F358446
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 246 | 173 | 492 | 304 |
Family's Representative Sequence
| Representative Sequence | 3300046518|Ga0495631_0094937|Ga0495631_0094937_294_1223 |
| Length | 299 |
| Sequence | MKTQPDASLGGSDAQSHGGRLFFLSLSGGQVLSMNPDGSDMVAIVSGAHLPDGVAIHAQAGHVYWTNMGVPSLDDGSIERCDLDGRNRITIIPQGVTHTPKQIHLDPANGKLYWADREGMRMMILVVSGDPEIHRGDATKWCVGVTLDHARGQLYWTQKGSDNAGEGRILRAGIEIPAGETAANRRDVEVWRNGLPEPIDLEFDPASRVMYWTDRGDPPAGNTLNRAAVDAPASEPPEILIDHLMEAIGLALDVAGGRLFVTDFGGSVYAARFDGSNEQVLAFGQGNLTGVAYADVSGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 16 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 17 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 18 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 19 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 23 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 25 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 26 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 27 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 28 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 29 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 30 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 31 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 32 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 33 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 34 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 47 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 48 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 49 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 66 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 67 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 68 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 69 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 71 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 72 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 73 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 74 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 75 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 76 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 77 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 78 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 79 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 80 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 81 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 82 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 83 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 84 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 85 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 86 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 87 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 140 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 141 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 142 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 143 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 144 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 145 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 146 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 148 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 156 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 159 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 160 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 161 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 162 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 163 