F359545

General Info

Members Datasets Scaffolds Average Seq Length
248 186 496 219

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10048108|rootL2_100481082
Length 241
Sequence VGGEGWVGKPVKSGDQYSTRTKEMMKTLGLIHTSAALVPVFQQLCSQHIPQVQVFNIVDDSLIKNVIKNGSLLPVTARRVVDYAASAEAAGADYIMVTCSSIGAAVETAAGLTKVPVLRVDQPMADRAVQTGARIGVIATLPTTLAPTSDLVRRRALAARKEIELRSVLCEGAFDALMSGDGAKHDTMVAAALRELVTKTDVIVLAQASMARVVDTLSEADRRVPILASPGIAVQYLSTVL

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
92 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
93 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
117 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
118 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
119 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
120 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
121 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
122 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
154 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
165 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
166 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
167 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
168 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
171 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
172 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
173 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
174 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
175 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
178 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
179 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
180 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
181 2738541278 Niastella sp. CF465 Isolate Unclassified
182 2738543023 Pedobacter sp. OK628 Isolate Unclassified
183 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
184 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
185 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
186 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.77
Metatranscriptomes 0
Isolates 3.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.9
Nodule 0
Rhizoplane 1.21
Rhizosphere 74.19
Stem 0
Stem Tuber 0
Unclassified 11.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10048108 3300003322 Bacteria 2514
2 JGI25150J39212_1000019 3300002774 Bacteria 135244
3 JGI25151J46595_10000074 3300003187 Bacteria 135244
4 JGI25153J46596_10000056 3300003215 Bacteria 135244
5 rootH2_10060522 3300003320 Bacteria 3482
6 rootH2_10238768 3300003320 Bacteria 1907
7 rootL2_10053677 3300003322 Unclassified 1717
8 rootH1_10008837 3300003323 Bacteria 37199
9 rootH1_10040548 3300003323 Bacteria 1939
10 rootH1_10068235 3300003323 Bacteria 3649
11 rootH1_10218069 3300003323 Unclassified 1939
12 rootH1_10242162 3300003323 Bacteria 2661
13 Ga0065165_1000339 3300005262 Bacteria 76812
14 Ga0065714_10070164 3300005288 Bacteria 3950
15 Ga0065704_10136607 3300005289 Bacteria 1564
16 Ga0065715_10200536 3300005293 Bacteria 1363
17 Ga0065715_10533120 3300005293 Bacteria 754
