F358583

General Info

Members Datasets Scaffolds Average Seq Length
246 186 492 302

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2506783011|2506867942
Length 342
Sequence LLRRLVLLALSLVAASLLVFLLLRLLPGDVADVIAGTTASPEQVARIRHQLGVDRPLITQYASWVGGVLTGDFGASAVNGVSVSAQLGEKLTVTAPLVAGATVLAVAVALPLGIISAARHRRADGLALSTLSQLGIAVPSFWVGLMLITLFAVEWGVLPAGGFPTDGWDDPAAAVRSLALPVVTLALVEGAVLMRFTRSATLEVLHADFIRTARAKGLTRGRALLRHGVRNAAGPVLSVLGLEFATLLAGTVVIENVFALPGVGQMLIVDIGNRDLVKVQGTVLLITVAVLVVGFLVDVGHRLLDPRLLDPRLLDPRLLDPRLLDPRLLDPRLPAAGTRGPR

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
65 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
122 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
139 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
140 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
161 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
171 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
172 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
173 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
174 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
175 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
176 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
179 2506783011 Frankia datiscae Dg1 Isolate Nodule
180 2508501039 Frankia saprophytica CN3 Isolate Nodule
181 2773857933 Frankia sp. BMG5.30 Isolate Nodule
182 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
183 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
184 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
185 8002775197 Frankia nepalensis CN7 Isolate Nodule
186 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.75
Metatranscriptomes 0
Isolates 3.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.23
Nodule 1.63
Rhizoplane 1.22
Rhizosphere 74.8
Stem 0
Stem Tuber 0
Unclassified 2.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10001010 3300003187 Bacteria 21257
2 JGI25406J46586_10012391 3300003203 Bacteria 3702
3 rootH1_10092746 3300003316 Bacteria 1228
4 rootH2_10044369 3300003320 Bacteria 10110
5 rootH2_10163792 3300003320 Bacteria 1813
6 JGI25160J50197_1003002 3300003354 Bacteria 7696
7 Ga0070658_10003457 3300005327 Bacteria 12988
8 Ga0070683_100054240 3300005329 Bacteria 3717
9 Ga0070683_100130980 3300005329 Bacteria 2373
10 Ga0070680_100006822 3300005336 Bacteria 8702
11 Ga0068868_100313904 3300005338 Bacteria 1334
12 Ga0070689_100047635 3300005340 Bacteria 3305
13 Ga0070691_10025995 3300005341 Bacteria 2727
14 Ga0070668_100002990 3300005347 Bacteria 12496
15 Ga0070659_100372511 3300005366 Bacteria 1201
16 Ga0070709_10228892 3300005434 Bacteria 1329
17 Ga0070714_100057728 3300005435 Bacteria 3323
18 Ga0070713_100108533 3300005436 Bacteria 2416
19 Ga0070708_100051898 3300005445 Bacteria 3634
20 Ga0070708_100247576 3300005445 Bacteria 1674
21 Ga0070662_100029557 3300005457 Bacteria 3826
22 Ga0070681_10002984 3300005458 Bacteria 15697
23 Ga0070707_100238586 3300005468 Bacteria 1770
