F360027

General Info

Members Datasets Scaffolds Average Seq Length
248 187 245 73

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0073953|Ga0373934_0073953_957_1208
Length 83
Sequence MEGSISNQIRILRFHHGEMSQAELGQRIGVTRQTIAAIEAGKYSPSLEAAFRIAHVFGVPLGEVFQWNTSGTPLKEIPNFRLP

Samples

Sample ID Description Type Environment
1 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
2 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
3 2643221593 Lysobacter sp. Root690 Isolate Unclassified
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
98 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
143 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
182 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
183 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
184 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.98
Metatranscriptomes 0.81
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.27
Nodule 0
Rhizoplane 4.84
Rhizosphere 77.82
Stem 0
Stem Tuber 0
Unclassified 8.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10058213 3300003215 Bacteria 1064
2 rootH1_10041296 3300003323 Bacteria 1377
3 rootH1_10301457 3300003323 Bacteria 4529
4 Ga0055542_1029240 3300003762 Bacteria 719
5 Ga0055530_10001918 3300003791 Bacteria 14199
6 Ga0055531_10006706 3300003794 Bacteria 6446
7 Ga0055543_1012303 3300004625 Bacteria 1726
8 Ga0065165_1001889 3300005262 Bacteria 20208
9 Ga0070658_10144636 3300005327 Bacteria 1987
10 Ga0070658_10360656 3300005327 Bacteria 1245
11 Ga0070683_100987552 3300005329 Bacteria 808
12 Ga0070670_101637622 3300005331 Bacteria 592
13 Ga0070680_100083273 3300005336 Bacteria 2641
14 Ga0070682_102068667 3300005337 Bacteria 502
15 Ga0070660_100088153 3300005339 Bacteria 2443
16 Ga0070659_100410890 3300005366 Bacteria 1144
17 Ga0070714_100020519 3300005435 Bacteria 5397
18 Ga0070713_102379556 3300005436 Unclassified 512
19 Ga0070711_101974278 3300005439 Bacteria 513
20 Ga0070678_100516661 3300005456 Bacteria 1056
21 Ga0070678_102303233 3300005456 Bacteria 511
22 Ga0070662_100054384 3300005457 Bacteria 2901
23 Ga0070685_10013687 3300005466 Bacteria 4285
24 Ga0068853_100088347 3300005539 Bacteria 2721
25 Ga0068853_101137346 3300005539 Bacteria 753
26 Ga0068853_101655635 3300005539 Bacteria 620
27 Ga0070665_100000622 3300005548 Bacteria 48397
28 Ga0070665_100006253 3300005548 Bacteria 12181
29 Ga0068855_100058722 3300005563 Bacteria 4503
30 Ga0068855_100383477 3300005563 Bacteria 1543
31 Ga0070664_102382889 3300005564 Bacteria 502
32 Ga0068852_101633479 3300005616 Bacteria 667
33 Ga0068859_100465383 3300005617 Bacteria 1360
34 Ga0068864_100062113 3300005618 Bacteria 3236
35 Ga0068864_100246946 3300005618 Bacteria 1655
36 Ga0068862_101883137 3300005844 Bacteria 608
37 Ga0070717_10356869 3300006028 Unclassified 1308
38 Ga0075430_101129467 3300006846 Bacteria 645
39 Ga0068865_100000601 3300006881 Bacteria 20228
40 Ga0097620_100465418 3300006931 Bacteria 1360
41 Ga0099794_10793525 3300007265 Bacteria 507
42 Ga0105240_10003686 3300009093 Bacteria 23693
43 Ga0105240_10110244 3300009093 Bacteria 3332
44 Ga0105241_10941682 3300009174 Bacteria 804
45 Ga0105241_12008074 3300009174 Bacteria 569
46 Ga0105242_10312673 3300009176 Bacteria 1438
47 Ga0105248_10000097 3300009177 Bacteria 97424
48 Ga0105237_10072823 3300009545 Bacteria 3429
49 Ga0105237_10264019 3300009545 Bacteria 1724
50 Ga0105238_10011518 3300009551 Bacteria 8909
51 Ga0105238_10152383 3300009551 Bacteria 2287
52 Ga0105238_10226698 3300009551 Bacteria 1845
53 Ga0105238_10245229 3300009551 Bacteria 1769
54 Ga0105249_10181310 3300009553 Bacteria 2049
55 Ga0105249_11279691 3300009553 Bacteria 805
56 Ga0105239_12193997 3300010375 Bacteria 642
57 Ga0157370_11152444 3300013104 Bacteria 700
58 Ga0157374_10134343 3300013296 Bacteria 2397
59 Ga0157374_12643409 3300013296 Bacteria 530
60 Ga0163162_10172128 3300013306 Bacteria 2290
61 Ga0163162_10943679 3300013306 Bacteria 974
62 Ga0163162_12343850 3300013306 Bacteria 613
63 Ga0157372_10362897 3300013307 Bacteria 1688
64 Ga0157372_11987413 3300013307 Unclassified 668
65 Ga0157375_10200604 3300013308 Bacteria 2151
66 Ga0157375_10294899 3300013308 Bacteria 1785
67 Ga0163163_10004247 3300014325 Bacteria 12211