18 Ga0070658_10070195 3300005327 Unclassified 2867
19 Ga0070676_10304497 3300005328 Bacteria 1082
20 Ga0070683_100060497 3300005329 Unclassified 3520
21 Ga0070683_100543049 3300005329 Bacteria 1111
22 Ga0070670_100327755 3300005331 Bacteria 1342
23 Ga0070670_100749402 3300005331 Bacteria 880
24 Ga0068869_100069772 3300005334 Bacteria 2599
25 Ga0070666_10381872 3300005335 Unclassified 1011
26 Ga0068868_100643489 3300005338 Unclassified 943
27 Ga0070691_10022422 3300005341 Unclassified 2929
28 Ga0070668_100041352 3300005347 Bacteria 3532
29 Ga0070673_100137853 3300005364 Bacteria 2056
30 Ga0070659_100000283 3300005366 Bacteria 39665
31 Ga0070667_100913800 3300005367 Bacteria 817
32 Ga0070678_100233600 3300005456 Bacteria 1534
33 Ga0070681_10287290 3300005458 Bacteria 1555
34 Ga0068867_100064220 3300005459 Bacteria 2729
35 Ga0068853_100025420 3300005539 Bacteria 4968
36 Ga0070665_100422790 3300005548 Bacteria 1341
37 Ga0068855_100001483 3300005563 Bacteria 29355
38 Ga0068855_100257741 3300005563 Bacteria 1944
39 Ga0068854_100257330 3300005578 Unclassified 1396
40 Ga0068854_100322610 3300005578 Bacteria 1256
41 Ga0068856_100132545 3300005614 Bacteria 2497
42 Ga0068856_100238189 3300005614 Unclassified 1835
43 Ga0068852_100028629 3300005616 Bacteria 4564
44 Ga0068852_100270070 3300005616 Unclassified 1636
45 Ga0068863_100224306 3300005841 Bacteria 1811
46 Ga0068862_100083797 3300005844 Bacteria 2769
47 Ga0068862_100905987 3300005844 Unclassified 867
48 Ga0081455_10167641 3300005937 Bacteria 1676
49 Ga0075366_10265420 3300006195 Bacteria 1048
50 Ga0068871_100840236 3300006358 Bacteria 848
51 Ga0075428_100012570 3300006844 Bacteria 9413
52 Ga0075430_100005702 3300006846 Bacteria 10506
53 Ga0075430_100066889 3300006846 Bacteria 3017
54 Ga0075431_100035374 3300006847 Bacteria 5143
55 Ga0075434_100490657 3300006871 Unclassified 1249
56 Ga0075429_100290753 3300006880 Bacteria 1431
57 Ga0105240_10000592 3300009093 Bacteria 67301
58 Ga0111539_10111813 3300009094 Bacteria 3205
59 Ga0111539_10588949 3300009094 Unclassified 1295
60 Ga0114129_10000792 3300009147 Bacteria 40543
61 Ga0114129_10152415 3300009147 Bacteria 3163
62 Ga0105243_10782571 3300009148 Bacteria 938
63 Ga0105241_10014828 3300009174 Bacteria 5706
64 Ga0105241_10069921 3300009174 Bacteria 2723
65 Ga0105237_10003831 3300009545 Bacteria 17683
66 Ga0105238_10025018 3300009551 Bacteria 6086
67 Ga0105239_10001332 3300010375 Bacteria 33262
68 Ga0105239_10002179 3300010375 Bacteria 25167
69 Ga0157373_10000113 3300013100 Bacteria 63950
70 Ga0157373_10007331 3300013100 Bacteria 8214
71 Ga0157371_10011735 3300013102 Bacteria 6732
72 Ga0157371_10148525 3300013102 Bacteria 1671
73 Ga0157370_10080551 3300013104 Bacteria 3065
74 Ga0157369_10001781 3300013105 Bacteria 26087
75 Ga0157369_10036558 3300013105 Bacteria 5379
76 Ga0157378_10522814 3300013297 Bacteria 1188
77 Ga0157378_10544771 3300013297 Bacteria 1165
78 Ga0157372_10000021 3300013307 Bacteria 207801
79 Ga0157372_10069978 3300013307 Unclassified 3947
80 Ga0157372_10087927 3300013307 Bacteria 3527
