F359793

General Info

Members Datasets Scaffolds Average Seq Length
248 168 496 161

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100803341|Ga0075428_1008033412
Length 156
Sequence MTSLTEFSAPAIGGHDVDLSTYDGQVVLVVNTASECGFTPQYQGLQALFDEYADRGFTVLGFPCDQFGHQEPGDETEIAAFCERNYGVSFPMFGKIDVNGADAHPLFEWLRGQGGGDIEWNFTKFLVARDGRTVQRYATVVEPTQLTDDIEKALAD

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
102 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
103 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
104 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
105 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
106 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
112 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
148 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
149 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
158 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
159 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
162 2643221573 Lysobacter sp. Root604 Isolate Unclassified
163 2643221615 Nocardioides sp. Root224 Isolate Unclassified
164 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
165 2643221695 Lysobacter sp. Root494 Isolate Unclassified
166 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
167 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
168 2919085039 Luteibacter sp. 1214 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0
Isolates 2.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.6
Nodule 0
Rhizoplane 8.47
Rhizosphere 59.27
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100803341 3300006844 Bacteria 1000
2 JGI24739J22299_10011258 3300001989 Bacteria 3304
3 JGI24737J22298_10013479 3300001990 Bacteria 2660
4 JGI24735J21928_10029927 3300002067 Bacteria 1619
5 JGI25156J39149_1000214 3300002705 Bacteria 40310
6 JGI25157J39369_1000992 3300002741 Bacteria 13276
7 JGI25151J46595_10015104 3300003187 Bacteria 3419
8 Ga0055526_1008895 3300003771 Bacteria 4927
9 Ga0055526_1020126 3300003771 Bacteria 2393
10 Ga0055526_1033196 3300003771 Bacteria 1438
11 Ga0055537_1009559 3300003773 Bacteria 2125
12 Ga0055524_1001130 3300003775 Bacteria 16051
13 Ga0055536_1006409 3300003781 Bacteria 5505
14 Ga0055536_1008354 3300003781 Bacteria 4468
15 Ga0055536_1032498 3300003781 Bacteria 1348
16 Ga0055534_1000584 3300003784 Bacteria 19110
17 Ga0055534_1001032 3300003784 Bacteria 12182
18 Ga0055534_1021747 3300003784 Bacteria 1069
19 Ga0055530_10005440 3300003791 Bacteria 6056
20 Ga0055531_10008302 3300003794 Bacteria 5506
21 Ga0055531_10015705 3300003794 Bacteria 3316
22 Ga0055531_10029327 3300003794 Bacteria 1875
23 Ga0065165_1000790 3300005262 Bacteria 42379
24 Ga0065715_10001306 3300005293 Bacteria 7345
25 Ga0065715_10184477 3300005293 Bacteria 1454
26 Ga0070658_10006716 3300005327 Bacteria 9319
27 Ga0070666_10000003 3300005335 Bacteria 463666
28 Ga0070661_100009862 3300005344 Bacteria 6626
29 Ga0070671_100583983 3300005355 Bacteria 965
30 Ga0070667_100087945 3300005367 Bacteria 2667
31 Ga0070663_100915979 3300005455 Bacteria 758
32 Ga0070685_10640881 3300005466 Bacteria 769
33 Ga0068853_100079673 3300005539 Bacteria 2864
