F358996

General Info

Members Datasets Scaffolds Average Seq Length
247 149 246 305

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10106311|Ga0157371_101063112
Length 341
Sequence LRVHHAKKLRRKEVKGEEVMQIHPILTDTTTSPGHDGVPILRTHDLTKQYGERVAVNQLNLEIRRGEIVGFLGPNGAGKTTSIRMILGLIAPTSGHIEIFGRNLATEHATLLPRIGALVEAPALYMHLSGRENLQAVGAILGGVSRQRIETVLELVGLRXXXKDRVRTYSLGMKQRLGVGIALLNNPDLLILDEPANGLDPAGIVEMRDLLHRLASEGKTVFLSSHLLGEVQQICSRVAVINAGKLLADRSVEELTRGQGEFVVRLERAQEALLLLQQQTWGKGARLDGTDTLITPAPQENGRDLYTFLAQAGFTPDSLAPATQNLEQVFFSLINSQEKDQ

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2643221679 Angustibacter sp. Root456 Isolate Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
126 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
127 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
128 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
129 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
130 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
131 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
132 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
133 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
134 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
135 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
139 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
140 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
148 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 1.62
Rhizosphere 95.14
Stem 0
Stem Tuber 0
Unclassified 2.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_581922 2162886006 Bacteria 2805
2 SwRhRL2b_contig_1829743 2162886007 Bacteria 1451
3 JGI25406J46586_10033509 3300003203 Bacteria 1895
4 Ga0065704_10096294 3300005289 Bacteria 2447
5 Ga0065704_10147080 3300005289 Bacteria 1453
6 Ga0065712_10011026 3300005290 Bacteria 2214
7 Ga0065715_10001357 3300005293 Bacteria 8541
8 Ga0065715_10095129 3300005293 Bacteria 4158
9 Ga0065707_10006684 3300005295 Bacteria 4296
10 Ga0065707_10099119 3300005295 Bacteria 3030
11 Ga0070670_100058892 3300005331 Bacteria 3297
12 Ga0068869_100202985 3300005334 Bacteria 1564
13 Ga0070680_100020866 3300005336 Bacteria 5201
14 Ga0070682_100002797 3300005337 Bacteria 9668
15 Ga0070692_10013675 3300005345 Bacteria 3790
16 Ga0070669_100085259 3300005353 Bacteria 2358
17 Ga0070669_100133701 3300005353 Bacteria 1906
18 Ga0070673_100596505 3300005364 Bacteria 1007
19 Ga0070688_100204176 3300005365 Bacteria 1384
20 Ga0070659_100094717 3300005366 Unclassified 2398
21 Ga0070701_10049461 3300005438 Bacteria 2174
22 Ga0070701_10122637 3300005438 Bacteria 1466
23 Ga0070705_100068549 3300005440 Bacteria 2135
24 Ga0070700_100235580 3300005441 Bacteria 1305
25 Ga0070694_100004438 3300005444 Bacteria 8439
26 Ga0070694_100062372 3300005444 Bacteria 2546
27 Ga0070694_100305064 3300005444 Bacteria 1221
28 Ga0070708_100029545 3300005445 Bacteria 4727
29 Ga0070708_100037290 3300005445 Bacteria 4240
30 Ga0070706_100006897 3300005467 Bacteria 10720
31 Ga0070706_100023551 3300005467 Bacteria 5670
32 Ga0070707_100051101 3300005468 Bacteria 3962
33 Ga0070707_100073017 3300005468 Bacteria 3308
34 Ga0070707_100096694 3300005468 Bacteria 2860
35 Ga0070698_100029772 3300005471 Bacteria 5665
36 Ga0070699_100036227 3300005518 Bacteria 4268
37 Ga0070679_100207063 3300005530 Bacteria 1926
38 Ga0070697_100065107 3300005536 Bacteria 2978
39 Ga0070695_100051493 3300005545 Bacteria 2642
40 Ga0070693_100006066 3300005547 Bacteria 5851
41 Ga0070704_100100160 3300005549 Bacteria 2181
42 Ga0070704_100231742 3300005549 Bacteria 1507
43 Ga0068855_100048873 3300005563 Bacteria 4991
44 Ga0070664_100243159 3300005564 Bacteria 1616
45 Ga0068857_100029651 3300005577 Bacteria 4829
46 Ga0068857_100068942 3300005577 Bacteria 3148