81 Ga0157372_10116189 3300013307 Bacteria 3068
82 Ga0157372_10810554 3300013307 Bacteria 1087
83 Ga0157372_11448536 3300013307 Bacteria 791
84 Ga0157375_11509333 3300013308 Bacteria 793
85 Ga0163163_10374908 3300014325 Unclassified 1480
86 Ga0163163_10388468 3300014325 Bacteria 1453
87 Ga0157376_11316132 3300014969 Bacteria 753
88 Ga0182006_1050709 3300015261 Bacteria 1598
89 Ga0163161_10068441 3300017792 Bacteria 2594
90 Ga0207425_1000007 3300025245 Bacteria 777411
91 Ga0209026_1000521 3300025250 Bacteria 27122
92 Ga0209129_1000006 3300025258 Bacteria 777761
93 Ga0209233_1009111 3300025261 Bacteria 3036
94 Ga0209233_1053255 3300025261 Bacteria 812
95 Ga0209676_1000232 3300025292 Bacteria 120363
96 Ga0209025_1000025 3300025294 Bacteria 524454
97 Ga0209758_1000016 3300025297 Bacteria 778557
98 Ga0209050_1023496 3300025298 Bacteria 2167
99 Ga0207680_10351772 3300025903 Unclassified 1035
100 Ga0207645_10030391 3300025907 Bacteria 3480
101 Ga0207654_10048933 3300025911 Unclassified 2422
102 Ga0207695_10000048 3300025913 Bacteria 421800
103 Ga0207671_10039880 3300025914 Bacteria 3477
104 Ga0207657_10066257 3300025919 Unclassified 3075
105 Ga0207650_10090861 3300025925 Bacteria 2332
106 Ga0207690_10002858 3300025932 Bacteria 10408
107 Ga0207689_10210987 3300025942 Bacteria 1604
108 Ga0207661_10116380 3300025944 Bacteria 2269
109 Ga0207668_10766078 3300025972 Bacteria 852
110 Ga0207640_10402889 3300025981 Bacteria 1115
111 Ga0207703_10373295 3300026035 Bacteria 1318
112 Ga0207639_10502580 3300026041 Bacteria 1108
113 Ga0207702_10198756 3300026078 Unclassified 1857
114 Ga0207641_10180531 3300026088 Bacteria 1933
115 Ga0207648_10012385 3300026089 Bacteria 7985
116 Ga0207648_10782352 3300026089 Unclassified 887
117 Ga0207698_10021054 3300026142 Bacteria 4502
118 Ga0268266_10886216 3300028379 Unclassified 863
119 Ga0268265_10562566 3300028380 Bacteria 1084
120 Ga0268264_10828395 3300028381 Bacteria 926
121 Ga0307515_10031909 3300028794 Bacteria 8751
122 Ga0307512_10106599 3300030522 Bacteria 1869
123 Ga0316181_1032274 3300030744 Bacteria 1656
124 Ga0265328_10065388 3300031239 Bacteria 1336
125 Ga0265325_10174894 3300031241 Bacteria 1003
126 Ga0307513_10194353 3300031456 Bacteria 1877
127 Ga0307513_10235553 3300031456 Bacteria 1640
128 Ga0307513_10422424 3300031456 Bacteria 1063
129 Ga0307509_10045269 3300031507 Bacteria 4747
130 Ga0307509_10078435 3300031507 Bacteria 3422
131 Ga0307509_10085713 3300031507 Bacteria 3241
132 Ga0307509_10322760 3300031507 Bacteria 1280
133 Ga0307408_100006462 3300031548 Bacteria 7771
134 Ga0307408_100051586 3300031548 Bacteria 2963
135 Ga0265313_10035628 3300031595 Bacteria 2504
136 Ga0307508_10000062 3300031616 Bacteria 123066
137 Ga0307508_10002665 3300031616 Bacteria 18710
138 Ga0307508_10160482 3300031616 Bacteria 1852
139 Ga0265342_10107769 3300031712 Bacteria 1580
140 Ga0307405_10126966 3300031731 Bacteria 1755
141 Ga0307413_10441171 3300031824 Bacteria 1031
142 Ga0307412_10005075 3300031911 Bacteria 7362
143 Ga0307412_10086241 3300031911 Bacteria 2184