24 Ga0070699_100076397 3300005518 Bacteria 2915
25 Ga0070679_100003518 3300005530 Bacteria 14338
26 Ga0068853_100330812 3300005539 Bacteria 1414
27 Ga0070665_100074825 3300005548 Bacteria 3393
28 Ga0070665_100118026 3300005548 Bacteria 2655
29 Ga0068855_100017144 3300005563 Bacteria 8713
30 Ga0068855_100025374 3300005563 Bacteria 7092
31 Ga0070664_100007857 3300005564 Bacteria 8616
32 Ga0070664_100381020 3300005564 Bacteria 1287
33 Ga0068854_100181312 3300005578 Bacteria 1645
34 Ga0068856_100193177 3300005614 Bacteria 2049
35 Ga0068852_100154709 3300005616 Bacteria 2135
36 Ga0068860_100056079 3300005843 Bacteria 3747
37 Ga0081455_10002173 3300005937 Bacteria 23387
38 Ga0081455_10004843 3300005937 Bacteria 14938
39 Ga0081455_10021830 3300005937 Bacteria 5996
40 Ga0081455_10029725 3300005937 Bacteria 4977
41 Ga0081455_10097093 3300005937 Bacteria 2374
42 Ga0081455_10103219 3300005937 Bacteria 2284
43 Ga0081540_1001697 3300005983 Bacteria 18682
44 Ga0081540_1023127 3300005983 Bacteria 3647
45 Ga0081539_10017595 3300005985 Bacteria 5009
46 Ga0081539_10018505 3300005985 Bacteria 4830
47 Ga0070717_10024120 3300006028 Bacteria 4827
48 Ga0070717_10261296 3300006028 Bacteria 1532
49 Ga0075365_10062849 3300006038 Bacteria 2484
50 Ga0075365_10170403 3300006038 Bacteria 1519
51 Ga0070715_10013718 3300006163 Bacteria 2983
52 Ga0075362_10002674 3300006177 Bacteria 6056
53 Ga0075362_10007938 3300006177 Bacteria 4040
54 Ga0075367_10010941 3300006178 Bacteria 4780
55 Ga0075367_10079145 3300006178 Bacteria 1986
56 Ga0075367_10117846 3300006178 Bacteria 1634
57 Ga0075369_10027295 3300006186 Bacteria 2386
58 Ga0075366_10050025 3300006195 Bacteria 2481
59 Ga0075370_10045652 3300006353 Bacteria 2478
60 Ga0075370_10073159 3300006353 Bacteria 1962
61 Ga0075428_100010134 3300006844 Bacteria 10470
62 Ga0075430_100031848 3300006846 Bacteria 4476
63 Ga0075431_100001738 3300006847 Bacteria 20487
64 Ga0075433_10035726 3300006852 Bacteria 4277
65 Ga0075434_100130255 3300006871 Bacteria 2534
66 Ga0075429_100018352 3300006880 Bacteria 6058
67 Ga0105251_10024801 3300009011 Bacteria 3075
68 Ga0105240_10137229 3300009093 Bacteria 2928
69 Ga0105240_10409139 3300009093 Bacteria 1526
70 Ga0111539_10002925 3300009094 Bacteria 22643
71 Ga0111539_10024000 3300009094 Bacteria 7491
72 Ga0105247_10000032 3300009101 Bacteria 185415
73 Ga0114129_10003274 3300009147 Bacteria 22735
74 Ga0105242_10434629 3300009176 Bacteria 1233
75 Ga0105248_10002095 3300009177 Bacteria 22091
76 Ga0105248_10397248 3300009177 Bacteria 1552
77 Ga0105237_10010686 3300009545 Bacteria 9745
78 Ga0105237_10154153 3300009545 Bacteria 2294
79 Ga0105237_10235141 3300009545 Bacteria 1833
80 Ga0105238_10133061 3300009551 Bacteria 2465
81 Ga0105035_101683 3300009988 Bacteria 1561
82 Ga0099796_10027747 3300010159 Bacteria 1811
83 Ga0157369_10231718 3300013105 Bacteria 1931
84 Ga0157369_10338567 3300013105 Bacteria 1563
85 Ga0157372_10646924 3300013307 Bacteria 1231