47 Ga0068857_100110646 3300005577 Bacteria 2469
48 Ga0068857_100282494 3300005577 Bacteria 1527
49 Ga0068854_100100318 3300005578 Bacteria 2169
50 Ga0068854_100298734 3300005578 Bacteria 1302
51 Ga0070702_100069759 3300005615 Bacteria 2072
52 Ga0068859_100007582 3300005617 Bacteria 11026
53 Ga0068859_100029484 3300005617 Bacteria 5505
54 Ga0068859_100067930 3300005617 Bacteria 3599
55 Ga0068859_100084283 3300005617 Bacteria 3223
56 Ga0068859_100099220 3300005617 Bacteria 2967
57 Ga0068859_100155592 3300005617 Bacteria 2363
58 Ga0068859_100235976 3300005617 Bacteria 1917
59 Ga0068859_100671708 3300005617 Bacteria 1127
60 Ga0068864_100128591 3300005618 Bacteria 2273
61 Ga0068861_100020275 3300005719 Bacteria 4758
62 Ga0068861_100201681 3300005719 Bacteria 1670
63 Ga0068863_100123410 3300005841 Archaea 2471
64 Ga0068858_100046043 3300005842 Bacteria 4044
65 Ga0068858_100170176 3300005842 Bacteria 2054
66 Ga0068860_100043107 3300005843 Bacteria 4306
67 Ga0068862_100088866 3300005844 Bacteria 2688
68 Ga0081455_10004550 3300005937 Bacteria 15480
69 Ga0081539_10002213 3300005985 Bacteria 28360
70 Ga0081539_10007497 3300005985 Bacteria 9917
71 Ga0097621_100004499 3300006237 Bacteria 9722
72 Ga0097621_100067997 3300006237 Bacteria 2937
73 Ga0068871_100007061 3300006358 Bacteria 8004
74 Ga0075428_100003601 3300006844 Bacteria 16978
75 Ga0075430_100013095 3300006846 Bacteria 7068
76 Ga0075430_100048696 3300006846 Bacteria 3578
77 Ga0075431_100001640 3300006847 Bacteria 20934
78 Ga0075431_100151378 3300006847 Bacteria 2389
79 Ga0075431_100529357 3300006847 Bacteria 1167
80 Ga0075434_100368841 3300006871 Bacteria 1457
81 Ga0068865_100489812 3300006881 Bacteria 1023
82 Ga0097620_100007581 3300006931 Bacteria 11026
83 Ga0097620_100029483 3300006931 Bacteria 5505
84 Ga0097620_100067933 3300006931 Bacteria 3599
85 Ga0097620_100084285 3300006931 Bacteria 3223
86 Ga0097620_100099218 3300006931 Bacteria 2967
87 Ga0097620_100155592 3300006931 Bacteria 2363
88 Ga0097620_100235985 3300006931 Bacteria 1917
89 Ga0097620_100671740 3300006931 Bacteria 1127
90 Ga0111539_10002351 3300009094 Bacteria 25174
91 Ga0111539_10012005 3300009094 Bacteria 10861
92 Ga0111539_10186474 3300009094 Bacteria 2422
93 Ga0111539_10355219 3300009094 Bacteria 1705
94 Ga0105247_10002797 3300009101 Bacteria 11672
95 Ga0105247_10011309 3300009101 Bacteria 5384
96 Ga0105247_10136002 3300009101 Bacteria 1606
97 Ga0114129_10011131 3300009147 Bacteria 12822
98 Ga0114129_10015250 3300009147 Bacteria 10937
99 Ga0114129_10231410 3300009147 Bacteria 2489
100 Ga0114129_10233429 3300009147 Bacteria 2477
101 Ga0114129_10520382 3300009147 Bacteria 1551
102 Ga0105243_10208225 3300009148 Bacteria 1720
103 Ga0105243_10280987 3300009148 Bacteria 1499
104 Ga0105243_10317405 3300009148 Bacteria 1418
105 Ga0105241_10091547 3300009174 Bacteria 2400
106 Ga0105241_10359359 3300009174 Bacteria 1267
107 Ga0105248_10005950 3300009177 Bacteria 13398
108 Ga0105248_10090225 3300009177 Unclassified 3451
109 Ga0105248_10168878 3300009177 Bacteria 2465
110 Ga0105248_10177235 3300009177 Bacteria 2402
111 Ga0105248_10716020 3300009177 Bacteria 1129
112 Ga0105237_10002177 3300009545 Bacteria 24586
113 Ga0105238_10002420 3300009551 Bacteria 18719
114 Ga0105238_10129833 3300009551 Bacteria 2498
115 Ga0105249_10075009 3300009553 Unclassified 3132
116 Ga0105249_10115167 3300009553 Bacteria 2547
117 Ga0105249_10399700 3300009553 Bacteria 1404
118 Ga0105249_10525852 3300009553 Bacteria 1231
119 Ga0105239_10361255 3300010375 Bacteria 1640
120 Ga0105246_10012516 3300011119 Bacteria 5298
121 Ga0157373_10027055 3300013100 Bacteria 4138
122 Ga0157371_10106311 3300013102 Bacteria 1991
123 Ga0157374_10139669 3300013296 Bacteria 2351