34 Ga0068855_100389100 3300005563 Bacteria 1530
35 Ga0068852_100573575 3300005616 Bacteria 1130
36 Ga0068859_100077113 3300005617 Bacteria 3374
37 Ga0068859_100190186 3300005617 Bacteria 2137
38 Ga0068864_100023362 3300005618 Bacteria 5191
39 Ga0068863_100065630 3300005841 Bacteria 3434
40 Ga0068858_100054073 3300005842 Bacteria 3713
41 Ga0068858_100490605 3300005842 Bacteria 1186
42 Ga0068860_100040152 3300005843 Bacteria 4474
43 Ga0075369_10163290 3300006186 Bacteria 1021
44 Ga0097621_100023404 3300006237 Bacteria 4810
45 Ga0068871_100066660 3300006358 Bacteria 2951
46 Ga0075428_100746429 3300006844 Unclassified 1041
47 Ga0075428_100768031 3300006844 Bacteria 1025
48 Ga0097620_100077111 3300006931 Bacteria 3374
49 Ga0097620_100190183 3300006931 Bacteria 2137
50 Ga0105245_10029135 3300009098 Bacteria 4875
51 Ga0105243_11000593 3300009148 Bacteria 839
52 Ga0105242_10995814 3300009176 Bacteria 845
53 Ga0105248_10649898 3300009177 Bacteria 1190
54 Ga0105238_10001342 3300009551 Bacteria 24719
55 Ga0105238_10032799 3300009551 Bacteria 5286
56 Ga0105238_10772481 3300009551 Bacteria 975
57 Ga0105239_10006301 3300010375 Bacteria 13797
58 Ga0105239_12550240 3300010375 Bacteria 596
59 Ga0157370_10000178 3300013104 Bacteria 79566
60 Ga0157369_10206894 3300013105 Bacteria 2058
61 Ga0157369_10722287 3300013105 Bacteria 1025
62 Ga0157374_10300441 3300013296 Bacteria 1588
63 Ga0157378_10000010 3300013297 Bacteria 161268
64 Ga0157378_10429774 3300013297 Bacteria 1307
65 Ga0163162_10003166 3300013306 Bacteria 15729
66 Ga0163162_10624677 3300013306 Bacteria 1202
67 Ga0157375_10618493 3300013308 Bacteria 1241
68 Ga0157380_10279720 3300014326 Bacteria 1526
69 Ga0157380_10736291 3300014326 Bacteria 996
70 Ga0157379_10020758 3300014968 Bacteria 5812
71 Ga0182005_1000004 3300015265 Bacteria 609645
72 Ga0163161_10255561 3300017792 Bacteria 1367
73 Ga0209565_1000093 3300025263 Bacteria 138690
74 Ga0209565_1052916 3300025263 Bacteria 723
75 Ga0209673_1023320 3300025273 Bacteria 2110
76 Ga0209130_1005536 3300025284 Bacteria 4347
77 Ga0209130_1009798 3300025284 Bacteria 2696
78 Ga0209675_1000100 3300025291 Bacteria 128565
79 Ga0209675_1001317 3300025291 Bacteria 14718
80 Ga0209675_1005305 3300025291 Bacteria 5429
81 Ga0209675_1009738 3300025291 Bacteria 3361
82 Ga0209675_1009981 3300025291 Bacteria 3290
83 Ga0209676_1000141 3300025292 Bacteria 175894
84 Ga0209676_1000960 3300025292 Bacteria 34908
85 Ga0209676_1002387 3300025292 Bacteria 13461
86 Ga0209676_1007489 3300025292 Bacteria 5105
87 Ga0209676_1027032 3300025292 Bacteria 1811
88 Ga0209676_1043886 3300025292 Bacteria 1230
89 Ga0209025_1000755 3300025294 Bacteria 54059
90 Ga0209025_1001366 3300025294 Bacteria 32743
91 Ga0209025_1011865 3300025294 Bacteria 5672
92 Ga0209025_1015943 3300025294 Bacteria 4481
93 Ga0209025_1054097 3300025294 Bacteria 1566
94 Ga0209025_1059215 3300025294 Bacteria 1447
95 Ga0209025_1098152 3300025294 Bacteria 936
96 Ga0209025_1101650 3300025294 Bacteria 908
97 Ga0209025_1130369 3300025294 Bacteria 732
98 Ga0209564_1001510 3300025295 Bacteria 23291
99 Ga0209564_1008845 3300025295 Bacteria 4900
100 Ga0209564_1013615 3300025295 Bacteria 3435