86 Ga0163163_10035815 3300014325 Bacteria 4818
87 Ga0157379_10052936 3300014968 Bacteria 3626
88 Ga0213876_10021978 3300021384 Bacteria 3374
89 Ga0213871_10000183 3300021441 Bacteria 7025
90 Ga0209130_1003776 3300025284 Bacteria 6171
91 Ga0209025_1000514 3300025294 Bacteria 73822
92 Ga0209758_1001641 3300025297 Bacteria 25405
93 Ga0207426_1000066 3300025302 Bacteria 351182
94 Ga0207426_1011638 3300025302 Bacteria 3339
95 Ga0207710_10000077 3300025900 Bacteria 145153
96 Ga0207685_10066548 3300025905 Bacteria 1446
97 Ga0207699_10025810 3300025906 Bacteria 3231
98 Ga0207705_10022946 3300025909 Bacteria 4450
99 Ga0207684_10045262 3300025910 Bacteria 3734
100 Ga0207707_10010697 3300025912 Bacteria 7972
101 Ga0207695_10108125 3300025913 Bacteria 2766
102 Ga0207693_10048338 3300025915 Bacteria 3340
103 Ga0207657_10123437 3300025919 Bacteria 2129
104 Ga0207649_10098018 3300025920 Bacteria 1934
105 Ga0207652_10018599 3300025921 Bacteria 5700
106 Ga0207694_10055639 3300025924 Bacteria 3071
107 Ga0207694_10258308 3300025924 Bacteria 1427
108 Ga0207700_10028435 3300025928 Bacteria 3931
109 Ga0207700_10062516 3300025928 Bacteria 2829
110 Ga0207670_10153487 3300025936 Bacteria 1711
111 Ga0207689_10025905 3300025942 Bacteria 4911
112 Ga0207661_10003058 3300025944 Bacteria 11581
113 Ga0207679_10109761 3300025945 Bacteria 2175
114 Ga0207667_10113091 3300025949 Bacteria 2799
115 Ga0207667_10330532 3300025949 Bacteria 1556
116 Ga0207651_10290160 3300025960 Bacteria 1356
117 Ga0207712_10227806 3300025961 Bacteria 1494
118 Ga0207640_10115757 3300025981 Bacteria 1910
119 Ga0207639_10116319 3300026041 Bacteria 2189
120 Ga0207639_10124485 3300026041 Bacteria 2123
121 Ga0207678_10255850 3300026067 Bacteria 1500
122 Ga0207708_10182594 3300026075 Bacteria 1666
123 Ga0207702_10013140 3300026078 Bacteria 6884
124 Ga0207676_10263122 3300026095 Bacteria 1558
125 Ga0207675_100109107 3300026118 Bacteria 2611
126 Ga0207675_100147060 3300026118 Bacteria 2241
127 Ga0207698_10056414 3300026142 Bacteria 3033
128 Ga0207428_10019445 3300027907 Bacteria 5789
129 Ga0268266_10055612 3300028379 Bacteria 3402
130 Ga0268266_10090794 3300028379 Bacteria 2677
131 Ga0268264_10018637 3300028381 Bacteria 5674
132 Ga0268264_10153370 3300028381 Bacteria 2068
133 Ga0265324_10042858 3300029957 Bacteria 1563
134 Ga0265332_10039948 3300031238 Unclassified 2032
135 Ga0265329_10013833 3300031242 Unclassified 2864
136 Ga0265340_10035390 3300031247 Bacteria 2480
137 Ga0265314_10003880 3300031711 Bacteria 14234
138 Ga0307407_10386870 3300031903 Unclassified 1000
139 Ga0307415_100048038 3300032126 Unclassified 2877
140 Ga0307415_100145589 3300032126 Bacteria 1816
141 Ga0373935_0273243 3300035692 Bacteria 1188
142 Ga0373937_0556105 3300036401 Bacteria 1090
143 Ga0373925_0215830 3300037068 Bacteria 1530
144 Ga0395899_0097327 3300037312 Bacteria 2127
145 Ga0395899_0161890 3300037312 Bacteria 1580
146 Ga0395900_0008730 3300037418 Bacteria 10407
147 Ga0395900_0022222 3300037418 Bacteria 6489
