tn5; Chain A, domain 1 0.6039 111 406 3.90.350.10
af_I1J6P3_3_256_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.5783 195 244 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A5N7MZ11-F1-model_v4 IS701 family transposase 0.945 42 227
AF-A0A7Z9X066-F1-model_v4 IS701 family transposase 0.9444 6 429
AF-A0A2M7SHR3-F1-model_v4 IS701 family transposase ISGur14 0.9423 31 226
AF-A0A7Z9X066-F1-model_v4 IS701 family transposase 0.9422 6 429
AF-W4LVV8-F1-model_v4 Transposase IS701-like DDE domain-containing protein 0.9405 14 418

Map