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 164 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 165 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 166 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 167 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 168 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 169 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 170 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 171 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 172 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 173 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.28 |
| Metatranscriptomes | 0 |
| Isolates | 7.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.22 |
| Nodule | 6.5 |
| Rhizoplane | 2.85 |
| Rhizosphere | 80.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495631_0094937 | 3300046518 | Bacteria | 1284 |
| 2 | JGI25406J46586_10000172 | 3300003203 | Bacteria | 28962 |
| 3 | rootH2_10179199 | 3300003320 | Bacteria | 1439 |
| 4 | JGI25404J52841_10000704 | 3300003659 | Bacteria | 5165 |
| 5 | JGI25404J52841_10002917 | 3300003659 | Bacteria | 3314 |
| 6 | Ga0065707_10110066 | 3300005295 | Bacteria | 2445 |
| 7 | Ga0070691_10024467 | 3300005341 | Bacteria | 2806 |
| 8 | Ga0070671_100141143 | 3300005355 | Bacteria | 2033 |
| 9 | Ga0070710_10130680 | 3300005437 | Bacteria | 1531 |
| 10 | Ga0070705_100159493 | 3300005440 | Bacteria | 1506 |
| 11 | Ga0070694_100006670 | 3300005444 | Bacteria | 7011 |
| 12 | Ga0070694_100012432 | 3300005444 | Bacteria | 5292 |
| 13 | Ga0070662_100008591 | 3300005457 | Bacteria | 6662 |
| 14 | Ga0070706_100085980 | 3300005467 | Bacteria | 2914 |
| 15 | Ga0070707_100108053 | 3300005468 | Bacteria | 2699 |
| 16 | Ga0070695_100050124 | 3300005545 | Bacteria | 2675 |
| 17 | Ga0068861_100093431 | 3300005719 | Bacteria | 2378 |
| 18 | Ga0068860_100017077 | 3300005843 | Bacteria | 7075 |
| 19 | Ga0081540_1000136 | 3300005983 | Bacteria | 78663 |
| 20 | Ga0081540_1000625 | 3300005983 | Bacteria | 33652 |
| 21 | Ga0081540_1001429 | 3300005983 | Bacteria | 20644 |
| 22 | Ga0081540_1006143 | 3300005983 | Bacteria | 8817 |
| 23 | Ga0081540_1007009 | 3300005983 | Bacteria | 8108 |
| 24 | Ga0081540_1008406 | 3300005983 | Bacteria | 7215 |
| 25 | Ga0081540_1008813 | 3300005983 | Bacteria | 7007 |
| 26 | Ga0081540_1101506 | 3300005983 | Bacteria | 1238 |
| 27 | Ga0081539_10000003 | 3300005985 | Bacteria | 594833 |
| 28 | Ga0070715_10064134 | 3300006163 | Bacteria | 1622 |
| 29 | Ga0070716_100183331 | 3300006173 | Bacteria | 1377 |
| 30 | Ga0070716_100204638 | 3300006173 | Bacteria | 1315 |
| 31 | Ga0070712_100030993 | 3300006175 | Bacteria | 3599 |
| 32 | Ga0075367_10049638 | 3300006178 | Bacteria | 2474 |
| 33 | Ga0097621_100091117 | 3300006237 | Bacteria | 2552 |
| 34 | Ga0097621_100350783 | 3300006237 | Bacteria | 1312 |
| 35 | Ga0068871_100008799 | 3300006358 | Bacteria | 7272 |
| 36 | Ga0075428_100075624 | 3300006844 | Bacteria | 3677 |
| 37 | Ga0075428_100171559 | 3300006844 | Bacteria | 2351 |
| 38 | Ga0075430_100003064 | 3300006846 | Bacteria | 13969 |
| 39 | Ga0075430_100125164 | 3300006846 | Bacteria | 2142 |
| 40 | Ga0075431_100033671 | 3300006847 | Bacteria | 5279 |
| 41 | Ga0075433_10019020 | 3300006852 | Bacteria | 5715 |
| 42 | Ga0075434_100014508 | 3300006871 | Bacteria | 7533 |
| 43 | Ga0075429_100011546 | 3300006880 | Bacteria | 7661 |
| 44 | Ga0099823_1039116 | 3300006944 | Bacteria | 3502 |
| 45 | Ga0075435_100015624 | 3300007076 | Bacteria | 5710 |
| 46 | Ga0075435_100148230 | 3300007076 | Bacteria | 1971 |