101 Ga0209758_1026079 3300025297 Bacteria 2543
102 Ga0209758_1050984 3300025297 Bacteria 1445
103 Ga0209050_1001342 3300025298 Bacteria 27296
104 Ga0209050_1033084 3300025298 Bacteria 1575
105 Ga0209256_1001596 3300025299 Bacteria 22189
106 Ga0209256_1002777 3300025299 Bacteria 13467
107 Ga0209256_1008846 3300025299 Bacteria 4554
108 Ga0207426_1080596 3300025302 Bacteria 884
109 Ga0209051_1058923 3300025303 Bacteria 1220
110 Ga0209257_1000462 3300025304 Bacteria 74803
111 Ga0209257_1003492 3300025304 Bacteria 13392
112 Ga0209257_1006373 3300025304 Bacteria 7640
113 Ga0207680_10000006 3300025903 Bacteria 635950
114 Ga0207647_10013146 3300025904 Bacteria 5750
115 Ga0207705_10005875 3300025909 Bacteria 9131
116 Ga0207705_10155801 3300025909 Bacteria 1714
117 Ga0207657_10365563 3300025919 Bacteria 1137
118 Ga0207649_10440626 3300025920 Bacteria 981
119 Ga0207694_10001494 3300025924 Bacteria 19968
120 Ga0207694_10021963 3300025924 Bacteria 4840
121 Ga0207694_11605950 3300025924 Bacteria 548
122 Ga0207644_10256804 3300025931 Bacteria 1396
123 Ga0207686_10516471 3300025934 Bacteria 929
124 Ga0207709_10588889 3300025935 Bacteria 879
125 Ga0207711_10517953 3300025941 Bacteria 1112
126 Ga0207689_10517256 3300025942 Bacteria 1001
127 Ga0207667_10418271 3300025949 Bacteria 1364
128 Ga0207658_10034538 3300025986 Bacteria 3615
129 Ga0207658_10936910 3300025986 Bacteria 789
130 Ga0207677_10017599 3300026023 Bacteria 4267
131 Ga0207703_10459969 3300026035 Bacteria 1190
132 Ga0207639_10504960 3300026041 Bacteria 1105
133 Ga0207639_10679996 3300026041 Bacteria 954
134 Ga0207639_11039699 3300026041 Bacteria 767
135 Ga0207641_10137505 3300026088 Bacteria 2200
136 Ga0207641_10153525 3300026088 Bacteria 2087
137 Ga0207641_10737223 3300026088 Bacteria 972
138 Ga0207676_10032136 3300026095 Bacteria 3952
139 Ga0207676_11504175 3300026095 Bacteria 670
140 Ga0209974_10009171 3300027876 Bacteria 3360
141 Ga0268266_10000021 3300028379 Bacteria 522453
142 Ga0268264_10219866 3300028381 Bacteria 1748
143 Ga0307517_10175336 3300028786 Bacteria 1398
144 Ga0265338_10071035 3300028800 Bacteria 2981
145 Ga0265338_10672313 3300028800 Unclassified 716
146 Ga0316182_1145176 3300030745 Bacteria 1508
147 Ga0307413_10105564 3300031824 Bacteria 1873
148 Ga0307410_10272706 3300031852 Bacteria 1324
149 Ga0307406_10049511 3300031901 Bacteria 2659
150 Ga0307406_10100517 3300031901 Bacteria 1969
151 Ga0307406_10130810 3300031901 Bacteria 1762
152 Ga0307406_10256160 3300031901 Bacteria 1321
153 Ga0307412_10040349 3300031911 Bacteria 3020
154 Ga0307412_10215828 3300031911 Bacteria 1467
155 Ga0307409_100152820 3300031995 Bacteria 2007
156 Ga0307409_100200025 3300031995 Bacteria 1787
157 Ga0307416_100032839 3300032002 Bacteria 3928
158 Ga0307416_100084934 3300032002 Bacteria 2692
159 Ga0307411_10008559 3300032005 Bacteria 5310
160 Ga0307415_100706682 3300032126 Bacteria 910
161 Ga0307415_102069822 3300032126 Bacteria 555
162 Ga0307510_10010860 3300033180 Bacteria 10821
163 Ga0373937_0005920 3300036401 Bacteria 10520
164 Ga0373937_1738948 3300036401 Bacteria 570
165 Ga0436361_0870420 3300039447 Bacteria 4539