148 Ga0395900_0240047 3300037418 Bacteria 1818
149 Ga0395898_0028181 3300037466 Bacteria 5632
150 Ga0395898_0059768 3300037466 Bacteria 3706
151 Ga0395905_0321658 3300037471 Bacteria 1437
152 Ga0395901_0012627 3300038443 Bacteria 8570
153 Ga0395901_0073839 3300038443 Bacteria 3558
154 Ga0395901_0113911 3300038443 Bacteria 2840
155 Ga0395901_0191661 3300038443 Bacteria 2143
156 Ga0395901_0220634 3300038443 Bacteria 1982
157 Ga0436365_1583942 3300039437 Bacteria 10173
158 Ga0436360_0133927 3300039438 Bacteria 11900
159 Ga0436361_0939780 3300039447 Bacteria 5692
160 Ga0436363_1691674 3300039450 Bacteria 3454
161 Ga0436362_0293772 3300039453 Bacteria 1368
162 Ga0451853_1406104 3300041512 Bacteria 1166
163 Ga0439448_0048237 3300042005 Bacteria 1390
164 Ga0439432_042226 3300042006 Bacteria 1442
165 Ga0451577_0122924 3300042876 Bacteria 2325
166 Ga0466963_0014986 3300044694 Bacteria 4791
167 Ga0466963_0102386 3300044694 Bacteria 1961
168 Ga0466963_0343815 3300044694 Bacteria 1050
169 Ga0466964_0030496 3300044706 Bacteria 2135
170 Ga0466957_0056611 3300044842 Bacteria 2398
171 Ga0466959_0015727 3300045049 Bacteria 5518
172 Ga0466959_0321884 3300045049 Bacteria 1057
173 Ga0466967_0054244 3300045976 Bacteria 3526
174 Ga0466967_0148468 3300045976 Bacteria 2189
175 Ga0466967_0412170 3300045976 Bacteria 1316
176 Ga0495592_0178127 3300046454 Bacteria 1450
177 Ga0495610_0048581 3300046512 Bacteria 2082
178 Ga0495658_0005667 3300046683 Bacteria 6137
179 Ga0495672_0022464 3300047320 Bacteria 4099
180 Ga0495687_092218 3300047443 Bacteria 1157
181 Ga0495686_0040727 3300047472 Bacteria 2961
182 Ga0495686_0240962 3300047472 Unclassified 1020
183 Ga0496104_0626006 3300048907 Bacteria 986
184 Ga0496112_0663932 3300048915 Bacteria 972
185 Ga0496115_0001417 3300048918 Bacteria 17161
186 Ga0496116_0014118 3300048919 Bacteria 6395
187 Ga0496119_0000332 3300048922 Bacteria 66091
188 Ga0496120_0000422 3300048923 Bacteria 67516
189 Ga0496120_0012465 3300048923 Bacteria 5786
190 Ga0496121_0040380 3300048924 Bacteria 4095
191 Ga0496122_0000252 3300048925 Bacteria 120561
192 Ga0496123_0016603 3300048926 Bacteria 5967
193 Ga0496125_0246271 3300048928 Bacteria 1131
194 Ga0496126_0000404 3300048929 Bacteria 87755
195 Ga0496126_0033372 3300048929 Bacteria 4843
196 Ga0501031_0270999 3300049568 Bacteria 1102
197 Ga0501032_0161588 3300049569 Bacteria 1471
198 Ga0501034_0000621 3300049571 Bacteria 55508
199 Ga0501034_0289996 3300049571 Unclassified 1575
200 Ga0501038_0192017 3300049574 Bacteria 1643
201 Ga0501039_0098058 3300049575 Bacteria 2286
202 Ga0501040_0013451 3300049576 Bacteria 5379
203 Ga0501042_0006289 3300049578 Bacteria 7707
204 Ga0501047_0141959 3300049581 Bacteria 2280
205 Ga0501068_0003730 3300049584 Bacteria 8243
206 Ga0501068_0041921 3300049584 Bacteria 2752
207 Ga0501070_0000807 3300049586 Bacteria 28476
208 Ga0501070_0194791 3300049586 Bacteria 1665
209 Ga0501072_0200459 3300049588 Bacteria 1591