| 47 | Ga0099795_10000922 | 3300007788 | Bacteria | 5950 |
| 48 | Ga0105240_10001672 | 3300009093 | Bacteria | 37648 |
| 49 | Ga0105240_10066475 | 3300009093 | Bacteria | 4472 |
| 50 | Ga0105240_10270715 | 3300009093 | Bacteria | 1956 |
| 51 | Ga0111539_10032807 | 3300009094 | Bacteria | 6305 |
| 52 | Ga0114129_10080579 | 3300009147 | Bacteria | 4525 |
| 53 | Ga0114129_10081407 | 3300009147 | Bacteria | 4500 |
| 54 | Ga0105243_10043301 | 3300009148 | Bacteria | 3528 |
| 55 | Ga0105242_10840966 | 3300009176 | Bacteria | 912 |
| 56 | Ga0105248_10000106 | 3300009177 | Bacteria | 93898 |
| 57 | Ga0105237_10000430 | 3300009545 | Bacteria | 59639 |
| 58 | Ga0105237_10572657 | 3300009545 | Bacteria | 1136 |
| 59 | Ga0105249_10031393 | 3300009553 | Bacteria | 4805 |
| 60 | Ga0105239_10029647 | 3300010375 | Bacteria | 6016 |
| 61 | Ga0163162_10045641 | 3300013306 | Bacteria | 4389 |
| 62 | Ga0163163_10732415 | 3300014325 | Bacteria | 1052 |
| 63 | Ga0157379_10053622 | 3300014968 | Bacteria | 3602 |
| 64 | Ga0213872_10027462 | 3300021361 | Unclassified | 2613 |
| 65 | Ga0213872_10083763 | 3300021361 | Bacteria | 1431 |
| 66 | Ga0213876_10049205 | 3300021384 | Bacteria | 2227 |
| 67 | Ga0213875_10000009 | 3300021388 | Bacteria | 451129 |
| 68 | Ga0207685_10065044 | 3300025905 | Bacteria | 1459 |
| 69 | Ga0207684_10058893 | 3300025910 | Bacteria | 3260 |
| 70 | Ga0207695_10001549 | 3300025913 | Bacteria | 37807 |
| 71 | Ga0207695_10049463 | 3300025913 | Bacteria | 4430 |
| 72 | Ga0207671_10000523 | 3300025914 | Bacteria | 51846 |
| 73 | Ga0207693_10026567 | 3300025915 | Bacteria | 4580 |
| 74 | Ga0207693_10065358 | 3300025915 | Bacteria | 2849 |
| 75 | Ga0207663_10013232 | 3300025916 | Bacteria | 4481 |
| 76 | Ga0207646_10191921 | 3300025922 | Bacteria | 1845 |
| 77 | Ga0207700_10125812 | 3300025928 | Bacteria | 2085 |
| 78 | Ga0207700_10400522 | 3300025928 | Bacteria | 1203 |
| 79 | Ga0207644_10244702 | 3300025931 | Bacteria | 1429 |
| 80 | Ga0207706_10009049 | 3300025933 | Bacteria | 9162 |
| 81 | Ga0207686_10026876 | 3300025934 | Bacteria | 3364 |
| 82 | Ga0207665_10215234 | 3300025939 | Bacteria | 1406 |
| 83 | Ga0207689_10014912 | 3300025942 | Bacteria | 6595 |
| 84 | Ga0207712_10014523 | 3300025961 | Bacteria | 5069 |
| 85 | Ga0207668_10233925 | 3300025972 | Bacteria | 1483 |
| 86 | Ga0207708_10024544 | 3300026075 | Bacteria | 4561 |
| 87 | Ga0209389_1007506 | 3300027296 | Bacteria | 9610 |
| 88 | Ga0209489_111015 | 3300027361 | Bacteria | 9610 |
| 89 | Ga0209700_110459 | 3300027363 | Bacteria | 9620 |
| 90 | Ga0207428_10000733 | 3300027907 | Bacteria | 37786 |
| 91 | Ga0207428_10057345 | 3300027907 | Bacteria | 3092 |
| 92 | Ga0268265_10006558 | 3300028380 | Bacteria | 7876 |
| 93 | Ga0268265_10332631 | 3300028380 | Bacteria | 1380 |
| 94 | Ga0307517_10133402 | 3300028786 | Bacteria | 1776 |
| 95 | Ga0307510_10010950 | 3300033180 | Bacteria | 10777 |
| 96 | Ga0307510_10023753 | 3300033180 | Bacteria | 7101 |
| 97 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 98 | Ga0373936_0127427 | 3300035113 | Bacteria | 1092 |
| 99 | Ga0373945_0005371 | 3300035116 | Bacteria | 4101 |
| 100 | Ga0373935_0188900 | 3300035692 | Bacteria | 1418 |
| 101 | Ga0373927_0071308 | 3300035695 | Bacteria | 2249 |
| 102 | Ga0373947_0035252 | 3300035725 | Bacteria | 2962 |
| 103 | Ga0373925_0018001 | 3300037068 | Bacteria | 5130 |
| 104 | Ga0395900_0075111 | 3300037418 | Bacteria | 3474 |
| 105 | Ga0395898_0090971 | 3300037466 | Bacteria | 2936 |
| 106 | Ga0395905_0002674 | 3300037471 | Bacteria | 19542 |
| 107 | Ga0395905_0113483 | 3300037471 | Bacteria | 2546 |