144 Ga0307412_10904703 3300031911 Bacteria 774
145 Ga0307416_100443292 3300032002 Bacteria 1349
146 Ga0307414_10000323 3300032004 Bacteria 27329
147 Ga0307414_10002736 3300032004 Bacteria 9281
148 Ga0307414_10573938 3300032004 Bacteria 1008
149 Ga0307415_100172102 3300032126 Bacteria 1690
150 Ga0307510_10058127 3300033180 Bacteria 4008
151 Ga0373953_0076612 3300035117 Bacteria 1386
152 Ga0373924_0055492 3300035410 Bacteria 1649
153 Ga0373933_0194521 3300035724 Unclassified 1296
154 Ga0373937_0011925 3300036401 Bacteria 7627
155 Ga0373925_0120657 3300037068 Bacteria 2035
156 Ga0395899_0000001 3300037312 Bacteria 1750322
157 Ga0395899_0001857 3300037312 Bacteria 17464
158 Ga0395900_0000585 3300037418 Bacteria 50049
159 Ga0395901_1136890 3300038443 Bacteria 750
160 Ga0400488_52022 3300038741 Bacteria 2603
161 Ga0400489_65437 3300039093 Bacteria 1819
162 Ga0451791_0438377 3300041451 Bacteria 956
163 Ga0451797_1339496 3300041453 Bacteria 791
164 Ga0451849_0404290 3300041505 Bacteria 796
165 Ga0439449_0010820 3300042007 Bacteria 3443
166 Ga0439457_013402 3300042014 Bacteria 1843
167 Ga0439457_017929 3300042014 Bacteria 1571
168 Ga0466969_0000052 3300044656 Bacteria 60425
169 Ga0466966_0000591 3300044684 Bacteria 23091
170 Ga0466966_0014558 3300044684 Bacteria 5206
171 Ga0466961_0242733 3300044693 Bacteria 1107
172 Ga0466971_0143895 3300044719 Bacteria 1111
173 Ga0466957_0010144 3300044842 Bacteria 5390
174 Ga0466957_0012559 3300044842 Bacteria 4903
175 Ga0466959_0014160 3300045049 Bacteria 5789
176 Ga0466958_0041326 3300045836 Bacteria 2773
177 Ga0495592_0037539 3300046454 Bacteria 3647
178 Ga0495629_0125014 3300046459 Bacteria 1792
179 Ga0495629_0128220 3300046459 Bacteria 1768
180 Ga0495638_0029572 3300046460 Unclassified 3533
181 Ga0495638_0303268 3300046460 Bacteria 860
182 Ga0495639_0171279 3300046475 Bacteria 1054
183 Ga0495662_0123778 3300046476 Unclassified 1270
184 Ga0495664_0097272 3300046477 Bacteria 1772
185 Ga0495608_0103495 3300046511 Bacteria 1835
186 Ga0495618_0106652 3300046514 Bacteria 1794
187 Ga0495628_0032509 3300046516 Bacteria 4212
188 Ga0495630_0088549 3300046517 Bacteria 2338
189 Ga0495630_0090032 3300046517 Bacteria 2318
190 Ga0495587_0134170 3300046536 Unclassified 1415
191 Ga0495645_0065104 3300046543 Bacteria 2637
192 Ga0495667_0039568 3300046559 Bacteria 3135
193 Ga0495634_0091700 3300046642 Bacteria 1972
194 Ga0495634_0092501 3300046642 Bacteria 1962
195 Ga0495611_0228011 3300046648 Bacteria 866
196 Ga0495613_0004289 3300046689 Bacteria 10685
197 Ga0495613_0102065 3300046689 Bacteria 2071
198 Ga0495613_0106438 3300046689 Bacteria 2024
199 Ga0495674_0035376 3300047319 Bacteria 4507
200 Ga0495674_0224506 3300047319 Bacteria 1552
201 Ga0495672_0014841 3300047320 Bacteria 5314
202 Ga0495672_0017676 3300047320 Bacteria 4763
203 Ga0495680_0127583 3300047322 Bacteria 1872
204 Ga0495684_0055823 3300047471 Bacteria 3012
205 Ga0495684_0195727 3300047471 Bacteria 1492
206 Ga0496114_0388555 3300048917 Bacteria 1236
207 Ga0501047_0025848 3300049581 Bacteria 5646
208 Ga0501048_0652528 3300049582 Unclassified 756