68 Ga0163163_10029894 3300014325 Bacteria 5243
69 Ga0163163_10131984 3300014325 Bacteria 2538
70 Ga0163163_10384001 3300014325 Bacteria 1462
71 Ga0163163_10961234 3300014325 Bacteria 917
72 Ga0182008_10214371 3300014497 Bacteria 983
73 Ga0157376_10707447 3300014969 Bacteria 1013
74 Ga0213873_10063464 3300021358 Unclassified 1004
75 Ga0213873_10171382 3300021358 Unclassified 662
76 Ga0213872_10000287 3300021361 Bacteria 43203
77 Ga0213876_10021026 3300021384 Bacteria 3450
78 Ga0213876_10649461 3300021384 Unclassified 561
79 Ga0213875_10000083 3300021388 Bacteria 109856
80 Ga0209674_102098 3300025226 Bacteria 4520
81 Ga0207427_116233 3300025231 Bacteria 698
82 Ga0209437_107515 3300025233 Bacteria 1769
83 Ga0209437_108735 3300025233 Bacteria 1609
84 Ga0207425_1001338 3300025245 Bacteria 10576
85 Ga0209148_1001074 3300025254 Bacteria 16668
86 Ga0209676_1000034 3300025292 Bacteria 460125
87 Ga0209025_1000030 3300025294 Bacteria 441196
88 Ga0209758_1000424 3300025297 Bacteria 71558
89 Ga0209758_1008044 3300025297 Bacteria 6960
90 Ga0209050_1002653 3300025298 Bacteria 14650
91 Ga0209257_1000775 3300025304 Bacteria 47326
92 Ga0207680_10353944 3300025903 Bacteria 1032
93 Ga0207705_10074831 3300025909 Bacteria 2459
94 Ga0207705_10663923 3300025909 Bacteria 811
95 Ga0207695_10002462 3300025913 Bacteria 27332
96 Ga0207695_10010910 3300025913 Bacteria 11053
97 Ga0207695_10045382 3300025913 Bacteria 4665
98 Ga0207695_10310899 3300025913 Bacteria 1466
99 Ga0207695_10762049 3300025913 Bacteria 848
100 Ga0207671_10142572 3300025914 Bacteria 1847
101 Ga0207660_10356932 3300025917 Bacteria 1172
102 Ga0207657_10024196 3300025919 Bacteria 5635
103 Ga0207694_10010271 3300025924 Bacteria 7058
104 Ga0207694_10038157 3300025924 Bacteria 3693
105 Ga0207694_10917151 3300025924 Bacteria 741
106 Ga0207650_10409800 3300025925 Bacteria 1123
107 Ga0207650_11888649 3300025925 Bacteria 505
108 Ga0207700_10508866 3300025928 Bacteria 1066
109 Ga0207664_10063061 3300025929 Bacteria 2961
110 Ga0207644_10361777 3300025931 Bacteria 1180
111 Ga0207686_10075925 3300025934 Bacteria 2177
112 Ga0207686_10090277 3300025934 Bacteria 2021
113 Ga0207704_10000806 3300025938 Bacteria 13840
114 Ga0207711_10000267 3300025941 Bacteria 56315
115 Ga0207689_10947135 3300025942 Bacteria 726
116 Ga0207661_11481307 3300025944 Bacteria 622
117 Ga0207667_10094739 3300025949 Bacteria 3082
118 Ga0207667_10271084 3300025949 Bacteria 1735
119 Ga0207651_10056691 3300025960 Bacteria 2698
120 Ga0207703_11935116 3300026035 Bacteria 566
121 Ga0207639_10981076 3300026041 Bacteria 791
122 Ga0207639_11439213 3300026041 Bacteria 647
123 Ga0207639_11903157 3300026041 Bacteria 556
124 Ga0207702_10444925 3300026078 Bacteria 1256
125 Ga0207641_12462200 3300026088 Bacteria 519
126 Ga0207676_10009193 3300026095 Bacteria 7034
127 Ga0207683_10509723 3300026121 Bacteria 1111
128 Ga0207698_10189383 3300026142 Bacteria 1831
129 Ga0265357_1010832 3300028023 Unclassified 922
130 Ga0268266_10000621 3300028379 Bacteria 48218
131 Ga0268266_10028931 3300028379 Bacteria 4709
132 Ga0268265_11083924 3300028380 Bacteria 795
133 Ga0268265_12528236 3300028380 Bacteria 519
134 Ga0307517_10046203 3300028786 Bacteria 4553
135 Ga0265338_10003528 3300028800 Bacteria 21909
136 Ga0307511_10043455 3300030521 Bacteria 3755
137 Ga0265760_10001099 3300031090 Bacteria 7862
138 Ga0265760_10174088 3300031090 Bacteria 716
139 Ga0265328_10302674 3300031239 Bacteria 617
140 Ga0265325_10088016 3300031241 Bacteria 1535
141 Ga0265339_10000379 3300031249 Bacteria 35004
142 Ga0265339_10021043 3300031249 Bacteria 3803
143 Ga0307513_10462659 3300031456 Bacteria 991
144 Ga0307509_10554224 3300031507 Bacteria 827
145 Ga0307408_100493958 3300031548 Bacteria 1070
146 Ga0307508_10323201 3300031616 Bacteria 1135
147 Ga0265314_10016946 3300031711 Bacteria 5735
148 Ga0265342_10002587 3300031712 Bacteria 15495
149 Ga0307413_10499335 3300031824 Bacteria 976
150 Ga0307410_10322447 3300031852 Bacteria 1226
151 Ga0307406_10159254 3300031901 Bacteria 1621
152 Ga0307407_10839827 3300031903 Bacteria 701
153 Ga0307412_12278937 3300031911 Bacteria 505
154 Ga0307409_100066317 3300031995 Bacteria 2846
155 Ga0307414_10083155 3300032004 Bacteria 2350
156 Ga0307411_10045186 3300032005 Bacteria 2832