| 108 | Ga0436364_1201245 | 3300037853 | Bacteria | 33298 |
| 109 | Ga0395901_0003058 | 3300038443 | Bacteria | 16851 |
| 110 | Ga0436365_0109263 | 3300039437 | Bacteria | 3855 |
| 111 | Ga0436365_0780822 | 3300039437 | Bacteria | 2541 |
| 112 | Ga0436361_0813175 | 3300039447 | Bacteria | 5693 |
| 113 | Ga0436361_0893686 | 3300039447 | Bacteria | 4031 |
| 114 | Ga0436361_1205038 | 3300039447 | Bacteria | 1392 |
| 115 | Ga0436363_0937467 | 3300039450 | Bacteria | 1551 |
| 116 | Ga0436363_1268008 | 3300039450 | Bacteria | 1872 |
| 117 | Ga0436363_1380668 | 3300039450 | Bacteria | 1643 |
| 118 | Ga0436363_1610190 | 3300039450 | Bacteria | 2358 |
| 119 | Ga0495603_0003986 | 3300046455 | Bacteria | 8788 |
| 120 | Ga0495629_0000130 | 3300046459 | Bacteria | 65355 |
| 121 | Ga0495629_0033126 | 3300046459 | Bacteria | 3656 |
| 122 | Ga0495629_0094804 | 3300046459 | Bacteria | 2082 |
| 123 | Ga0495638_0208076 | 3300046460 | Bacteria | 1100 |
| 124 | Ga0495641_0011920 | 3300046461 | Bacteria | 4905 |
| 125 | Ga0495651_0002683 | 3300046462 | Bacteria | 13807 |
| 126 | Ga0495651_0219972 | 3300046462 | Bacteria | 1315 |
| 127 | Ga0495653_0000287 | 3300046463 | Bacteria | 40916 |
| 128 | Ga0495653_0028181 | 3300046463 | Bacteria | 4492 |
| 129 | Ga0495653_0223274 | 3300046463 | Bacteria | 1265 |
| 130 | Ga0495580_0005931 | 3300046472 | Bacteria | 10018 |
| 131 | Ga0495580_0044087 | 3300046472 | Bacteria | 3173 |
| 132 | Ga0495580_0081045 | 3300046472 | Bacteria | 2262 |
| 133 | Ga0495580_0255801 | 3300046472 | Bacteria | 1198 |
| 134 | Ga0495580_0257847 | 3300046472 | Bacteria | 1193 |
| 135 | Ga0495582_0036489 | 3300046473 | Bacteria | 2704 |
| 136 | Ga0495582_0103867 | 3300046473 | Bacteria | 1592 |
| 137 | Ga0495582_0236006 | 3300046473 | Bacteria | 1047 |
| 138 | Ga0495662_0003730 | 3300046476 | Bacteria | 7676 |
| 139 | Ga0495664_0001627 | 3300046477 | Bacteria | 11938 |
| 140 | Ga0495664_0064830 | 3300046477 | Bacteria | 2177 |
| 141 | Ga0495583_0000991 | 3300046506 | Bacteria | 32505 |
| 142 | Ga0495606_0017630 | 3300046507 | Bacteria | 5389 |
| 143 | Ga0495618_0002868 | 3300046514 | Bacteria | 10928 |
| 144 | Ga0495618_0003817 | 3300046514 | Bacteria | 9327 |
| 145 | Ga0495628_0006685 | 3300046516 | Bacteria | 10055 |
| 146 | Ga0495628_0010938 | 3300046516 | Bacteria | 7684 |
| 147 | Ga0495630_0003756 | 3300046517 | Bacteria | 10599 |
| 148 | Ga0495630_0014716 | 3300046517 | Bacteria | 5704 |
| 149 | Ga0495632_0010306 | 3300046519 | Bacteria | 5548 |
| 150 | Ga0495643_0092395 | 3300046522 | Bacteria | 1560 |
| 151 | Ga0495648_0016967 | 3300046524 | Bacteria | 5228 |
| 152 | Ga0495648_0060601 | 3300046524 | Bacteria | 2251 |
| 153 | Ga0495648_0168618 | 3300046524 | Bacteria | 1124 |
| 154 | Ga0495666_0001210 | 3300046526 | Bacteria | 12464 |
| 155 | Ga0495652_0011111 | 3300046529 | Bacteria | 8157 |
| 156 | Ga0495665_0002391 | 3300046531 | Bacteria | 10136 |
| 157 | Ga0495640_0024645 | 3300046533 | Bacteria | 4374 |
| 158 | Ga0495640_0041939 | 3300046533 | Bacteria | 3195 |
| 159 | Ga0495586_0002165 | 3300046535 | Bacteria | 10680 |
| 160 | Ga0495587_0003300 | 3300046536 | Bacteria | 10777 |
| 161 | Ga0495645_0003156 | 3300046543 | Bacteria | 11171 |
| 162 | Ga0495645_0078889 | 3300046543 | Bacteria | 2366 |
| 163 | Ga0495622_0064444 | 3300046557 | Bacteria | 1695 |
| 164 | Ga0495634_0003748 | 3300046642 | Bacteria | 12107 |
| 165 | Ga0495634_0012329 | 3300046642 | Bacteria | 6194 |
| 166 | Ga0495625_0001932 | 3300046660 | Bacteria | 23427 |
| 167 | Ga0495635_0002829 | 3300046663 | Bacteria | 11914 |
| 168 | Ga0495635_0017617 | 3300046663 | Bacteria | 4989 |