166 Ga0436361_1094092 3300039447 Bacteria 828
167 Ga0436363_1169152 3300039450 Bacteria 601
168 Ga0439439_0003348 3300041406 Bacteria 3525
169 Ga0439465_0002545 3300041413 Bacteria 5944
170 Ga0451798_0812343 3300041458 Bacteria 742
171 Ga0451804_0650824 3300041463 Bacteria 575
172 Ga0439432_009702 3300042006 Bacteria 3349
173 Ga0439432_077548 3300042006 Bacteria 1008
174 Ga0439449_0006803 3300042007 Bacteria 4362
175 Ga0451577_0000065 3300042876 Bacteria 260821
176 Ga0453684_0000990 3300044712 Bacteria 92744
177 Ga0495592_0369249 3300046454 Bacteria 916
178 Ga0495650_0001063 3300046471 Bacteria 30453
179 Ga0495607_0000808 3300046501 Bacteria 29654
180 Ga0495632_0000003 3300046519 Bacteria 396071
181 Ga0495625_0303233 3300046660 Bacteria 1021
182 Ga0495623_0509322 3300046679 Bacteria 634
183 Ga0495658_0155086 3300046683 Bacteria 1409
184 Ga0495636_0010547 3300047318 Bacteria 3650
185 Ga0496100_0033313 3300048903 Bacteria 3223
186 Ga0496101_0001266 3300048904 Bacteria 15116
187 Ga0496101_0208456 3300048904 Bacteria 1513
188 Ga0496102_0939154 3300048905 Bacteria 786
189 Ga0496103_0068916 3300048906 Bacteria 2211
190 Ga0496104_0187335 3300048907 Bacteria 1980
191 Ga0496104_0396556 3300048907 Bacteria 1292
192 Ga0496105_0000062 3300048908 Bacteria 85187
193 Ga0496105_0056176 3300048908 Bacteria 3249
194 Ga0496105_0079676 3300048908 Bacteria 2704
195 Ga0496108_0618186 3300048911 Bacteria 943
196 Ga0496110_0054809 3300048913 Bacteria 3507
197 Ga0496111_0048997 3300048914 Bacteria 3046
198 Ga0496112_0090066 3300048915 Bacteria 3036
199 Ga0496113_0031483 3300048916 Bacteria 3850
200 Ga0496114_0025704 3300048917 Bacteria 4814
201 Ga0496115_0000901 3300048918 Bacteria 21555
202 Ga0496115_0343665 3300048918 Bacteria 1217
203 Ga0496115_0738883 3300048918 Bacteria 770
204 Ga0496118_0315954 3300048921 Bacteria 850
205 Ga0496119_0001049 3300048922 Bacteria 35355
206 Ga0496119_0132395 3300048922 Bacteria 1357
207 Ga0496121_0033885 3300048924 Bacteria 4609
208 Ga0496122_0419394 3300048925 Bacteria 673
209 Ga0496125_0166410 3300048928 Bacteria 1489
210 Ga0496126_0023575 3300048929 Bacteria 5962
211 Ga0501031_0316438 3300049568 Bacteria 1011
212 Ga0501034_0000585 3300049571 Bacteria 57565
213 Ga0501036_0233720 3300049572 Bacteria 1542
214 Ga0501041_0186865 3300049577 Bacteria 1298
215 Ga0501041_0361652 3300049577 Bacteria 917
216 Ga0501042_0322093 3300049578 Bacteria 1117
217 Ga0501048_0113236 3300049582 Bacteria 1916
218 Ga0501071_0134605 3300049587 Bacteria 1838
219 Ga0501071_0222406 3300049587 Bacteria 1421
220 Ga0501072_0042942 3300049588 Bacteria 3553
221 Ga0501072_0165041 3300049588 Bacteria 1767
222 Ga0501074_0271462 3300049590 Bacteria 1206
223 Ga0501076_0202311 3300049592 Bacteria 1622
224 Ga0501076_0914721 3300049592 Bacteria 723
225 Ga0501077_0654457 3300049593 Bacteria 675
226 Ga0501222_049675 3300049662 Bacteria 613
227 Ga0501223_030243 3300049663 Bacteria 1053
228 Ga0501227_148561 3300049665 Bacteria 646
229 Ga0501079_0054304 3300049741 Bacteria 3090
230 Ga0501079_0225208 3300049741 Bacteria 1465
231 Ga0501080_0098062 3300049742 Bacteria 2720
232 Ga0501081_0378191 3300049743 Bacteria 1046