157 Ga0316212_1008755 3300033547 Unclassified 1454
158 Ga0373934_0073953 3300035086 Bacteria 1365
159 Ga0373936_0002772 3300035113 Bacteria 6533
160 Ga0373935_1137847 3300035692 Bacteria 581
161 Ga0373933_0917973 3300035724 Unclassified 577
162 Ga0373937_0029292 3300036401 Bacteria 4985
163 Ga0395905_1892531 3300037471 Bacteria 503
164 Ga0436364_0079644 3300037853 Bacteria 315114
165 Ga0395901_0960454 3300038443 Unclassified 833
166 Ga0436365_0422889 3300039437 Bacteria 2349
167 Ga0436365_1669369 3300039437 Bacteria 2222
168 Ga0436360_0211267 3300039438 Bacteria 1381
169 Ga0436361_0507512 3300039447 Bacteria 63188
170 Ga0436363_0035669 3300039450 Unclassified 4768
171 Ga0436363_1186630 3300039450 Bacteria 521
172 Ga0436362_0135419 3300039453 Bacteria 2274
173 Ga0436362_0842514 3300039453 Bacteria 1110
174 Ga0436362_1149345 3300039453 Unclassified 865
175 Ga0439465_0324971 3300041413 Bacteria 578
176 Ga0451841_0286061 3300041498 Bacteria 574
177 Ga0466966_0502880 3300044684 Bacteria 729
178 Ga0466963_0831732 3300044694 Bacteria 651
179 Ga0466971_0537183 3300044719 Unclassified 579
180 Ga0466957_0012014 3300044842 Bacteria 5006
181 Ga0466959_0470628 3300045049 Bacteria 851
182 Ga0466958_0012493 3300045836 Unclassified 4813
183 Ga0466958_0043273 3300045836 Unclassified 2712
184 Ga0495638_0000029 3300046460 Bacteria 330201
185 Ga0495638_0381267 3300046460 Bacteria 736
186 Ga0495583_0001937 3300046506 Bacteria 19128
187 Ga0495583_0097167 3300046506 Bacteria 1261
188 Ga0495632_0001572 3300046519 Bacteria 18841
189 Ga0495648_0000020 3300046524 Bacteria 254330
190 Ga0495642_0021492 3300046528 Bacteria 2538
191 Ga0495642_0122572 3300046528 Bacteria 1116
192 Ga0495654_0174643 3300046530 Bacteria 934
193 Ga0495645_0511788 3300046543 Unclassified 749
194 Ga0495633_0524663 3300046558 Bacteria 534
195 Ga0495668_0242935 3300046616 Bacteria 986
196 Ga0495668_0546495 3300046616 Bacteria 639
197 Ga0495611_0025972 3300046648 Bacteria 2554
198 Ga0495625_0090299 3300046660 Bacteria 2119
199 Ga0495625_0435949 3300046660 Bacteria 812
200 Ga0495669_0027359 3300046684 Bacteria 2495
201 Ga0495669_0080994 3300046684 Bacteria 1490
202 Ga0495670_0000002 3300046691 Bacteria 601814
203 Ga0495670_0556463 3300046691 Bacteria 624
204 Ga0495671_0000022 3300046692 Bacteria 255591
205 Ga0495672_0066480 3300047320 Bacteria 2057
206 Ga0495672_0481142 3300047320 Bacteria 555
207 Ga0495687_166602 3300047443 Bacteria 735
208 Ga0495675_0050222 3300047444 Unclassified 2651
209 Ga0495673_0000051 3300047469 Bacteria 255511
210 Ga0495686_0077793 3300047472 Bacteria 2031
211 Ga0495686_0170874 3300047472 Bacteria 1264
212 Ga0496101_0620733 3300048904 Bacteria 855
213 Ga0496101_1050303 3300048904 Bacteria 640
214 Ga0496103_0073226 3300048906 Bacteria 2146
215 Ga0496104_0064675 3300048907 Bacteria 3470
216 Ga0496105_1029700 3300048908 Bacteria 614
217 Ga0496106_0070915 3300048909 Bacteria 2662
218 Ga0496107_0163375 3300048910 Bacteria 1651
219 Ga0496108_0076235 3300048911 Bacteria 2834
220 Ga0496110_0227112 3300048913 Bacteria 1698
221 Ga0496112_0090347 3300048915 Bacteria 3031
222 Ga0496115_0069217 3300048918 Bacteria 2858
223 Ga0496115_0309234 3300048918 Bacteria 1294
224 Ga0501031_0243315 3300049568 Bacteria 1169
225 Ga0501034_0043840 3300049571 Bacteria 4525
226 Ga0501048_0574455 3300049582 Bacteria 809
227 Ga0501069_0008689 3300049585 Bacteria 5349
228 Ga0501070_0837973 3300049586 Bacteria 720
229 Ga0501071_1550123 3300049587 Unclassified 511
230 Ga0501072_0135591 3300049588 Bacteria 1963
231 Ga0501073_0740429 3300049589 Unclassified 678
232 Ga0501074_0027168 3300049590 Bacteria 4149
233 Ga0501074_1069034 3300049590 Bacteria 567
234 Ga0501075_0148315 3300049591 Bacteria 1788
235 Ga0501077_0386251 3300049593 Bacteria 894
236 Ga0501079_0146337 3300049741 Bacteria 1841
237 Ga0501080_0166208 3300049742 Bacteria 2036
238 nmdc:mga0k408_427637_c1 3300050493 Bacteria 787
239 Ga0500644_0064929 3300053088 Bacteria 1298
240 Ga0500595_011186 3300053119 Bacteria 3525
241 Ga0500559_0499350 3300053136 Bacteria 559
242 Ga0500588_0084050 3300053146 Bacteria 1070
243 Ga0501084_0061537 3300054114 Bacteria 3143
244 Ga0501082_0444813 3300060353 Bacteria 1132
245 Ga0530510_1412090 3300061734 Unclassified 534