124 Ga0157378_10184806 3300013297 Bacteria 1963
125 Ga0163162_10067482 3300013306 Bacteria 3627
126 Ga0163162_10092788 3300013306 Bacteria 3103
127 Ga0163162_10143305 3300013306 Bacteria 2504
128 Ga0157375_10156773 3300013308 Bacteria 2416
129 Ga0157375_10340123 3300013308 Bacteria 1666
130 Ga0157375_10396959 3300013308 Bacteria 1546
131 Ga0163163_10000238 3300014325 Bacteria 56166
132 Ga0163163_10545132 3300014325 Bacteria 1222
133 Ga0157380_10039177 3300014326 Bacteria 3684
134 Ga0157380_10110651 3300014326 Bacteria 2307
135 Ga0157379_10233583 3300014968 Bacteria 1667
136 Ga0157379_10263664 3300014968 Bacteria 1566
137 Ga0213873_10006275 3300021358 Bacteria 2333
138 Ga0213876_10001790 3300021384 Bacteria 13007
139 Ga0213876_10125379 3300021384 Bacteria 1364
140 Ga0207710_10008690 3300025900 Bacteria 4283
141 Ga0207647_10001526 3300025904 Bacteria 17817
142 Ga0207643_10021989 3300025908 Bacteria 3510
143 Ga0207643_10150702 3300025908 Bacteria 1394
144 Ga0207684_10005327 3300025910 Bacteria 11891
145 Ga0207671_10001273 3300025914 Bacteria 29705
146 Ga0207671_10130510 3300025914 Bacteria 1928
147 Ga0207660_10104272 3300025917 Bacteria 2123
148 Ga0207652_10276206 3300025921 Bacteria 1516
149 Ga0207646_10041969 3300025922 Bacteria 4110
150 Ga0207646_10109442 3300025922 Bacteria 2479
151 Ga0207681_10039424 3300025923 Bacteria 3136
152 Ga0207681_10085649 3300025923 Bacteria 2237
153 Ga0207694_10091562 3300025924 Bacteria 2400
154 Ga0207694_10204567 3300025924 Bacteria 1607
155 Ga0207694_10474077 3300025924 Bacteria 1046
156 Ga0207650_10000009 3300025925 Bacteria 483583
157 Ga0207650_10199739 3300025925 Bacteria 1601
158 Ga0207690_10037655 3300025932 Bacteria 3142
159 Ga0207709_10013723 3300025935 Bacteria 4470
160 Ga0207670_10493134 3300025936 Bacteria 994
161 Ga0207711_10011014 3300025941 Bacteria 7514
162 Ga0207711_10021729 3300025941 Bacteria 5360
163 Ga0207689_10446336 3300025942 Archaea 1081
164 Ga0207712_10006895 3300025961 Bacteria 7173
165 Ga0207677_10203577 3300026023 Bacteria 1575
166 Ga0207703_10025782 3300026035 Bacteria 4626
167 Ga0207703_10196734 3300026035 Bacteria 1789
168 Ga0207708_10065981 3300026075 Bacteria 2767
169 Ga0207708_10209347 3300026075 Bacteria 1558
170 Ga0207641_10145807 3300026088 Archaea 2140
171 Ga0207648_10125793 3300026089 Bacteria 2255
172 Ga0207676_10034760 3300026095 Bacteria 3818
173 Ga0207676_10108717 3300026095 Bacteria 2316
174 Ga0207674_10006471 3300026116 Bacteria 13770
175 Ga0207674_10011337 3300026116 Bacteria 10016
176 Ga0207674_10039526 3300026116 Bacteria 4890
177 Ga0207674_10227190 3300026116 Bacteria 1814
178 Ga0207674_10305505 3300026116 Bacteria 1540
179 Ga0207675_100081611 3300026118 Bacteria 3032
180 Ga0207683_10379272 3300026121 Bacteria 1300
181 Ga0207698_10068533 3300026142 Bacteria 2802
182 Ga0207428_10006237 3300027907 Bacteria 11017
183 Ga0207428_10021981 3300027907 Bacteria 5389
184 Ga0268264_10173851 3300028381 Bacteria 1950
185 Ga0265314_10003491 3300031711 Bacteria 15181
186 Ga0307405_10295125 3300031731 Bacteria 1227
187 Ga0307412_10092386 3300031911 Bacteria 2121
188 Ga0307414_10422291 3300032004 Bacteria 1163
189 Ga0307411_10382574 3300032005 Bacteria 1158
190 Ga0307415_100070905 3300032126 Bacteria 2448
191 Ga0395899_0042990 3300037312 Bacteria 3371
192 Ga0395900_0012559 3300037418 Bacteria 8666
193 Ga0395898_0036116 3300037466 Bacteria 4909
194 Ga0395905_0034165 3300037471 Bacteria 4774
195 Ga0395901_0061207 3300038443 Bacteria 3917
196 Ga0436365_0792129 3300039437 Bacteria 7460
197 Ga0436365_0856555 3300039437 Bacteria 3691
198 Ga0436365_0983108 3300039437 Bacteria 2464
199 Ga0436365_1034273 3300039437 Bacteria 15593
200 Ga0436362_0966846 3300039453 Bacteria 2714
201 Ga0453684_0003458 3300044712 Bacteria 35504