| 169 | Ga0495661_0003141 | 3300046665 | Bacteria | 12369 |
| 170 | Ga0495588_0040114 | 3300046674 | Bacteria | 2387 |
| 171 | Ga0495599_0004615 | 3300046678 | Bacteria | 8166 |
| 172 | Ga0495646_0002143 | 3300046680 | Bacteria | 11987 |
| 173 | Ga0495646_0053510 | 3300046680 | Bacteria | 2433 |
| 174 | Ga0495613_0013630 | 3300046689 | Bacteria | 6033 |
| 175 | Ga0495613_0165495 | 3300046689 | Bacteria | 1571 |
| 176 | Ga0495624_0004212 | 3300046690 | Bacteria | 10562 |
| 177 | Ga0495624_0007587 | 3300046690 | Bacteria | 7613 |
| 178 | Ga0495624_0012107 | 3300046690 | Bacteria | 5906 |
| 179 | Ga0495624_0028816 | 3300046690 | Bacteria | 3625 |
| 180 | Ga0495589_0125996 | 3300046794 | Bacteria | 1232 |
| 181 | Ga0495581_0000785 | 3300047315 | Bacteria | 16839 |
| 182 | Ga0495604_0003789 | 3300047317 | Bacteria | 12033 |
| 183 | Ga0495674_0012425 | 3300047319 | Bacteria | 8024 |
| 184 | Ga0495674_0028625 | 3300047319 | Bacteria | 5076 |
| 185 | Ga0495674_0064874 | 3300047319 | Bacteria | 3173 |
| 186 | Ga0495672_0002118 | 3300047320 | Bacteria | 18607 |
| 187 | Ga0495672_0093139 | 3300047320 | Bacteria | 1650 |
| 188 | Ga0495676_0014047 | 3300047321 | Bacteria | 7172 |
| 189 | Ga0495680_0006981 | 3300047322 | Bacteria | 10416 |
| 190 | Ga0495683_0095137 | 3300047323 | Bacteria | 1439 |
| 191 | Ga0495687_000183 | 3300047443 | Bacteria | 91212 |
| 192 | Ga0495679_003082 | 3300047446 | Bacteria | 8172 |
| 193 | Ga0495679_010813 | 3300047446 | Bacteria | 3560 |
| 194 | Ga0495681_0083662 | 3300047470 | Bacteria | 1420 |
| 195 | Ga0495684_0010107 | 3300047471 | Bacteria | 7296 |
| 196 | Ga0495684_0016169 | 3300047471 | Bacteria | 5746 |
| 197 | Ga0495593_0006251 | 3300047673 | Bacteria | 6990 |
| 198 | Ga0495593_0015300 | 3300047673 | Bacteria | 4348 |
| 199 | Ga0495602_0015283 | 3300048088 | Bacteria | 7753 |
| 200 | Ga0495614_0001609 | 3300048089 | Bacteria | 9815 |
| 201 | Ga0496100_0053143 | 3300048903 | Bacteria | 2637 |
| 202 | Ga0496101_0000701 | 3300048904 | Bacteria | 20112 |
| 203 | Ga0496104_0012213 | 3300048907 | Bacteria | 7718 |
| 204 | Ga0496105_0141379 | 3300048908 | Bacteria | 1981 |
| 205 | Ga0496107_0125373 | 3300048910 | Bacteria | 1894 |
| 206 | Ga0496114_0000664 | 3300048917 | Bacteria | 25510 |
| 207 | Ga0496115_0237116 | 3300048918 | Bacteria | 1504 |
| 208 | Ga0496121_0103513 | 3300048924 | Bacteria | 2190 |
| 209 | Ga0496121_0124671 | 3300048924 | Bacteria | 1939 |
| 210 | Ga0496126_0004460 | 3300048929 | Bacteria | 16727 |
| 211 | Ga0495678_049128 | 3300049459 | Bacteria | 1641 |
| 212 | nmdc:mga06z11_104523_c1 | 3300050494 | Bacteria | 1559 |
| 213 | nmdc:mga05p37_27652_c1 | 3300050507 | Bacteria | 6909 |
| 214 | nmdc:mga05p37_46880_c1 | 3300050507 | Bacteria | 5314 |
| 215 | nmdc:mga09592_12509_c1 | 3300050508 | Bacteria | 6915 |
| 216 | nmdc:mga0qj67_140706_c1 | 3300050509 | Bacteria | 1957 |
| 217 | nmdc:mga0qj67_2286_c1 | 3300050509 | Bacteria | 13612 |
| 218 | nmdc:mga06r32_6322_c1 | 3300050510 | Bacteria | 10636 |
| 219 | nmdc:mga06r32_941_c1 | 3300050510 | Bacteria | 25910 |
| 220 | nmdc:mga08y16_94046_c1 | 3300050511 | Bacteria | 3123 |
| 221 | nmdc:mga0n895_7723_c1 | 3300050512 | Bacteria | 9257 |
| 222 | nmdc:mga0n895_87596_c1 | 3300050512 | Bacteria | 3112 |
| 223 | nmdc:mga0a205_105750_c1 | 3300050515 | Bacteria | 2713 |
| 224 | nmdc:mga0a205_5094_c1 | 3300050515 | Bacteria | 11823 |
| 225 | nmdc:mga0sz30_16310_c1 | 3300050516 | Bacteria | 2948 |
| 226 | Ga0495601_0060676 | 3300053077 | Bacteria | 2399 |
| 227 | Ga0495619_0024096 | 3300053085 | Bacteria | 3902 |