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10144636 Ga0070658_101446364 66
2 3300005339 Ga0070660_100088153 Ga0070660_1000881533 66
3 3300005366 Ga0070659_100410890 Ga0070659_1004108902 66
4 3300005548 Ga0070665_100000622 Ga0070665_10000062225 66
5 3300009093 Ga0105240_10110244 Ga0105240_101102445 66
6 3300009551 Ga0105238_10152383 Ga0105238_101523834 66
7 3300009553 Ga0105249_11279691 Ga0105249_112796912 66
8 3300025909 Ga0207705_10074831 Ga0207705_100748314 66
9 3300025913 Ga0207695_10310899 Ga0207695_103108992 66
10 3300025919 Ga0207657_10024196 Ga0207657_100241965 66
11 3300025924 Ga0207694_10010271 Ga0207694_100102715 66
12 3300028379 Ga0268266_10000621 Ga0268266_1000062125 66
13 3300030521 Ga0307511_10043455 Ga0307511_100434553 66
14 3300037471 Ga0395905_1892531 Ga0395905_1892531_272_481 66
15 3300053119 Ga0500595_011186 Ga0500595_011186_2968_3177 66
16 3300005329 Ga0070683_100987552 Ga0070683_1009875522 67
17 3300005539 Ga0068853_101137346 Ga0068853_1011373462 67
18 3300025944 Ga0207661_11481307 Ga0207661_114813072 67
19 3300026041 Ga0207639_10981076 Ga0207639_109810762 67
20 iso_pu_bacteria 2643221588 2643950106 67
21 3300048918 Ga0496115_0309234 Ga0496115_0309234_646_861 68
22 3300049585 Ga0501069_0008689 Ga0501069_0008689_173_382 68
23 3300049586 Ga0501070_0837973 Ga0501070_0837973_358_567 68
24 3300049590 Ga0501074_1069034 Ga0501074_1069034_345_554 68
25 3300003323 rootH1_10301457 rootH1_103014573 69
26 3300003791 Ga0055530_10001918 Ga0055530_100019187 69
27 3300003794 Ga0055531_10006706 Ga0055531_100067065 69
28 3300004625 Ga0055543_1012303 Ga0055543_10123032 69
29 3300005262 Ga0065165_1001889 Ga0065165_100188919 69
30 3300005331 Ga0070670_101637622 Ga0070670_1016376222 69
31 3300005466 Ga0070685_10013687 Ga0070685_100136874 69
32 3300005616 Ga0068852_101633479 Ga0068852_1016334792 69
33 3300005618 Ga0068864_100246946 Ga0068864_1002469462 69
34 3300005844 Ga0068862_101883137 Ga0068862_1018831372 69
35 3300006846 Ga0075430_101129467 Ga0075430_1011294672 69
36 3300006881 Ga0068865_100000601 Ga0068865_1000006015 69
37 3300007265 Ga0099794_10793525 Ga0099794_107935252 69
38 3300009093 Ga0105240_10003686 Ga0105240_1000368626 69
39 3300009174 Ga0105241_10941682 Ga0105241_109416822 69
40 3300009177 Ga0105248_10000097 Ga0105248_10000097102 69
41 3300009545 Ga0105237_10264019 Ga0105237_102640194 69
42 3300009551 Ga0105238_10245229 Ga0105238_102452294 69
43 3300009553 Ga0105249_10181310 Ga0105249_101813101 69
44 3300013306 Ga0163162_10943679 Ga0163162_109436792 69
45 3300013308 Ga0157375_10294899 Ga0157375_102948992 69
46 3300014325 Ga0163163_10004247 Ga0163163_100042474 69
47 3300014325 Ga0163163_10029894 Ga0163163_100298945 69
48 3300021388 Ga0213875_10000083 Ga0213875_100000834 69
49 3300025292 Ga0209676_1000034 Ga0209676_1000034165 69
50 3300025297 Ga0209758_1000424 Ga0209758_100042443 69
51 3300025298 Ga0209050_1002653 Ga0209050_10026538 69
52 3300025304 Ga0209257_1000775 Ga0209257_100077515 69
53 3300025913 Ga0207695_10002462 Ga0207695_1000246223 69
54 3300025913 Ga0207695_10045382 Ga0207695_100453824 69
55 3300025925 Ga0207650_11888649 Ga0207650_118886492 69
56 3300025938 Ga0207704_10000806 Ga0207704_100008063 69
57 3300025941 Ga0207711_10000267 Ga0207711_100002675 69
58 3300025942 Ga0207689_10947135 Ga0207689_109471352 69
59 3300026088 Ga0207641_12462200 Ga0207641_124622002 69
60 3300028380 Ga0268265_11083924 Ga0268265_110839241 69
61 3300028380 Ga0268265_12528236 Ga0268265_125282361 69
62 3300031456 Ga0307513_10462659 Ga0307513_104626592 69
63 3300031548 Ga0307408_100493958 Ga0307408_1004939582 69
64 3300031616 Ga0307508_10323201 Ga0307508_103232013 69