233 Ga0501270_048767 3300049767 Bacteria 761
234 Ga0501035_0091092 3300049822 Bacteria 2684
235 Ga0501044_0786376 3300049823 Bacteria 832
236 nmdc:mga08y16_566836_c1 3300050511 Bacteria 1148
237 nmdc:mga0sz30_179558_c1 3300050516 Bacteria 939
238 Ga0500646_0121104 3300053090 Bacteria 841
239 Ga0500651_0000070 3300053093 Bacteria 67252
240 Ga0501084_0343178 3300054114 Bacteria 1261
241 Ga0530510_0947417 3300061734 Bacteria 658
242 2643878725 2643221573 Bacteria 4784121
243 2644092227 2643221615 Bacteria 5487866
244 2644322030 2643221657 Bacteria 5490246
245 2644529987 2643221695 Bacteria 3441323
246 2819562947 2818991440 Bacteria 4774720
247 2904463559 2904463128 Bacteria 4775606
248 2919085552 2919085039 Bacteria 4532964
249 Ga0075428_100803341
250 JGI24739J22299_10011258
251 JGI24737J22298_10013479
252 JGI24735J21928_10029927
253 JGI25156J39149_1000214
254 JGI25157J39369_1000992
255 JGI25151J46595_10015104
256 Ga0055526_1008895
257 Ga0055526_1020126
258 Ga0055526_1033196
259 Ga0055537_1009559
260 Ga0055524_1001130
261 Ga0055536_1006409
262 Ga0055536_1008354
263 Ga0055536_1032498
264 Ga0055534_1000584
265 Ga0055534_1001032
266 Ga0055534_1021747
267 Ga0055530_10005440
268 Ga0055531_10008302
269 Ga0055531_10015705
270 Ga0055531_10029327
271 Ga0065165_1000790
272 Ga0065715_10001306
273 Ga0065715_10184477
274 Ga0070658_10006716
275 Ga0070666_10000003
276 Ga0070661_100009862
277 Ga0070671_100583983
278 Ga0070667_100087945
279 Ga0070663_100915979
280 Ga0070685_10640881
281 Ga0068853_100079673
282 Ga0068855_100389100
283 Ga0068852_100573575
284 Ga0068859_100077113
285 Ga0068859_100190186
286 Ga0068864_100023362
287 Ga0068863_100065630
288 Ga0068858_100054073
289 Ga0068858_100490605
290 Ga0068860_100040152
291 Ga0075369_10163290
292 Ga0097621_100023404
293 Ga0068871_100066660
294 Ga0075428_100746429
295 Ga0075428_100768031
296 Ga0097620_100077111
297 Ga0097620_100190183
298 Ga0105245_10029135
299 Ga0105243_11000593
300 Ga0105242_10995814
301 Ga0105248_10649898
302 Ga0105238_10001342
303 Ga0105238_10032799
304 Ga0105238_10772481
305 Ga0105239_10006301
306 Ga0105239_12550240
307 Ga0157370_10000178
308 Ga0157369_10206894
309 Ga0157369_10722287
310 Ga0157374_10300441
311 Ga0157378_10000010
312 Ga0157378_10429774
313 Ga0163162_10003166
314 Ga0163162_10624677
315 Ga0157375_10618493
316 Ga0157380_10279720
317 Ga0157380_10736291
318 Ga0157379_10020758
319 Ga0182005_1000004
320 Ga0163161_10255561
321 Ga0209565_1000093
322 Ga0209565_1052916
323 Ga0209673_1023320
324 Ga0209130_1005536
325 Ga0209130_1009798
326 Ga0209675_1000100
327 Ga0209675_1001317
328 Ga0209675_1005305
329 Ga0209675_1009738
330 Ga0209675_1009981
331 Ga0209676_1000141
332 Ga0209676_1000960
333 Ga0209676_1002387
334 Ga0209676_1007489
335 Ga0209676_1027032
336 Ga0209676_1043886
337 Ga0209025_1000755
338 Ga0209025_1001366
339 Ga0209025_1011865
340 Ga0209025_1015943
341 Ga0209025_1054097
342 Ga0209025_1059215
343 Ga0209025_1098152
344 Ga0209025_1101650
345 Ga0209025_1130369
346 Ga0209564_1001510
347 Ga0209564_1008845
348 Ga0209564_1013615
349 Ga0209758_1026079
350 Ga0209758_1050984
351 Ga0209050_1001342
352 Ga0209050_1033084
353 Ga0209256_1001596
354 Ga0209256_1002777