209 Ga0501223_000741 3300049663 Bacteria 7770
210 Ga0501249_000008 3300049679 Bacteria 197587
211 Ga0501044_0445950 3300049823 Bacteria 1201
212 nmdc:mga0k408_328588_c1 3300050493 Bacteria 912
213 nmdc:mga05p37_14969_c1 3300050507 Bacteria 9311
214 nmdc:mga05p37_1784_c1 3300050507 Bacteria 25122
215 nmdc:mga09592_171493_c1 3300050508 Bacteria 1876
216 nmdc:mga09592_52518_c1 3300050508 Bacteria 3441
217 nmdc:mga0qj67_3635_c1 3300050509 Bacteria 11125
218 nmdc:mga0qj67_9314_c1 3300050509 Bacteria 7304
219 nmdc:mga06r32_118337_c1 3300050510 Bacteria 2612
220 nmdc:mga08y16_1187899_c1 3300050511 Unclassified 734
221 nmdc:mga0n895_519034_c1 3300050512 Unclassified 1199
222 Ga0495601_0152292 3300053077 Bacteria 1510
223 Ga0500578_0005051 3300053086 Bacteria 9072
224 Ga0500646_0036576 3300053090 Bacteria 1368
225 Ga0500583_0000081 3300053092 Bacteria 55682
226 Ga0500583_0005623 3300053092 Bacteria 4222
227 Ga0500641_0001307 3300053096 Bacteria 8846
228 Ga0500594_0030878 3300053118 Bacteria 1409
229 Ga0500559_0198771 3300053136 Bacteria 945
230 Ga0500568_0000471 3300053139 Bacteria 29804
231 Ga0500573_0199848 3300053140 Bacteria 1062
232 Ga0500588_0009341 3300053146 Bacteria 2329
233 Ga0500589_026855 3300053147 Bacteria 2671
234 Ga0500603_030868 3300053150 Bacteria 1382
235 Ga0500616_0028342 3300053153 Unclassified 3086
236 Ga0500622_0008668 3300053156 Bacteria 5672
237 Ga0500622_0082256 3300053156 Bacteria 1611
238 Ga0500636_0162056 3300053177 Bacteria 1218
239 Ga0500611_000005 3300053727 Bacteria 228837
240 Ga0500611_015250 3300053727 Bacteria 1358
241 2513235226 2513020052 Bacteria 5120511
242 2522548720 2522125168 Bacteria 7376607
243 2738729901 2738541278 Bacteria 9755573
244 2739300105 2738543023 Bacteria 6767879
245 2833644040 2833640130 Bacteria 4858325
246 2896319166 2896317667 Bacteria 4606601
247 2919684725 2919683626 Bacteria 5534354
248 8056443608 8056440228 Bacteria 4946504
249 rootL2_10048108
250 JGI25150J39212_1000019
251 JGI25151J46595_10000074
252 JGI25153J46596_10000056
253 rootH2_10060522
254 rootH2_10238768
255 rootL2_10053677
256 rootH1_10008837
257 rootH1_10040548
258 rootH1_10068235
259 rootH1_10218069
260 rootH1_10242162
261 Ga0065165_1000339
262 Ga0065714_10070164
263 Ga0065704_10136607
264 Ga0065715_10200536
265 Ga0065715_10533120
266 Ga0070658_10070195
267 Ga0070676_10304497
268 Ga0070683_100060497
269 Ga0070683_100543049
270 Ga0070670_100327755
271 Ga0070670_100749402
272 Ga0068869_100069772
273 Ga0070666_10381872
274 Ga0068868_100643489
275 Ga0070691_10022422
276 Ga0070668_100041352
277 Ga0070673_100137853
278 Ga0070659_100000283
279 Ga0070667_100913800
280 Ga0070678_100233600
281 Ga0070681_10287290
282 Ga0068867_100064220
283 Ga0068853_100025420
284 Ga0070665_100422790
285 Ga0068855_100001483
286 Ga0068855_100257741
287 Ga0068854_100257330
288 Ga0068854_100322610
289 Ga0068856_100132545
290 Ga0068856_100238189
291 Ga0068852_100028629
292 Ga0068852_100270070
293 Ga0068863_100224306
294 Ga0068862_100083797
295 Ga0068862_100905987
296 Ga0081455_10167641
297 Ga0075366_10265420