65 3300031824 Ga0307413_10499335 Ga0307413_104993352 69
66 3300031852 Ga0307410_10322447 Ga0307410_103224473 69
67 3300031901 Ga0307406_10159254 Ga0307406_101592542 69
68 3300031903 Ga0307407_10839827 Ga0307407_108398272 69
69 3300031911 Ga0307412_12278937 Ga0307412_122789372 69
70 3300031995 Ga0307409_100066317 Ga0307409_1000663173 69
71 3300032004 Ga0307414_10083155 Ga0307414_100831552 69
72 3300032005 Ga0307411_10045186 Ga0307411_100451863 69
73 3300035113 Ga0373936_0002772 Ga0373936_0002772_5153_5362 69
74 3300037853 Ga0436364_0079644 Ga0436364_0079644_208779_208997 69
75 3300041413 Ga0439465_0324971 Ga0439465_0324971_227_439 69
76 3300044684 Ga0466966_0502880 Ga0466966_0502880_437_649 69
77 3300046528 Ga0495642_0021492 Ga0495642_0021492_748_972 69
78 3300046616 Ga0495668_0546495 Ga0495668_0546495_269_481 69
79 3300046660 Ga0495625_0090299 Ga0495625_0090299_54_272 69
80 3300046684 Ga0495669_0080994 Ga0495669_0080994_552_776 69
81 3300046691 Ga0495670_0556463 Ga0495670_0556463_75_299 69
82 3300047443 Ga0495687_166602 Ga0495687_166602_323_547 69
83 3300048918 Ga0496115_0069217 Ga0496115_0069217_2557_2778 69
84 3300049568 Ga0501031_0243315 Ga0501031_0243315_496_708 69
85 3300049571 Ga0501034_0043840 Ga0501034_0043840_1652_1864 69
86 3300049582 Ga0501048_0574455 Ga0501048_0574455_453_665 69
87 3300049587 Ga0501071_1550123 Ga0501071_1550123_106_318 69
88 3300049588 Ga0501072_0135591 Ga0501072_0135591_379_591 69
89 3300049589 Ga0501073_0740429 Ga0501073_0740429_267_479 69
90 3300049590 Ga0501074_0027168 Ga0501074_0027168_3438_3650 69
91 3300049591 Ga0501075_0148315 Ga0501075_0148315_406_618 69
92 3300049593 Ga0501077_0386251 Ga0501077_0386251_320_532 69
93 3300049741 Ga0501079_0146337 Ga0501079_0146337_1206_1418 69
94 3300049742 Ga0501080_0166208 Ga0501080_0166208_1746_1958 69
95 3300050493 nmdc:mga0k408_427637_c1 nmdc:mga0k408_427637_c1_517_729 69
96 3300053136 Ga0500559_0499350 Ga0500559_0499350_217_429 69
97 3300053146 Ga0500588_0084050 Ga0500588_0084050_420_632 69
98 3300054114 Ga0501084_0061537 Ga0501084_0061537_250_462 69
99 3300060353 Ga0501082_0444813 Ga0501082_0444813_905_1117 69
100 3300061734 Ga0530510_1412090 Ga0530510_1412090_202_414 69
101 iso_pu_bacteria 2643221593 2643977313 69
102 3300005337 Ga0070682_102068667 Ga0070682_1020686672 70
103 3300005456 Ga0070678_102303233 Ga0070678_1023032332 70
104 3300005548 Ga0070665_100006253 Ga0070665_1000062534 70
105 3300009176 Ga0105242_10312673 Ga0105242_103126732 70
106 3300013306 Ga0163162_12343850 Ga0163162_123438501 70
107 3300013307 Ga0157372_10362897 Ga0157372_103628973 70
108 3300021361 Ga0213872_10000287 Ga0213872_1000028711 70
109 3300025925 Ga0207650_10409800 Ga0207650_104098002 70
110 3300025934 Ga0207686_10075925 Ga0207686_100759253 70
111 3300025934 Ga0207686_10090277 Ga0207686_100902772 70
112 3300026078 Ga0207702_10444925 Ga0207702_104449252 70
113 3300028379 Ga0268266_10028931 Ga0268266_100289314 70
114 3300031507 Ga0307509_10554224 Ga0307509_105542242 70
115 3300039447 Ga0436361_0507512 Ga0436361_0507512_50268_50480 70
116 3300041498 Ga0451841_0286061 Ga0451841_0286061_286_501 70
117 3300046460 Ga0495638_0000029 Ga0495638_0000029_11180_11395 70
118 3300046506 Ga0495583_0001937 Ga0495583_0001937_7784_7999 70
119 3300046519 Ga0495632_0001572 Ga0495632_0001572_7761_7976 70
120 3300046524 Ga0495648_0000020 Ga0495648_0000020_11197_11412 70
121 3300046528 Ga0495642_0122572 Ga0495642_0122572_262_483 70
122 3300046530 Ga0495654_0174643 Ga0495654_0174643_54_275 70
123 3300046543 Ga0495645_0511788 Ga0495645_0511788_115_330 70
124 3300046558 Ga0495633_0524663 Ga0495633_0524663_243_458 70
125 3300046616 Ga0495668_0242935 Ga0495668_0242935_319_534 70