210 Ga0501076_0144189 3300049592 Bacteria 1936
211 Ga0501035_0214378 3300049822 Bacteria 1646
212 Ga0501035_0317712 3300049822 Unclassified 1309
213 Ga0501044_0006912 3300049823 Bacteria 12489
214 nmdc:mga03683_15947_c1 3300050489 Bacteria 2813
215 nmdc:mga03683_23647_c1 3300050489 Bacteria 2396
216 nmdc:mga03683_71198_c1 3300050489 Bacteria 1487
217 nmdc:mga03n38_61817_c1 3300050490 Bacteria 1706
218 nmdc:mga0k408_31995_c2 3300050493 Bacteria 2537
219 nmdc:mga0k408_56829_c1 3300050493 Bacteria 2271
220 nmdc:mga06z11_27066_c1 3300050494 Bacteria 2738
221 nmdc:mga06z11_8539_c1 3300050494 Bacteria 4281
222 nmdc:mga07m45_26142_c1 3300050496 Bacteria 1961
223 nmdc:mga05p37_968_c2 3300050507 Bacteria 22586
224 nmdc:mga09592_3465_c1 3300050508 Bacteria 12744
225 nmdc:mga06r32_1261_c1 3300050510 Bacteria 22739
226 nmdc:mga08y16_11108_c1 3300050511 Bacteria 9457
227 nmdc:mga08y16_434595_c1 3300050511 Bacteria 1340
228 nmdc:mga0n895_113739_c1 3300050512 Bacteria 2724
229 nmdc:mga0sz30_111382_c1 3300050516 Bacteria 1200
230 nmdc:mga0sz30_712_c1 3300050516 Bacteria 12233
231 Ga0500651_0034867 3300053093 Bacteria 3172
232 Ga0500556_0029349 3300053104 Bacteria 1854
233 Ga0500642_0025926 3300053130 Bacteria 2387
234 Ga0500561_0009470 3300053137 Bacteria 1980
235 Ga0500568_0018068 3300053139 Bacteria 3096
236 Ga0500604_0000220 3300053151 Bacteria 16409
237 Ga0501082_0096028 3300060353 Bacteria 2562
238 Ga0466962_0023383 3300061719 Bacteria 2971
239 2506867942 2506783011 Bacteria 5323186
240 2508674850 2508501039 Bacteria 9978592
241 2774904441 2773857933 Bacteria 5818019
242 2821449147 2821443989 Bacteria 7658172
243 2844539273 2844533157 Bacteria 7517899
244 2868092782 2868088558 Bacteria 7609351
245 8002778126 8002775197 Bacteria 10728764
246 8002813111 8002811521 Bacteria 2942897
247 JGI25151J46595_10001010
248 JGI25406J46586_10012391
249 rootH1_10092746
250 rootH2_10044369
251 rootH2_10163792
252 JGI25160J50197_1003002
253 Ga0070658_10003457
254 Ga0070683_100054240
255 Ga0070683_100130980
256 Ga0070680_100006822
257 Ga0068868_100313904
258 Ga0070689_100047635
259 Ga0070691_10025995
260 Ga0070668_100002990
261 Ga0070659_100372511
262 Ga0070709_10228892
263 Ga0070714_100057728
264 Ga0070713_100108533
265 Ga0070708_100051898
266 Ga0070708_100247576
267 Ga0070662_100029557
268 Ga0070681_10002984
269 Ga0070707_100238586
270 Ga0070699_100076397
271 Ga0070679_100003518
272 Ga0068853_100330812
273 Ga0070665_100074825
274 Ga0070665_100118026
275 Ga0068855_100017144
276 Ga0068855_100025374
277 Ga0070664_100007857
278 Ga0070664_100381020
279 Ga0068854_100181312
280 Ga0068856_100193177
281 Ga0068852_100154709
282 Ga0068860_100056079
283 Ga0081455_10002173
284 Ga0081455_10004843
285 Ga0081455_10021830
286 Ga0081455_10029725
287 Ga0081455_10097093
288 Ga0081455_10103219
289 Ga0081540_1001697
290 Ga0081540_1023127
291 Ga0081539_10017595
292 Ga0081539_10018505
293 Ga0070717_10024120
294 Ga0070717_10261296
295 Ga0075365_10062849
296 Ga0075365_10170403