202 Ga0453684_0016498 3300044712 Bacteria 11539
203 Ga0453684_0190106 3300044712 Bacteria 2402
204 Ga0451576_0790247 3300045051 Bacteria 997
205 Ga0495632_0047794 3300046519 Bacteria 2121
206 Ga0495589_0071077 3300046794 Bacteria 1701
207 Ga0496104_0248623 3300048907 Bacteria 1691
208 Ga0496109_0000016 3300048912 Bacteria 212455
209 Ga0496114_0034650 3300048917 Bacteria 4166
210 Ga0496114_0119161 3300048917 Bacteria 2269
211 Ga0501291_000750 3300049514 Bacteria 3679
212 Ga0501291_007333 3300049514 Bacteria 1492
213 Ga0501298_000253 3300049521 Bacteria 6954
214 Ga0501299_002319 3300049522 Bacteria 2628
215 Ga0501198_008418 3300049649 Bacteria 1497
216 Ga0501201_004406 3300049651 Bacteria 1304
217 Ga0501216_009229 3300049660 Bacteria 1569
218 Ga0501227_021245 3300049665 Bacteria 1496
219 Ga0501235_003915 3300049669 Bacteria 3219
220 Ga0501235_016472 3300049669 Bacteria 1633
221 Ga0501243_020037 3300049675 Bacteria 1098
222 Ga0501252_004502 3300049682 Bacteria 1486
223 Ga0501261_002908 3300049690 Bacteria 2104
224 Ga0501080_0002712 3300049742 Bacteria 15522
225 Ga0501083_0052497 3300049744 Bacteria 2738
226 Ga0501268_017278 3300049765 Bacteria 1203
227 Ga0501271_002358 3300049768 Bacteria 1683
228 Ga0501212_006034 3300049851 Bacteria 1623
229 nmdc:mga05p37_11397_c2 3300050507 Bacteria 4082
230 nmdc:mga05p37_293376_c1 3300050507 Bacteria 1935
231 nmdc:mga05p37_446792_c1 3300050507 Bacteria 1498
232 nmdc:mga09592_28590_c1 3300050508 Bacteria 4632
233 nmdc:mga0qj67_70323_c1 3300050509 Bacteria 2792
234 nmdc:mga0qj67_7037_c1 3300050509 Bacteria 8293
235 nmdc:mga06r32_68348_c1 3300050510 Bacteria 3432
236 nmdc:mga06r32_833117_c1 3300050510 Bacteria 882
237 nmdc:mga08y16_103067_c1 3300050511 Bacteria 2971
238 nmdc:mga08y16_109505_c1 3300050511 Bacteria 2876
239 nmdc:mga08y16_1120_c1 3300050511 Bacteria 26424
240 nmdc:mga08y16_112410_c1 3300050511 Bacteria 2835
241 nmdc:mga08y16_26014_c1 3300050511 Bacteria 6174
242 nmdc:mga08y16_442811_c1 3300050511 Bacteria 1326
243 nmdc:mga0a205_60893_c1 3300050515 Bacteria 3646
244 Ga0495619_0175860 3300053085 Bacteria 1481
245 Ga0500566_0002442 3300053094 Bacteria 11026
246 Ga0501082_0010907 3300060353 Bacteria 7819

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049651 Ga0501201_004406 Ga0501201_004406_38_814 255
2 3300060353 Ga0501082_0010907 Ga0501082_0010907_7019_7789 255
3 3300049665 Ga0501227_021245 Ga0501227_021245_416_1192 257
4 3300050509 nmdc:mga0qj67_70323_c1 nmdc:mga0qj67_70323_c1_1962_2765 258
5 3300045051 Ga0451576_0790247 Ga0451576_0790247_27_815 259
6 3300049514 Ga0501291_007333 Ga0501291_007333_641_1441 259
7 3300049660 Ga0501216_009229 Ga0501216_009229_710_1510 259
8 3300049669 Ga0501235_003915 Ga0501235_003915_2351_3151 259
9 3300050510 nmdc:mga06r32_833117_c1 nmdc:mga06r32_833117_c1_52_834 260
10 3300005366 Ga0070659_100094717 Ga0070659_1000947172 265
11 3300025932 Ga0207690_10037655 Ga0207690_100376554 265
12 3300025942 Ga0207689_10446336 Ga0207689_104463362 274
13 3300039437 Ga0436365_0856555 Ga0436365_0856555_355_1203 280
14 3300039453 Ga0436362_0966846 Ga0436362_0966846_748_1596 280
15 3300005468 Ga0070707_100073017 Ga0070707_1000730172 285
16 3300009174 Ga0105241_10359359 Ga0105241_103593591 287
17 3300027907 Ga0207428_10006237 Ga0207428_100062374 287
18 3300050507 nmdc:mga05p37_11397_c2 nmdc:mga05p37_11397_c2_2352_3281 287
19 3300050507 nmdc:mga05p37_293376_c1 nmdc:mga05p37_293376_c1_31_894 287
20 3300050511 nmdc:mga08y16_1120_c1 nmdc:mga08y16_1120_c1_23491_24420 287
21 3300048907 Ga0496104_0248623 Ga0496104_0248623_669_1664 288
22 3300006847 Ga0075431_100529357 Ga0075431_1005293571 293
23 3300048917 Ga0496114_0119161 Ga0496114_0119161_220_1170 294