126 3300046648 Ga0495611_0025972 Ga0495611_0025972_2140_2361 70
127 3300046684 Ga0495669_0027359 Ga0495669_0027359_369_590 70
128 3300046691 Ga0495670_0000002 Ga0495670_0000002_42825_43040 70
129 3300046692 Ga0495671_0000022 Ga0495671_0000022_11265_11480 70
130 3300047320 Ga0495672_0066480 Ga0495672_0066480_616_843 70
131 3300047320 Ga0495672_0481142 Ga0495672_0481142_133_348 70
132 3300047469 Ga0495673_0000051 Ga0495673_0000051_244132_244347 70
133 3300047472 Ga0495686_0077793 Ga0495686_0077793_1518_1742 70
134 3300047472 Ga0495686_0170874 Ga0495686_0170874_15_239 70
135 3300048904 Ga0496101_1050303 Ga0496101_1050303_280_492 70
136 3300053088 Ga0500644_0064929 Ga0500644_0064929_547_762 70
137 iso_pu_bacteria 2593339238 2595447887 70
138 3300005563 Ga0068855_100383477 Ga0068855_1003834772 71
139 3300009174 Ga0105241_12008074 Ga0105241_120080742 71
140 3300009545 Ga0105237_10072823 Ga0105237_100728234 71
141 3300009551 Ga0105238_10011518 Ga0105238_100115185 71
142 3300025913 Ga0207695_10762049 Ga0207695_107620492 71
143 3300025914 Ga0207671_10142572 Ga0207671_101425722 71
144 3300025924 Ga0207694_10038157 Ga0207694_100381575 71
145 3300025928 Ga0207700_10508866 Ga0207700_105088663 71
146 3300025949 Ga0207667_10271084 Ga0207667_102710843 71
147 3300026041 Ga0207639_11903157 Ga0207639_119031571 71
148 3300031090 Ga0265760_10174088 Ga0265760_101740882 71
149 3300039453 Ga0436362_1149345 Ga0436362_1149345_488_706 71
150 3300003323 rootH1_10041296 rootH1_100412963 72
151 3300005327 Ga0070658_10360656 Ga0070658_103606563 72
152 3300005439 Ga0070711_101974278 Ga0070711_1019742782 72
153 3300005456 Ga0070678_100516661 Ga0070678_1005166612 72
154 3300005457 Ga0070662_100054384 Ga0070662_1000543844 72
155 3300005539 Ga0068853_101655635 Ga0068853_1016556352 72
156 3300005564 Ga0070664_102382889 Ga0070664_1023828892 72
157 3300005617 Ga0068859_100465383 Ga0068859_1004653832 72
158 3300005618 Ga0068864_100062113 Ga0068864_1000621134 72
159 3300006028 Ga0070717_10356869 Ga0070717_103568694 72
160 3300006931 Ga0097620_100465418 Ga0097620_1004654182 72
161 3300010375 Ga0105239_12193997 Ga0105239_121939971 72
162 3300013104 Ga0157370_11152444 Ga0157370_111524442 72
163 3300013296 Ga0157374_10134343 Ga0157374_101343433 72
164 3300013296 Ga0157374_12643409 Ga0157374_126434092 72
165 3300013306 Ga0163162_10172128 Ga0163162_101721283 72
166 3300013307 Ga0157372_11987413 Ga0157372_119874131 72
167 3300013308 Ga0157375_10200604 Ga0157375_102006044 72
168 3300014325 Ga0163163_10131984 Ga0163163_101319843 72
169 3300014325 Ga0163163_10384001 Ga0163163_103840013 72
170 3300014325 Ga0163163_10961234 Ga0163163_109612341 72
171 3300014969 Ga0157376_10707447 Ga0157376_107074472 72
172 3300025903 Ga0207680_10353944 Ga0207680_103539441 72
173 3300025909 Ga0207705_10663923 Ga0207705_106639232 72
174 3300025924 Ga0207694_10917151 Ga0207694_109171512 72
175 3300025931 Ga0207644_10361777 Ga0207644_103617772 72
176 3300025960 Ga0207651_10056691 Ga0207651_100566914 72
177 3300026035 Ga0207703_11935116 Ga0207703_119351162 72
178 3300026041 Ga0207639_11439213 Ga0207639_114392131 72
179 3300026095 Ga0207676_10009193 Ga0207676_100091934 72
180 3300026121 Ga0207683_10509723 Ga0207683_105097232 72
181 3300026142 Ga0207698_10189383 Ga0207698_101893832 72
182 3300028786 Ga0307517_10046203 Ga0307517_100462036 72
183 3300031241 Ga0265325_10088016 Ga0265325_100880162 72
184 3300035692 Ga0373935_1137847 Ga0373935_1137847_60_278 72
185 3300038443 Ga0395901_0960454 Ga0395901_0960454_332_553 72
186 3300045836 Ga0466958_0043273 Ga0466958_0043273_2038_2259 72
187 3300046460 Ga0495638_0381267 Ga0495638_0381267_14_241 72