| 228 | 2513722200 | 2513237104 | Bacteria | 10034502 |
| 229 | 2513893757 | 2513237141 | Bacteria | 8496279 |
| 230 | 2517104969 | 2517093001 | Bacteria | 9002274 |
| 231 | 2585399336 | 2582581867 | Bacteria | 7184437 |
| 232 | 2617351599 | 2617270735 | Bacteria | 9163226 |
| 233 | 2824663967 | 2824661429 | Bacteria | 9877870 |
| 234 | 2847938946 | 2847930680 | Bacteria | 9342022 |
| 235 | 2874632571 | 2874628541 | Bacteria | 8630250 |
| 236 | 2885413960 | 2885409591 | Bacteria | 9235467 |
| 237 | 2903751352 | 2903748898 | Bacteria | 9972761 |
| 238 | 2903752643 | 2903748898 | Bacteria | 9972761 |
| 239 | 2903756657 | 2903748898 | Bacteria | 9972761 |
| 240 | 2904695313 | 2904690495 | Bacteria | 9412302 |
| 241 | 2906637267 | 2906635258 | Bacteria | 8601019 |
| 242 | 8016631181 | 8016630954 | Bacteria | 9217207 |
| 243 | 8019565937 | 8019565922 | Bacteria | 9639779 |
| 244 | 8046767891 | 8046767195 | Bacteria | 7547379 |
| 245 | 8046768880 | 8046767195 | Bacteria | 7547379 |
| 246 | 8057582581 | 8057575449 | Bacteria | 7367519 |
| 247 | Ga0495631_0094937 | |||
| 248 | JGI25406J46586_10000172 | |||
| 249 | rootH2_10179199 | |||
| 250 | JGI25404J52841_10000704 | |||
| 251 | JGI25404J52841_10002917 | |||
| 252 | Ga0065707_10110066 | |||
| 253 | Ga0070691_10024467 | |||
| 254 | Ga0070671_100141143 | |||
| 255 | Ga0070710_10130680 | |||
| 256 | Ga0070705_100159493 | |||
| 257 | Ga0070694_100006670 | |||
| 258 | Ga0070694_100012432 | |||
| 259 | Ga0070662_100008591 | |||
| 260 | Ga0070706_100085980 | |||
| 261 | Ga0070707_100108053 | |||
| 262 | Ga0070695_100050124 | |||
| 263 | Ga0068861_100093431 | |||
| 264 | Ga0068860_100017077 | |||
| 265 | Ga0081540_1000136 | |||
| 266 | Ga0081540_1000625 | |||
| 267 | Ga0081540_1001429 | |||
| 268 | Ga0081540_1006143 | |||
| 269 | Ga0081540_1007009 | |||
| 270 | Ga0081540_1008406 | |||
| 271 | Ga0081540_1008813 | |||
| 272 | Ga0081540_1101506 | |||
| 273 | Ga0081539_10000003 | |||
| 274 | Ga0070715_10064134 | |||
| 275 | Ga0070716_100183331 | |||
| 276 | Ga0070716_100204638 | |||
| 277 | Ga0070712_100030993 | |||
| 278 | Ga0075367_10049638 | |||
| 279 | Ga0097621_100091117 | |||
| 280 | Ga0097621_100350783 | |||
| 281 | Ga0068871_100008799 | |||
| 282 | Ga0075428_100075624 | |||
| 283 | Ga0075428_100171559 | |||
| 284 | Ga0075430_100003064 | |||
| 285 | Ga0075430_100125164 | |||
| 286 | Ga0075431_100033671 | |||
| 287 | Ga0075433_10019020 | |||
| 288 | Ga0075434_100014508 | |||
| 289 | Ga0075429_100011546 | |||
| 290 | Ga0099823_1039116 | |||
| 291 | Ga0075435_100015624 | |||
| 292 | Ga0075435_100148230 | |||
| 293 | Ga0099795_10000922 | |||
| 294 | Ga0105240_10001672 | |||
| 295 | Ga0105240_10066475 | |||
| 296 | Ga0105240_10270715 | |||
| 297 | Ga0111539_10032807 | |||
| 298 | Ga0114129_10080579 | |||
| 299 | Ga0114129_10081407 | |||
| 300 | Ga0105243_10043301 | |||
| 301 | Ga0105242_10840966 | |||
| 302 | Ga0105248_10000106 | |||
| 303 | Ga0105237_10000430 | |||
| 304 | Ga0105237_10572657 | |||
| 305 | Ga0105249_10031393 | |||
| 306 | Ga0105239_10029647 | |||
| 307 | Ga0163162_10045641 | |||
| 308 | Ga0163163_10732415 | |||
| 309 | Ga0157379_10053622 | |||
| 310 | Ga0213872_10027462 | |||
| 311 | Ga0213872_10083763 | |||
| 312 | Ga0213876_10049205 | |||
| 313 | Ga0213875_10000009 | |||
| 314 | Ga0207685_10065044 | |||
| 315 | Ga0207684_10058893 | |||
| 316 | Ga0207695_10001549 | |||
| 317 | Ga0207695_10049463 | |||
| 318 | Ga0207671_10000523 | |||
| 319 | Ga0207693_10026567 | |||
| 320 | Ga0207693_10065358 | |||
| 321 | Ga0207663_10013232 | |||
| 322 | Ga0207646_10191921 | |||