24 3300037312 Ga0395899_0042990 Ga0395899_0042990_382_1308 296
25 3300037418 Ga0395900_0012559 Ga0395900_0012559_5424_6350 296
26 3300037466 Ga0395898_0036116 Ga0395898_0036116_2289_3215 296
27 3300037471 Ga0395905_0034165 Ga0395905_0034165_1800_2726 296
28 3300038443 Ga0395901_0061207 Ga0395901_0061207_2932_3858 296
29 3300005445 Ga0070708_100029545 Ga0070708_1000295453 297
30 3300005467 Ga0070706_100006897 Ga0070706_1000068976 297
31 3300005467 Ga0070706_100023551 Ga0070706_1000235514 297
32 3300005468 Ga0070707_100051101 Ga0070707_1000511013 297
33 3300005468 Ga0070707_100096694 Ga0070707_1000966942 297
34 3300005536 Ga0070697_100065107 Ga0070697_1000651072 297
35 3300013296 Ga0157374_10139669 Ga0157374_101396693 297
36 3300014968 Ga0157379_10233583 Ga0157379_102335832 297
37 3300025910 Ga0207684_10005327 Ga0207684_100053276 297
38 3300025922 Ga0207646_10041969 Ga0207646_100419693 297
39 3300025922 Ga0207646_10109442 Ga0207646_101094423 297
40 3300005445 Ga0070708_100037290 Ga0070708_1000372904 298
41 3300005365 Ga0070688_100204176 Ga0070688_1002041761 299
42 3300005438 Ga0070701_10049461 Ga0070701_100494612 299
43 3300005617 Ga0068859_100671708 Ga0068859_1006717081 299
44 3300006931 Ga0097620_100671740 Ga0097620_1006717401 299
45 3300053085 Ga0495619_0175860 Ga0495619_0175860_38_958 299
46 3300005295 Ga0065707_10099119 Ga0065707_100991192 300
47 3300026095 Ga0207676_10108717 Ga0207676_101087172 300
48 3300005617 Ga0068859_100084283 Ga0068859_1000842832 301
49 3300006237 Ga0097621_100067997 Ga0097621_1000679972 301
50 3300006846 Ga0075430_100048696 Ga0075430_1000486962 301
51 3300006847 Ga0075431_100001640 Ga0075431_1000016404 301
52 3300006931 Ga0097620_100084285 Ga0097620_1000842852 301
53 3300009147 Ga0114129_10233429 Ga0114129_102334293 301
54 3300009148 Ga0105243_10317405 Ga0105243_103174052 301
55 3300009177 Ga0105248_10005950 Ga0105248_100059502 301
56 3300025941 Ga0207711_10011014 Ga0207711_100110148 301
57 3300044712 Ga0453684_0003458 Ga0453684_0003458_20341_21255 301
58 3300044712 Ga0453684_0016498 Ga0453684_0016498_10476_11384 301
59 3300050508 nmdc:mga09592_28590_c1 nmdc:mga09592_28590_c1_177_1103 301
60 3300050509 nmdc:mga0qj67_7037_c1 nmdc:mga0qj67_7037_c1_4781_5707 301
61 3300005471 Ga0070698_100029772 Ga0070698_1000297722 302
62 3300005518 Ga0070699_100036227 Ga0070699_1000362273 302
63 3300005563 Ga0068855_100048873 Ga0068855_1000488732 302
64 3300021358 Ga0213873_10006275 Ga0213873_100062753 302
65 3300053094 Ga0500566_0002442 Ga0500566_0002442_9339_10295 302
66 3300005843 Ga0068860_100043107 Ga0068860_1000431072 303
67 3300009148 Ga0105243_10280987 Ga0105243_102809873 303
68 3300009551 Ga0105238_10129833 Ga0105238_101298331 303
69 3300009553 Ga0105249_10399700 Ga0105249_103997002 303
70 3300025924 Ga0207694_10204567 Ga0207694_102045671 303
71 3300025935 Ga0207709_10013723 Ga0207709_100137233 303
72 3300025936 Ga0207670_10493134 Ga0207670_104931341 303
73 3300026089 Ga0207648_10125793 Ga0207648_101257932 303
74 3300028381 Ga0268264_10173851 Ga0268264_101738511 303
75 3300031731 Ga0307405_10295125 Ga0307405_102951252 303
76 3300031911 Ga0307412_10092386 Ga0307412_100923862 303
77 3300032004 Ga0307414_10422291 Ga0307414_104222911 303
78 3300032005 Ga0307411_10382574 Ga0307411_103825741 303
79 iso_pu_bacteria 2643221679 2644446945 303
80 3300005290 Ga0065712_10011026 Ga0065712_100110262 304
81 3300005293 Ga0065715_10001357 Ga0065715_100013573 304
82 3300005564 Ga0070664_100243159 Ga0070664_1002431592 304
83 3300005577 Ga0068857_100110646 Ga0068857_1001106463 304
84 3300005617 Ga0068859_100067930 Ga0068859_1000679303 304
85 3300005842 Ga0068858_100046043 Ga0068858_1000460433 304
86 3300006931 Ga0097620_100067933 Ga0097620_1000679333 304