188 3300046506 Ga0495583_0097167 Ga0495583_0097167_303_539 72
189 3300046660 Ga0495625_0435949 Ga0495625_0435949_59_295 72
190 3300048904 Ga0496101_0620733 Ga0496101_0620733_518_763 72
191 3300048906 Ga0496103_0073226 Ga0496103_0073226_1466_1711 72
192 3300048907 Ga0496104_0064675 Ga0496104_0064675_3187_3432 72
193 3300048908 Ga0496105_1029700 Ga0496105_1029700_296_541 72
194 3300048909 Ga0496106_0070915 Ga0496106_0070915_2265_2510 72
195 3300048910 Ga0496107_0163375 Ga0496107_0163375_1193_1438 72
196 3300048911 Ga0496108_0076235 Ga0496108_0076235_769_1014 72
197 3300048913 Ga0496110_0227112 Ga0496110_0227112_571_816 72
198 3300048915 Ga0496112_0090347 Ga0496112_0090347_375_620 72
199 3300003215 JGI25153J46596_10058213 JGI25153J46596_100582133 73
200 3300003762 Ga0055542_1029240 Ga0055542_10292402 73
201 3300005336 Ga0070680_100083273 Ga0070680_1000832734 73
202 3300005435 Ga0070714_100020519 Ga0070714_1000205197 73
203 3300005436 Ga0070713_102379556 Ga0070713_1023795561 73
204 3300005539 Ga0068853_100088347 Ga0068853_1000883473 73
205 3300005563 Ga0068855_100058722 Ga0068855_1000587223 73
206 3300009551 Ga0105238_10226698 Ga0105238_102266983 73
207 3300014497 Ga0182008_10214371 Ga0182008_102143712 73
208 3300021358 Ga0213873_10063464 Ga0213873_100634642 73
209 3300021358 Ga0213873_10171382 Ga0213873_101713822 73
210 3300021384 Ga0213876_10021026 Ga0213876_100210262 73
211 3300021384 Ga0213876_10649461 Ga0213876_106494612 73
212 3300025226 Ga0209674_102098 Ga0209674_1020987 73
213 3300025231 Ga0207427_116233 Ga0207427_1162332 73
214 3300025233 Ga0209437_107515 Ga0209437_1075154 73
215 3300025233 Ga0209437_108735 Ga0209437_1087353 73
216 3300025245 Ga0207425_1001338 Ga0207425_10013386 73
217 3300025254 Ga0209148_1001074 Ga0209148_10010744 73
218 3300025294 Ga0209025_1000030 Ga0209025_1000030199 73
219 3300025297 Ga0209758_1008044 Ga0209758_10080441 73
220 3300025913 Ga0207695_10010910 Ga0207695_100109106 73
221 3300025917 Ga0207660_10356932 Ga0207660_103569322 73
222 3300025929 Ga0207664_10063061 Ga0207664_100630613 73
223 3300025949 Ga0207667_10094739 Ga0207667_100947394 73
224 3300028023 Ga0265357_1010832 Ga0265357_10108322 73
225 3300028800 Ga0265338_10003528 Ga0265338_1000352820 73
226 3300031090 Ga0265760_10001099 Ga0265760_100010994 73
227 3300031239 Ga0265328_10302674 Ga0265328_103026742 73
228 3300031249 Ga0265339_10000379 Ga0265339_1000037937 73
229 3300031249 Ga0265339_10021043 Ga0265339_100210436 73
230 3300031711 Ga0265314_10016946 Ga0265314_100169467 73
231 3300031712 Ga0265342_10002587 Ga0265342_100025879 73
232 3300033547 Ga0316212_1008755 Ga0316212_10087552 73
233 3300035086 Ga0373934_0073953 Ga0373934_0073953_957_1208 73
234 3300035724 Ga0373933_0917973 Ga0373933_0917973_55_306 73
235 3300036401 Ga0373937_0029292 Ga0373937_0029292_3930_4181 73
236 3300039437 Ga0436365_0422889 Ga0436365_0422889_195_425 73
237 3300039437 Ga0436365_1669369 Ga0436365_1669369_1093_1317 73
238 3300039438 Ga0436360_0211267 Ga0436360_0211267_340_576 73
239 3300039450 Ga0436363_0035669 Ga0436363_0035669_4393_4617 73
240 3300039450 Ga0436363_1186630 Ga0436363_1186630_172_411 73
241 3300039453 Ga0436362_0135419 Ga0436362_0135419_1175_1405 73
242 3300039453 Ga0436362_0842514 Ga0436362_0842514_160_384 73
243 3300044694 Ga0466963_0831732 Ga0466963_0831732_195_425 73
244 3300044719 Ga0466971_0537183 Ga0466971_0537183_290_523 73
245 3300044842 Ga0466957_0012014 Ga0466957_0012014_322_555 73
246 3300045049 Ga0466959_0470628 Ga0466959_0470628_345_572 73
247 3300045836 Ga0466958_0012493 Ga0466958_0012493_3892_4125 73
248 3300047444 Ga0495675_0050222 Ga0495675_0050222_188_439 73