| 323 | Ga0207700_10125812 | |||
| 324 | Ga0207700_10400522 | |||
| 325 | Ga0207644_10244702 | |||
| 326 | Ga0207706_10009049 | |||
| 327 | Ga0207686_10026876 | |||
| 328 | Ga0207665_10215234 | |||
| 329 | Ga0207689_10014912 | |||
| 330 | Ga0207712_10014523 | |||
| 331 | Ga0207668_10233925 | |||
| 332 | Ga0207708_10024544 | |||
| 333 | Ga0209389_1007506 | |||
| 334 | Ga0209489_111015 | |||
| 335 | Ga0209700_110459 | |||
| 336 | Ga0207428_10000733 | |||
| 337 | Ga0207428_10057345 | |||
| 338 | Ga0268265_10006558 | |||
| 339 | Ga0268265_10332631 | |||
| 340 | Ga0307517_10133402 | |||
| 341 | Ga0307510_10010950 | |||
| 342 | Ga0307510_10023753 | |||
| 343 | Ga0315911_1000006 | |||
| 344 | Ga0373936_0127427 | |||
| 345 | Ga0373945_0005371 | |||
| 346 | Ga0373935_0188900 | |||
| 347 | Ga0373927_0071308 | |||
| 348 | Ga0373947_0035252 | |||
| 349 | Ga0373925_0018001 | |||
| 350 | Ga0395900_0075111 | |||
| 351 | Ga0395898_0090971 | |||
| 352 | Ga0395905_0002674 | |||
| 353 | Ga0395905_0113483 | |||
| 354 | Ga0436364_1201245 | |||
| 355 | Ga0395901_0003058 | |||
| 356 | Ga0436365_0109263 | |||
| 357 | Ga0436365_0780822 | |||
| 358 | Ga0436361_0813175 | |||
| 359 | Ga0436361_0893686 | |||
| 360 | Ga0436361_1205038 | |||
| 361 | Ga0436363_0937467 | |||
| 362 | Ga0436363_1268008 | |||
| 363 | Ga0436363_1380668 | |||
| 364 | Ga0436363_1610190 | |||
| 365 | Ga0495603_0003986 | |||
| 366 | Ga0495629_0000130 | |||
| 367 | Ga0495629_0033126 | |||
| 368 | Ga0495629_0094804 | |||
| 369 | Ga0495638_0208076 | |||
| 370 | Ga0495641_0011920 | |||
| 371 | Ga0495651_0002683 | |||
| 372 | Ga0495651_0219972 | |||
| 373 | Ga0495653_0000287 | |||
| 374 | Ga0495653_0028181 | |||
| 375 | Ga0495653_0223274 | |||
| 376 | Ga0495580_0005931 | |||
| 377 | Ga0495580_0044087 | |||
| 378 | Ga0495580_0081045 | |||
| 379 | Ga0495580_0255801 | |||
| 380 | Ga0495580_0257847 | |||
| 381 | Ga0495582_0036489 | |||
| 382 | Ga0495582_0103867 | |||
| 383 | Ga0495582_0236006 | |||
| 384 | Ga0495662_0003730 | |||
| 385 | Ga0495664_0001627 | |||
| 386 | Ga0495664_0064830 | |||
| 387 | Ga0495583_0000991 | |||
| 388 | Ga0495606_0017630 | |||
| 389 | Ga0495618_0002868 | |||
| 390 | Ga0495618_0003817 | |||
| 391 | Ga0495628_0006685 | |||
| 392 | Ga0495628_0010938 | |||
| 393 | Ga0495630_0003756 | |||
| 394 | Ga0495630_0014716 | |||
| 395 | Ga0495632_0010306 | |||
| 396 | Ga0495643_0092395 | |||
| 397 | Ga0495648_0016967 | |||
| 398 | Ga0495648_0060601 | |||
| 399 | Ga0495648_0168618 | |||
| 400 | Ga0495666_0001210 | |||
| 401 | Ga0495652_0011111 | |||
| 402 | Ga0495665_0002391 | |||
| 403 | Ga0495640_0024645 | |||
| 404 | Ga0495640_0041939 | |||
| 405 | Ga0495586_0002165 | |||
| 406 | Ga0495587_0003300 | |||
| 407 | Ga0495645_0003156 | |||
| 408 | Ga0495645_0078889 | |||
| 409 | Ga0495622_0064444 | |||
| 410 | Ga0495634_0003748 | |||
| 411 | Ga0495634_0012329 | |||
| 412 | Ga0495625_0001932 | |||
| 413 | Ga0495635_0002829 | |||
| 414 | Ga0495635_0017617 | |||
| 415 | Ga0495661_0003141 | |||
| 416 | Ga0495588_0040114 | |||
| 417 | Ga0495599_0004615 | |||
| 418 | Ga0495646_0002143 | |||
| 419 | Ga0495646_0053510 | |||
| 420 | Ga0495613_0013630 | |||
| 421 | Ga0495613_0165495 | |||
| 422 | Ga0495624_0004212 | |||
| 423 | Ga0495624_0007587 | |||
| 424 | Ga0495624_0012107 | |||
| 425 | Ga0495624_0028816 | |||
| 426 | Ga0495589_0125996 | |||
| 427 | Ga0495581_0000785 | |||
| 428 | Ga0495604_0003789 | |||
| 429 | Ga0495674_0012425 | |||
| 430 | Ga0495674_0028625 | |||
| 431 | Ga0495674_0064874 | |||
| 432 | Ga0495672_0002118 | |||
| 433 | Ga0495672_0093139 | |||
| 434 | Ga0495676_0014047 | |||