297 Ga0070715_10013718
298 Ga0075362_10002674
299 Ga0075362_10007938
300 Ga0075367_10010941
301 Ga0075367_10079145
302 Ga0075367_10117846
303 Ga0075369_10027295
304 Ga0075366_10050025
305 Ga0075370_10045652
306 Ga0075370_10073159
307 Ga0075428_100010134
308 Ga0075430_100031848
309 Ga0075431_100001738
310 Ga0075433_10035726
311 Ga0075434_100130255
312 Ga0075429_100018352
313 Ga0105251_10024801
314 Ga0105240_10137229
315 Ga0105240_10409139
316 Ga0111539_10002925
317 Ga0111539_10024000
318 Ga0105247_10000032
319 Ga0114129_10003274
320 Ga0105242_10434629
321 Ga0105248_10002095
322 Ga0105248_10397248
323 Ga0105237_10010686
324 Ga0105237_10154153
325 Ga0105237_10235141
326 Ga0105238_10133061
327 Ga0105035_101683
328 Ga0099796_10027747
329 Ga0157369_10231718
330 Ga0157369_10338567
331 Ga0157372_10646924
332 Ga0163163_10035815
333 Ga0157379_10052936
334 Ga0213876_10021978
335 Ga0213871_10000183
336 Ga0209130_1003776
337 Ga0209025_1000514
338 Ga0209758_1001641
339 Ga0207426_1000066
340 Ga0207426_1011638
341 Ga0207710_10000077
342 Ga0207685_10066548
343 Ga0207699_10025810
344 Ga0207705_10022946
345 Ga0207684_10045262
346 Ga0207707_10010697
347 Ga0207695_10108125
348 Ga0207693_10048338
349 Ga0207657_10123437
350 Ga0207649_10098018
351 Ga0207652_10018599
352 Ga0207694_10055639
353 Ga0207694_10258308
354 Ga0207700_10028435
355 Ga0207700_10062516
356 Ga0207670_10153487
357 Ga0207689_10025905
358 Ga0207661_10003058
359 Ga0207679_10109761
360 Ga0207667_10113091
361 Ga0207667_10330532
362 Ga0207651_10290160
363 Ga0207712_10227806
364 Ga0207640_10115757
365 Ga0207639_10116319
366 Ga0207639_10124485
367 Ga0207678_10255850
368 Ga0207708_10182594
369 Ga0207702_10013140
370 Ga0207676_10263122
371 Ga0207675_100109107
372 Ga0207675_100147060
373 Ga0207698_10056414
374 Ga0207428_10019445
375 Ga0268266_10055612
376 Ga0268266_10090794
377 Ga0268264_10018637
378 Ga0268264_10153370
379 Ga0265324_10042858
380 Ga0265332_10039948
381 Ga0265329_10013833
382 Ga0265340_10035390
383 Ga0265314_10003880
384 Ga0307407_10386870
385 Ga0307415_100048038
386 Ga0307415_100145589
387 Ga0373935_0273243
388 Ga0373937_0556105
389 Ga0373925_0215830
390 Ga0395899_0097327
391 Ga0395899_0161890
392 Ga0395900_0008730
393 Ga0395900_0022222
394 Ga0395900_0240047
395 Ga0395898_0028181
396 Ga0395898_0059768
397 Ga0395905_0321658
398 Ga0395901_0012627
399 Ga0395901_0073839
400 Ga0395901_0113911
401 Ga0395901_0191661
402 Ga0395901_0220634
403 Ga0436365_1583942
404 Ga0436360_0133927
405 Ga0436361_0939780
406 Ga0436363_1691674
407 Ga0436362_0293772
408 Ga0451853_1406104
409 Ga0439448_0048237
410 Ga0439432_042226
411 Ga0451577_0122924
412 Ga0466963_0014986
413 Ga0466963_0102386
414 Ga0466963_0343815
415 Ga0466964_0030496
416 Ga0466957_0056611
417 Ga0466959_0015727
418 Ga0466959_0321884
419 Ga0466967_0054244
420 Ga0466967_0148468
421 Ga0466967_0412170
422 Ga0495592_0178127
423 Ga0495610_0048581
424 Ga0495658_0005667
425 Ga0495672_0022464
426 Ga0495687_092218