355 Ga0209256_1008846
356 Ga0207426_1080596
357 Ga0209051_1058923
358 Ga0209257_1000462
359 Ga0209257_1003492
360 Ga0209257_1006373
361 Ga0207680_10000006
362 Ga0207647_10013146
363 Ga0207705_10005875
364 Ga0207705_10155801
365 Ga0207657_10365563
366 Ga0207649_10440626
367 Ga0207694_10001494
368 Ga0207694_10021963
369 Ga0207694_11605950
370 Ga0207644_10256804
371 Ga0207686_10516471
372 Ga0207709_10588889
373 Ga0207711_10517953
374 Ga0207689_10517256
375 Ga0207667_10418271
376 Ga0207658_10034538
377 Ga0207658_10936910
378 Ga0207677_10017599
379 Ga0207703_10459969
380 Ga0207639_10504960
381 Ga0207639_10679996
382 Ga0207639_11039699
383 Ga0207641_10137505
384 Ga0207641_10153525
385 Ga0207641_10737223
386 Ga0207676_10032136
387 Ga0207676_11504175
388 Ga0209974_10009171
389 Ga0268266_10000021
390 Ga0268264_10219866
391 Ga0307517_10175336
392 Ga0265338_10071035
393 Ga0265338_10672313
394 Ga0316182_1145176
395 Ga0307413_10105564
396 Ga0307410_10272706
397 Ga0307406_10049511
398 Ga0307406_10100517
399 Ga0307406_10130810
400 Ga0307406_10256160
401 Ga0307412_10040349
402 Ga0307412_10215828
403 Ga0307409_100152820
404 Ga0307409_100200025
405 Ga0307416_100032839
406 Ga0307416_100084934
407 Ga0307411_10008559
408 Ga0307415_100706682
409 Ga0307415_102069822
410 Ga0307510_10010860
411 Ga0373937_0005920
412 Ga0373937_1738948
413 Ga0436361_0870420
414 Ga0436361_1094092
415 Ga0436363_1169152
416 Ga0439439_0003348
417 Ga0439465_0002545
418 Ga0451798_0812343
419 Ga0451804_0650824
420 Ga0439432_009702
421 Ga0439432_077548
422 Ga0439449_0006803
423 Ga0451577_0000065
424 Ga0453684_0000990
425 Ga0495592_0369249
426 Ga0495650_0001063
427 Ga0495607_0000808
428 Ga0495632_0000003
429 Ga0495625_0303233
430 Ga0495623_0509322
431 Ga0495658_0155086
432 Ga0495636_0010547
433 Ga0496100_0033313
434 Ga0496101_0001266
435 Ga0496101_0208456
436 Ga0496102_0939154
437 Ga0496103_0068916
438 Ga0496104_0187335
439 Ga0496104_0396556
440 Ga0496105_0000062
441 Ga0496105_0056176
442 Ga0496105_0079676
443 Ga0496108_0618186
444 Ga0496110_0054809
445 Ga0496111_0048997
446 Ga0496112_0090066
447 Ga0496113_0031483
448 Ga0496114_0025704
449 Ga0496115_0000901
450 Ga0496115_0343665
451 Ga0496115_0738883
452 Ga0496118_0315954
453 Ga0496119_0001049
454 Ga0496119_0132395
455 Ga0496121_0033885
456 Ga0496122_0419394
457 Ga0496125_0166410
458 Ga0496126_0023575
459 Ga0501031_0316438
460 Ga0501034_0000585
461 Ga0501036_0233720
462 Ga0501041_0186865
463 Ga0501041_0361652
464 Ga0501042_0322093
465 Ga0501048_0113236
466 Ga0501071_0134605
467 Ga0501071_0222406
468 Ga0501072_0042942
469 Ga0501072_0165041
470 Ga0501074_0271462
471 Ga0501076_0202311
472 Ga0501076_0914721
473 Ga0501077_0654457
474 Ga0501222_049675
475 Ga0501223_030243
476 Ga0501227_148561
477 Ga0501079_0054304
478 Ga0501079_0225208
479 Ga0501080_0098062
480 Ga0501081_0378191
481 Ga0501270_048767
482 Ga0501035_0091092
483 Ga0501044_0786376
484 nmdc:mga08y16_566836_c1
485 nmdc:mga0sz30_179558_c1
486 Ga0500646_0121104
487 Ga0500651_0000070
488 Ga0501084_0343178
489 Ga0530510_0947417
490 2643878725
491 2644092227
492 2644322030
493 2644529987
494 2819562947
495 2904463559
496 2919085552