87 3300009101 Ga0105247_10002797 Ga0105247_1000279711 304
88 3300009101 Ga0105247_10011309 Ga0105247_100113092 304
89 3300009177 Ga0105248_10716020 Ga0105248_107160202 304
90 3300011119 Ga0105246_10012516 Ga0105246_100125165 304
91 3300025900 Ga0207710_10008690 Ga0207710_100086902 304
92 3300025914 Ga0207671_10130510 Ga0207671_101305103 304
93 3300025923 Ga0207681_10039424 Ga0207681_100394243 304
94 3300026116 Ga0207674_10011337 Ga0207674_100113379 304
95 3300026118 Ga0207675_100081611 Ga0207675_1000816112 304
96 3300026142 Ga0207698_10068533 Ga0207698_100685333 304
97 3300005577 Ga0068857_100282494 Ga0068857_1002824941 305
98 3300005617 Ga0068859_100235976 Ga0068859_1002359762 305
99 3300006844 Ga0075428_100003601 Ga0075428_10000360112 305
100 3300006931 Ga0097620_100235985 Ga0097620_1002359852 305
101 3300009147 Ga0114129_10011131 Ga0114129_100111314 305
102 3300009174 Ga0105241_10091547 Ga0105241_100915472 305
103 3300013306 Ga0163162_10092788 Ga0163162_100927882 305
104 3300014325 Ga0163163_10545132 Ga0163163_105451322 305
105 3300026116 Ga0207674_10305505 Ga0207674_103055051 305
106 3300046519 Ga0495632_0047794 Ga0495632_0047794_781_1701 305
107 3300046794 Ga0495589_0071077 Ga0495589_0071077_366_1331 305
108 3300050511 nmdc:mga08y16_109505_c1 nmdc:mga08y16_109505_c1_1698_2615 305
109 3300003203 JGI25406J46586_10033509 JGI25406J46586_100335092 306
110 3300005289 Ga0065704_10096294 Ga0065704_100962943 306
111 3300005345 Ga0070692_10013675 Ga0070692_100136752 306
112 3300005353 Ga0070669_100085259 Ga0070669_1000852593 306
113 3300005353 Ga0070669_100133701 Ga0070669_1001337011 306
114 3300005438 Ga0070701_10122637 Ga0070701_101226372 306
115 3300005440 Ga0070705_100068549 Ga0070705_1000685492 306
116 3300005441 Ga0070700_100235580 Ga0070700_1002355802 306
117 3300005444 Ga0070694_100004438 Ga0070694_1000044382 306
118 3300005444 Ga0070694_100062372 Ga0070694_1000623722 306
119 3300005530 Ga0070679_100207063 Ga0070679_1002070632 306
120 3300005547 Ga0070693_100006066 Ga0070693_1000060662 306
121 3300005549 Ga0070704_100231742 Ga0070704_1002317422 306
122 3300005577 Ga0068857_100029651 Ga0068857_1000296512 306
123 3300005577 Ga0068857_100068942 Ga0068857_1000689423 306
124 3300005578 Ga0068854_100100318 Ga0068854_1001003181 306
125 3300005615 Ga0070702_100069759 Ga0070702_1000697592 306
126 3300005617 Ga0068859_100007582 Ga0068859_1000075828 306
127 3300005617 Ga0068859_100029484 Ga0068859_1000294844 306
128 3300005617 Ga0068859_100099220 Ga0068859_1000992202 306
129 3300005617 Ga0068859_100155592 Ga0068859_1001555922 306
130 3300005618 Ga0068864_100128591 Ga0068864_1001285913 306
131 3300005719 Ga0068861_100020275 Ga0068861_1000202752 306
132 3300005841 Ga0068863_100123410 Ga0068863_1001234102 306
133 3300005842 Ga0068858_100170176 Ga0068858_1001701762 306
134 3300005844 Ga0068862_100088866 Ga0068862_1000888664 306
135 3300005985 Ga0081539_10002213 Ga0081539_100022133 306
136 3300006931 Ga0097620_100007581 Ga0097620_1000075818 306
137 3300006931 Ga0097620_100029483 Ga0097620_1000294834 306
138 3300006931 Ga0097620_100099218 Ga0097620_1000992182 306
139 3300006931 Ga0097620_100155592 Ga0097620_1001555922 306
140 3300009094 Ga0111539_10355219 Ga0111539_103552192 306
141 3300009147 Ga0114129_10520382 Ga0114129_105203822 306
142 3300009148 Ga0105243_10208225 Ga0105243_102082252 306
143 3300009177 Ga0105248_10090225 Ga0105248_100902253 306
144 3300009545 Ga0105237_10002177 Ga0105237_1000217721 306
145 3300009553 Ga0105249_10075009 Ga0105249_100750094 306
146 3300009553 Ga0105249_10115167 Ga0105249_101151672 306
147 3300013100 Ga0157373_10027055 Ga0157373_100270552 306
148 3300013102 Ga0157371_10106311 Ga0157371_101063112 306
149 3300013297 Ga0157378_10184806 Ga0157378_101848062 306