298 Ga0068871_100840236
299 Ga0075428_100012570
300 Ga0075430_100005702
301 Ga0075430_100066889
302 Ga0075431_100035374
303 Ga0075434_100490657
304 Ga0075429_100290753
305 Ga0105240_10000592
306 Ga0111539_10111813
307 Ga0111539_10588949
308 Ga0114129_10000792
309 Ga0114129_10152415
310 Ga0105243_10782571
311 Ga0105241_10014828
312 Ga0105241_10069921
313 Ga0105237_10003831
314 Ga0105238_10025018
315 Ga0105239_10001332
316 Ga0105239_10002179
317 Ga0157373_10000113
318 Ga0157373_10007331
319 Ga0157371_10011735
320 Ga0157371_10148525
321 Ga0157370_10080551
322 Ga0157369_10001781
323 Ga0157369_10036558
324 Ga0157378_10522814
325 Ga0157378_10544771
326 Ga0157372_10000021
327 Ga0157372_10069978
328 Ga0157372_10087927
329 Ga0157372_10116189
330 Ga0157372_10810554
331 Ga0157372_11448536
332 Ga0157375_11509333
333 Ga0163163_10374908
334 Ga0163163_10388468
335 Ga0157376_11316132
336 Ga0182006_1050709
337 Ga0163161_10068441
338 Ga0207425_1000007
339 Ga0209026_1000521
340 Ga0209129_1000006
341 Ga0209233_1009111
342 Ga0209233_1053255
343 Ga0209676_1000232
344 Ga0209025_1000025
345 Ga0209758_1000016
346 Ga0209050_1023496
347 Ga0207680_10351772
348 Ga0207645_10030391
349 Ga0207654_10048933
350 Ga0207695_10000048
351 Ga0207671_10039880
352 Ga0207657_10066257
353 Ga0207650_10090861
354 Ga0207690_10002858
355 Ga0207689_10210987
356 Ga0207661_10116380
357 Ga0207668_10766078
358 Ga0207640_10402889
359 Ga0207703_10373295
360 Ga0207639_10502580
361 Ga0207702_10198756
362 Ga0207641_10180531
363 Ga0207648_10012385
364 Ga0207648_10782352
365 Ga0207698_10021054
366 Ga0268266_10886216
367 Ga0268265_10562566
368 Ga0268264_10828395
369 Ga0307515_10031909
370 Ga0307512_10106599
371 Ga0316181_1032274
372 Ga0265328_10065388
373 Ga0265325_10174894
374 Ga0307513_10194353
375 Ga0307513_10235553
376 Ga0307513_10422424
377 Ga0307509_10045269
378 Ga0307509_10078435
379 Ga0307509_10085713
380 Ga0307509_10322760
381 Ga0307408_100006462
382 Ga0307408_100051586
383 Ga0265313_10035628
384 Ga0307508_10000062
385 Ga0307508_10002665
386 Ga0307508_10160482
387 Ga0265342_10107769
388 Ga0307405_10126966
389 Ga0307413_10441171
390 Ga0307412_10005075
391 Ga0307412_10086241
392 Ga0307412_10904703
393 Ga0307416_100443292
394 Ga0307414_10000323
395 Ga0307414_10002736
396 Ga0307414_10573938
397 Ga0307415_100172102
398 Ga0307510_10058127
399 Ga0373953_0076612
400 Ga0373924_0055492
401 Ga0373933_0194521
402 Ga0373937_0011925
403 Ga0373925_0120657
404 Ga0395899_0000001
405 Ga0395899_0001857
406 Ga0395900_0000585
407 Ga0395901_1136890
408 Ga0400488_52022
409 Ga0400489_65437
410 Ga0451791_0438377
411 Ga0451797_1339496
412 Ga0451849_0404290
413 Ga0439449_0010820
414 Ga0439457_013402
415 Ga0439457_017929
416 Ga0466969_0000052
417 Ga0466966_0000591
418 Ga0466966_0014558
419 Ga0466961_0242733
420 Ga0466971_0143895
421 Ga0466957_0010144
422 Ga0466957_0012559
423 Ga0466959_0014160
424 Ga0466958_0041326
425 Ga0495592_0037539
426 Ga0495629_0125014
427 Ga0495629_0128220
428 Ga0495638_0029572
429 Ga0495638_0303268
430 Ga0495639_0171279
431 Ga0495662_0123778