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

4

111

0.98

PF00578

AhpC-TSA

AhpC/TSA family

2

107

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wgr-assembly1.cif.gz_A combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase 0.9419 1 159
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9415 1 161
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9359 1 161
2vup-assembly1.cif.gz_A crystal structure of a type ii tryparedoxin-dependant peroxidase from trypanosoma brucei 0.9308 1 161
2p31-assembly2.cif.gz_B crystal structure of human glutathione peroxidase 7 0.9278 2 158
ID Description Score Start End Superfamily
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9481 3 161 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9457 1 158 3.40.30.10
af_Q7FS88_1_175_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9365 1 161 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9342 1 158 3.40.30.10
af_A8WFK6_20_197_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9337 1 159 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7X9LFI9-F1-model_v4 deleted 0.9573 1 159
AF-A0A562R3D5-F1-model_v4 Glutathione peroxidase 0.9573 1 161 GO:0004601
GO:0034599
AF-A0A7W8M8F6-F1-model_v4 Glutathione peroxidase 0.9572 1 161 GO:0004602
GO:0034599
AF-A0A193FZR3-F1-model_v4 Glutathione peroxidase 0.957 1 161 GO:0004601
GO:0034599
AF-A0A7J5UWH1-F1-model_v4 Glutathione peroxidase 0.957 4 161 GO:0004601
GO:0016020
GO:0034599

Map