| 435 | Ga0495680_0006981 | |||
| 436 | Ga0495683_0095137 | |||
| 437 | Ga0495687_000183 | |||
| 438 | Ga0495679_003082 | |||
| 439 | Ga0495679_010813 | |||
| 440 | Ga0495681_0083662 | |||
| 441 | Ga0495684_0010107 | |||
| 442 | Ga0495684_0016169 | |||
| 443 | Ga0495593_0006251 | |||
| 444 | Ga0495593_0015300 | |||
| 445 | Ga0495602_0015283 | |||
| 446 | Ga0495614_0001609 | |||
| 447 | Ga0496100_0053143 | |||
| 448 | Ga0496101_0000701 | |||
| 449 | Ga0496104_0012213 | |||
| 450 | Ga0496105_0141379 | |||
| 451 | Ga0496107_0125373 | |||
| 452 | Ga0496114_0000664 | |||
| 453 | Ga0496115_0237116 | |||
| 454 | Ga0496121_0103513 | |||
| 455 | Ga0496121_0124671 | |||
| 456 | Ga0496126_0004460 | |||
| 457 | Ga0495678_049128 | |||
| 458 | nmdc:mga06z11_104523_c1 | |||
| 459 | nmdc:mga05p37_27652_c1 | |||
| 460 | nmdc:mga05p37_46880_c1 | |||
| 461 | nmdc:mga09592_12509_c1 | |||
| 462 | nmdc:mga0qj67_140706_c1 | |||
| 463 | nmdc:mga0qj67_2286_c1 | |||
| 464 | nmdc:mga06r32_6322_c1 | |||
| 465 | nmdc:mga06r32_941_c1 | |||
| 466 | nmdc:mga08y16_94046_c1 | |||
| 467 | nmdc:mga0n895_7723_c1 | |||
| 468 | nmdc:mga0n895_87596_c1 | |||
| 469 | nmdc:mga0a205_105750_c1 | |||
| 470 | nmdc:mga0a205_5094_c1 | |||
| 471 | nmdc:mga0sz30_16310_c1 | |||
| 472 | Ga0495601_0060676 | |||
| 473 | Ga0495619_0024096 | |||
| 474 | 2513722200 | |||
| 475 | 2513893757 | |||
| 476 | 2517104969 | |||
| 477 | 2585399336 | |||
| 478 | 2617351599 | |||
| 479 | 2824663967 | |||
| 480 | 2847938946 | |||
| 481 | 2874632571 | |||
| 482 | 2885413960 | |||
| 483 | 2903751352 | |||
| 484 | 2903752643 | |||
| 485 | 2903756657 | |||
| 486 | 2904695313 | |||
| 487 | 2906637267 | |||
| 488 | 8016631181 | |||
| 489 | 8019565937 | |||
| 490 | 8046767891 | |||
| 491 | 8046768880 | |||
| 492 | 8057582581 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3v65-assembly1.cif.gz_B | crystal structure of agrin and lrp4 complex | 0.9057 | 18 | 305 |
| 3v65-assembly1.cif.gz_D | crystal structure of agrin and lrp4 complex | 0.9051 | 18 | 304 |
| 3s2k-assembly1.cif.gz_B | structural basis of wnt signaling inhibition by dickkopf binding to lrp5/6. | 0.9037 | 19 | 305 |
| 8dvn-assembly1.cif.gz_A | crystal structure of lrp6 e3e4 in complex with disulfide constrained peptide e3.10 | 0.9029 | 18 | 305 |
| 8dvl-assembly1.cif.gz_A | crystal structure of lrp6 e3e4 in complex with disulfide constrained peptide e3.18 | 0.9014 | 18 | 304 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4IL75_2_237_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.9075 | 77 | 301 | 2.120.10.30 |
| af_A0A2R8PYI8_197_421_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.9063 | 96 | 303 | 2.120.10.30 |
| 3v65D02 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.9051 | 18 | 304 | 2.120.10.30 |
| 3v64C02 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.9008 | 18 | 305 | 2.120.10.30 |
| af_A0A140LGI0_481_782_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8947 | 18 | 305 | 2.120.10.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A841P3J1-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase | 0.9858 | 19 | 305 |
GO:0005886
GO:0017147 GO:0042813 GO:0060070 |
| AF-A0A560DPE6-F1-model_v4 | Uncharacterized protein | 0.9858 | 201 | 307 |
|
| AF-A0A5N5X017-F1-model_v4 | Uncharacterized protein | 0.9818 | 20 | 170 |
|
| AF-A0A534WEQ0-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase | 0.9758 | 147 | 307 |
GO:0005886
GO:0017147 GO:0042813 GO:0060070 |
| AF-A0A841P3J1-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase | 0.9756 | 19 | 305 |
GO:0005886
GO:0017147 GO:0042813 GO:0060070 |