432 Ga0495664_0097272
433 Ga0495608_0103495
434 Ga0495618_0106652
435 Ga0495628_0032509
436 Ga0495630_0088549
437 Ga0495630_0090032
438 Ga0495587_0134170
439 Ga0495645_0065104
440 Ga0495667_0039568
441 Ga0495634_0091700
442 Ga0495634_0092501
443 Ga0495611_0228011
444 Ga0495613_0004289
445 Ga0495613_0102065
446 Ga0495613_0106438
447 Ga0495674_0035376
448 Ga0495674_0224506
449 Ga0495672_0014841
450 Ga0495672_0017676
451 Ga0495680_0127583
452 Ga0495684_0055823
453 Ga0495684_0195727
454 Ga0496114_0388555
455 Ga0501047_0025848
456 Ga0501048_0652528
457 Ga0501223_000741
458 Ga0501249_000008
459 Ga0501044_0445950
460 nmdc:mga0k408_328588_c1
461 nmdc:mga05p37_14969_c1
462 nmdc:mga05p37_1784_c1
463 nmdc:mga09592_171493_c1
464 nmdc:mga09592_52518_c1
465 nmdc:mga0qj67_3635_c1
466 nmdc:mga0qj67_9314_c1
467 nmdc:mga06r32_118337_c1
468 nmdc:mga08y16_1187899_c1
469 nmdc:mga0n895_519034_c1
470 Ga0495601_0152292
471 Ga0500578_0005051
472 Ga0500646_0036576
473 Ga0500583_0000081
474 Ga0500583_0005623
475 Ga0500641_0001307
476 Ga0500594_0030878
477 Ga0500559_0198771
478 Ga0500568_0000471
479 Ga0500573_0199848
480 Ga0500588_0009341
481 Ga0500589_026855
482 Ga0500603_030868
483 Ga0500616_0028342
484 Ga0500622_0008668
485 Ga0500622_0082256
486 Ga0500636_0162056
487 Ga0500611_000005
488 Ga0500611_015250
489 2513235226
490 2522548720
491 2738729901
492 2739300105
493 2833644040
494 2896319166
495 2919684725
496 8056443608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01177

Asp_Glu_race

Asp/Glu/Hydantoin racemase

28

237

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jfl-assembly1.cif.gz_B crystal structure determination of aspartate racemase from an archaea 0.8065 4 218
3ojc-assembly1.cif.gz_A crystal structure of a putative asp/glu racemase from yersinia pestis 0.8063 4 221
3ojc-assembly1.cif.gz_A crystal structure of a putative asp/glu racemase from yersinia pestis 0.7933 4 221
1jfl-assembly1.cif.gz_B crystal structure determination of aspartate racemase from an archaea 0.7835 4 218
2dx7-assembly1.cif.gz_B crystal structure of pyrococcus horikoshii ot3 aspartate racemase complex with citric acid 0.7778 4 216
ID Description Score Start End Superfamily
5ellB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8066 4 96 3.40.50.1860
1jflB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8054 4 99 3.40.50.1860
af_P03813_2_229_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7966 4 219 3.40.50.720
af_P03813_2_229_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7772 4 219 3.40.50.720
af_K7ML62_69_313_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.7644 7 221 1.10.472.10
ID Description Score Start End GO Terms
AF-G8TNH0-F1-model_v4 Asp/Glu/hydantoin racemase 0.9971 1 218 GO:0036361
AF-A0A1S2VA72-F1-model_v4 Asp/Glu/hydantoin racemase 0.9969 1 144 GO:0036361
AF-A0A1M5E3W3-F1-model_v4 Asp/Glu/Hydantoin racemase 0.9928 1 218 GO:0036361
AF-A0A5B8UG90-F1-model_v4 Asp/Glu/hydantoin racemase 0.991 1 218 GO:0036361
AF-A0A519UPH8-F1-model_v4 Asp/Glu/hydantoin racemase 0.9897 1 193 GO:0036361

Map