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

9

64

0.94

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

12

70

0.94

PF13560

HTH_31

Helix-turn-helix domain

5

66

0.91

PF04218

CENP-B_N

CENP-B N-terminal DNA-binding domain

7

44

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xj3-assembly1.cif.gz_A high resolution structure of the t55c mutant of cylr2. 0.9341 5 68
7t8i-assembly1.cif.gz_B crystal structure of the immr transcriptional regulator dna-binding domain of bacillus subtilis 0.9335 9 62
2xi8-assembly1.cif.gz_A high resolution structure of native cylr2 0.9325 5 68
3f51-assembly1.cif.gz_A crystal structure of the clp gene regulator clgr from corynebacterium glutamicum 0.9301 9 63
3u3w-assembly1.cif.gz_B crystal structure of bacillus thuringiensis plcr in complex with the peptide papr7 and dna 0.9285 9 61
ID Description Score Start End Superfamily
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9632 6 68 1.10.260.40
3f51C00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9314 9 63 1.10.260.40
3f51A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9301 9 63 1.10.260.40
3jxbD00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9286 9 61 1.10.260.40
3u3wB01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9285 9 61 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A7Y8IAC0-F1-model_v4 Helix-turn-helix transcriptional regulator 1.005 4 65 GO:0003677
AF-A0A0S8KX06-F1-model_v4 HTH cro/C1-type domain-containing protein 1.001 4 65 GO:0003677
AF-A0A6S6FY68-F1-model_v4 XRE family transcriptional regulator 1 5 69 GO:0003677
AF-A0A399RPD1-F1-model_v4 Transcriptional regulator 1 3 68 GO:0003677
AF-A0A6C1PC08-F1-model_v4 Transcriptional regulator 1 6 68 GO:0003677

Feature Viewer

pLDDT pTM Quality
93.9 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map