427 Ga0495686_0040727
428 Ga0495686_0240962
429 Ga0496104_0626006
430 Ga0496112_0663932
431 Ga0496115_0001417
432 Ga0496116_0014118
433 Ga0496119_0000332
434 Ga0496120_0000422
435 Ga0496120_0012465
436 Ga0496121_0040380
437 Ga0496122_0000252
438 Ga0496123_0016603
439 Ga0496125_0246271
440 Ga0496126_0000404
441 Ga0496126_0033372
442 Ga0501031_0270999
443 Ga0501032_0161588
444 Ga0501034_0000621
445 Ga0501034_0289996
446 Ga0501038_0192017
447 Ga0501039_0098058
448 Ga0501040_0013451
449 Ga0501042_0006289
450 Ga0501047_0141959
451 Ga0501068_0003730
452 Ga0501068_0041921
453 Ga0501070_0000807
454 Ga0501070_0194791
455 Ga0501072_0200459
456 Ga0501076_0144189
457 Ga0501035_0214378
458 Ga0501035_0317712
459 Ga0501044_0006912
460 nmdc:mga03683_15947_c1
461 nmdc:mga03683_23647_c1
462 nmdc:mga03683_71198_c1
463 nmdc:mga03n38_61817_c1
464 nmdc:mga0k408_31995_c2
465 nmdc:mga0k408_56829_c1
466 nmdc:mga06z11_27066_c1
467 nmdc:mga06z11_8539_c1
468 nmdc:mga07m45_26142_c1
469 nmdc:mga05p37_968_c2
470 nmdc:mga09592_3465_c1
471 nmdc:mga06r32_1261_c1
472 nmdc:mga08y16_11108_c1
473 nmdc:mga08y16_434595_c1
474 nmdc:mga0n895_113739_c1
475 nmdc:mga0sz30_111382_c1
476 nmdc:mga0sz30_712_c1
477 Ga0500651_0034867
478 Ga0500556_0029349
479 Ga0500642_0025926
480 Ga0500561_0009470
481 Ga0500568_0018068
482 Ga0500604_0000220
483 Ga0501082_0096028
484 Ga0466962_0023383
485 2506867942
486 2508674850
487 2774904441
488 2821449147
489 2844539273
490 2868092782
491 8002778126
492 8002813111

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

109

310

0.97

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

1

97

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8079 89 292
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7807 90 291
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.7781 87 292
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7734 90 291
7ahd-assembly1.cif.gz_B opua (e190q) occluded 0.7715 87 292
ID Description Score Start End Superfamily
af_Q2FZR7_83_297_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9476 85 292 1.10.3720.10
af_Q2G1F7_265_478_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9251 89 294 1.10.3720.10
af_Q2FZQ9_85_310_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9235 86 292 1.10.3720.10
af_P9WFZ7_89_318_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9051 90 292 1.10.3720.10
af_P0AFH2_84_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8963 87 294 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A443G087-F1-model_v4 deleted 0.942 48 259
AF-A0A1G9DRC5-F1-model_v4 Peptide/nickel transport system permease protein 0.9419 48 286 GO:0005886
GO:0071916
AF-A0A1G9DRC5-F1-model_v4 Peptide/nickel transport system permease protein 0.9307 48 286 GO:0005886
GO:0071916
AF-X1DG11-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9306 93 287 GO:0005886
GO:0055085
AF-A0A4R1I3V4-F1-model_v4 Peptide/nickel transport system permease protein 0.93 6 292 GO:0005886
GO:0071916

Map