150 3300013306 Ga0163162_10067482 Ga0163162_100674824 306
151 3300013306 Ga0163162_10143305 Ga0163162_101433053 306
152 3300013308 Ga0157375_10340123 Ga0157375_103401232 306
153 3300014325 Ga0163163_10000238 Ga0163163_1000023829 306
154 3300014326 Ga0157380_10039177 Ga0157380_100391773 306
155 3300014968 Ga0157379_10263664 Ga0157379_102636642 306
156 3300025908 Ga0207643_10021989 Ga0207643_100219892 306
157 3300025908 Ga0207643_10150702 Ga0207643_101507022 306
158 3300025914 Ga0207671_10001273 Ga0207671_1000127326 306
159 3300025921 Ga0207652_10276206 Ga0207652_102762062 306
160 3300025923 Ga0207681_10085649 Ga0207681_100856492 306
161 3300025925 Ga0207650_10000009 Ga0207650_10000009223 306
162 3300025925 Ga0207650_10199739 Ga0207650_101997391 306
163 3300025941 Ga0207711_10021729 Ga0207711_100217296 306
164 3300025961 Ga0207712_10006895 Ga0207712_100068956 306
165 3300026023 Ga0207677_10203577 Ga0207677_102035771 306
166 3300026035 Ga0207703_10025782 Ga0207703_100257822 306
167 3300026035 Ga0207703_10196734 Ga0207703_101967341 306
168 3300026075 Ga0207708_10065981 Ga0207708_100659812 306
169 3300026075 Ga0207708_10209347 Ga0207708_102093473 306
170 3300026088 Ga0207641_10145807 Ga0207641_101458071 306
171 3300026095 Ga0207676_10034760 Ga0207676_100347602 306
172 3300026116 Ga0207674_10006471 Ga0207674_1000647113 306
173 3300026116 Ga0207674_10039526 Ga0207674_100395265 306
174 3300026116 Ga0207674_10227190 Ga0207674_102271902 306
175 3300031711 Ga0265314_10003491 Ga0265314_1000349110 306
176 3300049514 Ga0501291_000750 Ga0501291_000750_271_1200 306
177 3300049521 Ga0501298_000253 Ga0501298_000253_2888_3817 306
178 3300049522 Ga0501299_002319 Ga0501299_002319_1666_2595 306
179 3300049669 Ga0501235_016472 Ga0501235_016472_373_1302 306
180 3300049675 Ga0501243_020037 Ga0501243_020037_68_997 306
181 3300049690 Ga0501261_002908 Ga0501261_002908_699_1628 306
182 3300049768 Ga0501271_002358 Ga0501271_002358_341_1270 306
183 3300050507 nmdc:mga05p37_446792_c1 nmdc:mga05p37_446792_c1_288_1211 306
184 3300050511 nmdc:mga08y16_103067_c1 nmdc:mga08y16_103067_c1_277_1197 306
185 3300050511 nmdc:mga08y16_442811_c1 nmdc:mga08y16_442811_c1_78_998 306
186 3300006846 Ga0075430_100013095 Ga0075430_1000130956 307
187 3300006847 Ga0075431_100151378 Ga0075431_1001513782 307
188 3300009101 Ga0105247_10136002 Ga0105247_101360022 307
189 3300009147 Ga0114129_10015250 Ga0114129_100152505 307
190 3300048917 Ga0496114_0034650 Ga0496114_0034650_220_1188 307
191 3300049742 Ga0501080_0002712 Ga0501080_0002712_14108_15040 307
192 3300049744 Ga0501083_0052497 Ga0501083_0052497_1684_2616 307
193 3300005334 Ga0068869_100202985 Ga0068869_1002029852 308
194 3300005336 Ga0070680_100020866 Ga0070680_1000208664 308
195 3300005364 Ga0070673_100596505 Ga0070673_1005965051 308
196 3300005545 Ga0070695_100051493 Ga0070695_1000514932 308
197 3300005549 Ga0070704_100100160 Ga0070704_1001001602 308
198 3300005578 Ga0068854_100298734 Ga0068854_1002987342 308
199 3300005719 Ga0068861_100201681 Ga0068861_1002016812 308
200 3300006881 Ga0068865_100489812 Ga0068865_1004898121 308
201 3300009094 Ga0111539_10012005 Ga0111539_100120052 308
202 3300009177 Ga0105248_10168878 Ga0105248_101688782 308
203 3300009177 Ga0105248_10177235 Ga0105248_101772353 308
204 3300010375 Ga0105239_10361255 Ga0105239_103612551 308
205 3300013308 Ga0157375_10156773 Ga0157375_101567733 308
206 3300013308 Ga0157375_10396959 Ga0157375_103969591 308
207 3300014326 Ga0157380_10110651 Ga0157380_101106512 308
208 3300021384 Ga0213876_10125379 Ga0213876_101253791 308
209 3300025917 Ga0207660_10104272 Ga0207660_101042721 308
210 3300025924 Ga0207694_10474077 Ga0207694_104740771 308
211 3300026121 Ga0207683_10379272 Ga0207683_103792722 308
212 3300039437 Ga0436365_0792129 Ga0436365_0792129_4679_5614 308
213 3300039437 Ga0436365_0983108 Ga0436365_0983108_1468_2403 308
214 3300005331 Ga0070670_100058892 Ga0070670_1000588923 309
215 3300005937 Ga0081455_10004550 Ga0081455_100045508 309
216 3300005985 Ga0081539_10007497 Ga0081539_100074973 309
217 3300006871 Ga0075434_100368841 Ga0075434_1003688412 309
218 3300009094 Ga0111539_10186474 Ga0111539_101864742 309
219 3300009147 Ga0114129_10231410 Ga0114129_102314102 309
220 3300009553 Ga0105249_10525852 Ga0105249_105258521 309
221 3300048912 Ga0496109_0000016 Ga0496109_0000016_134822_135763 309
222 3300050510 nmdc:mga06r32_68348_c1 nmdc:mga06r32_68348_c1_1695_2624 309
223 3300050511 nmdc:mga08y16_112410_c1 nmdc:mga08y16_112410_c1_1234_2163 309
224 3300050515 nmdc:mga0a205_60893_c1 nmdc:mga0a205_60893_c1_1041_1970 309
225 3300032126 Ga0307415_100070905 Ga0307415_1000709051 310
226 3300044712 Ga0453684_0190106 Ga0453684_0190106_562_1506 310
227 3300049649 Ga0501198_008418 Ga0501198_008418_77_1030 310
228 3300049682 Ga0501252_004502 Ga0501252_004502_406_1359 310
229 3300049765 Ga0501268_017278 Ga0501268_017278_204_1157 310
230 3300049851 Ga0501212_006034 Ga0501212_006034_35_988 310
231 2162886006 SwRhRL3b_contig_581922 SwRhRL3b_0091.00001740 311
232 2162886007 SwRhRL2b_contig_1829743 SwRhRL2b_0535.00000600 311
233 3300005289 Ga0065704_10147080 Ga0065704_101470802 311
234 3300005293 Ga0065715_10095129 Ga0065715_100951291 311
235 3300005295 Ga0065707_10006684 Ga0065707_100066842 311
236 3300005337 Ga0070682_100002797 Ga0070682_1000027973 311
237 3300005444 Ga0070694_100305064 Ga0070694_1003050641 311
238 3300006237 Ga0097621_100004499 Ga0097621_1000044994 311
239 3300006358 Ga0068871_100007061 Ga0068871_1000070617 311
240 3300009094 Ga0111539_10002351 Ga0111539_1000235122 311
241 3300009551 Ga0105238_10002420 Ga0105238_100024206 311
242 3300021384 Ga0213876_10001790 Ga0213876_100017904 311
243 3300025904 Ga0207647_10001526 Ga0207647_100015268 311
244 3300025924 Ga0207694_10091562 Ga0207694_100915622 311
245 3300027907 Ga0207428_10021981 Ga0207428_100219814 311
246 3300039437 Ga0436365_1034273 Ga0436365_1034273_12045_12995 311
247 3300050511 nmdc:mga08y16_26014_c1 nmdc:mga08y16_26014_c1_1529_2464 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

56

197

0.98

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

129

231

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9447 7 225
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9353 8 218
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9224 6 219
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9212 6 218
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9114 6 225
ID Description Score Start End Superfamily
1vplA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9447 7 225 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9427 8 222 3.40.50.300
af_A4I2P8_1496_1744_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9404 3 225 3.40.50.300
af_Q8T6J0_514_774_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9397 1 225 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9385 1 225 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2H1J8Z5-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9615 6 226 GO:0005524
GO:0016887
AF-A0A2Z5YFA9-F1-model_v4 deleted 0.9554 1 218
AF-A0A0U3H3Q4-F1-model_v4 ABC transporter ATP-binding protein 0.9549 6 225 GO:0005524
GO:0016887
AF-A0A2V3VNW7-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9543 6 225 GO:0005524
GO:0005886
GO:0016887
AF-A0A1X0B0N3-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9541 2 226 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.96 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map