F358446

General Info

Members Datasets Scaffolds Average Seq Length
246 173 492 304

Family's Representative Sequence

Representative Sequence 3300046518|Ga0495631_0094937|Ga0495631_0094937_294_1223
Length 299
Sequence MKTQPDASLGGSDAQSHGGRLFFLSLSGGQVLSMNPDGSDMVAIVSGAHLPDGVAIHAQAGHVYWTNMGVPSLDDGSIERCDLDGRNRITIIPQGVTHTPKQIHLDPANGKLYWADREGMRMMILVVSGDPEIHRGDATKWCVGVTLDHARGQLYWTQKGSDNAGEGRILRAGIEIPAGETAANRRDVEVWRNGLPEPIDLEFDPASRVMYWTDRGDPPAGNTLNRAAVDAPASEPPEILIDHLMEAIGLALDVAGGRLFVTDFGGSVYAARFDGSNEQVLAFGQGNLTGVAYADVSGR

Samples

Sample ID Description Type Environment
1 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
66 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
67 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
71 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
72 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
73 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
74 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
87 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
103 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
132 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
159 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
160 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
161 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
162 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
163 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
164 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
165 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
166 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
167 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
168 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
169 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
170 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
171 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
172 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
173 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.28
Metatranscriptomes 0
Isolates 7.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 6.5
Rhizoplane 2.85
Rhizosphere 80.08
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495631_0094937 3300046518 Bacteria 1284
2 JGI25406J46586_10000172 3300003203 Bacteria 28962
3 rootH2_10179199 3300003320 Bacteria 1439
4 JGI25404J52841_10000704 3300003659 Bacteria 5165
5 JGI25404J52841_10002917 3300003659 Bacteria 3314
6 Ga0065707_10110066 3300005295 Bacteria 2445
7 Ga0070691_10024467 3300005341 Bacteria 2806
8 Ga0070671_100141143 3300005355 Bacteria 2033
9 Ga0070710_10130680 3300005437 Bacteria 1531
10 Ga0070705_100159493 3300005440 Bacteria 1506
11 Ga0070694_100006670 3300005444 Bacteria 7011
12 Ga0070694_100012432 3300005444 Bacteria 5292
13 Ga0070662_100008591 3300005457 Bacteria 6662
14 Ga0070706_100085980 3300005467 Bacteria 2914
15 Ga0070707_100108053 3300005468 Bacteria 2699
16 Ga0070695_100050124 3300005545 Bacteria 2675
17 Ga0068861_100093431 3300005719 Bacteria 2378
18 Ga0068860_100017077 3300005843 Bacteria 7075
19 Ga0081540_1000136 3300005983 Bacteria 78663
20 Ga0081540_1000625 3300005983 Bacteria 33652
21 Ga0081540_1001429 3300005983 Bacteria 20644
22 Ga0081540_1006143 3300005983 Bacteria 8817
23 Ga0081540_1007009 3300005983 Bacteria 8108
24 Ga0081540_1008406 3300005983 Bacteria 7215
25 Ga0081540_1008813 3300005983 Bacteria 7007
26 Ga0081540_1101506 3300005983 Bacteria 1238
27 Ga0081539_10000003 3300005985 Bacteria 594833
28 Ga0070715_10064134 3300006163 Bacteria 1622
29 Ga0070716_100183331 3300006173 Bacteria 1377
30 Ga0070716_100204638 3300006173 Bacteria 1315
31 Ga0070712_100030993 3300006175 Bacteria 3599
32 Ga0075367_10049638 3300006178 Bacteria 2474
33 Ga0097621_100091117 3300006237 Bacteria 2552
34 Ga0097621_100350783 3300006237 Bacteria 1312
35 Ga0068871_100008799 3300006358 Bacteria 7272
36 Ga0075428_100075624 3300006844 Bacteria 3677
37 Ga0075428_100171559 3300006844 Bacteria 2351
38 Ga0075430_100003064 3300006846 Bacteria 13969
39 Ga0075430_100125164 3300006846 Bacteria 2142
40 Ga0075431_100033671 3300006847 Bacteria 5279
41 Ga0075433_10019020 3300006852 Bacteria 5715
42 Ga0075434_100014508 3300006871 Bacteria 7533
43 Ga0075429_100011546 3300006880 Bacteria 7661
44 Ga0099823_1039116 3300006944 Bacteria 3502
45 Ga0075435_100015624 3300007076 Bacteria 5710
46 Ga0075435_100148230 3300007076 Bacteria 1971
47 Ga0099795_10000922 3300007788 Bacteria 5950
48 Ga0105240_10001672 3300009093 Bacteria 37648
49 Ga0105240_10066475 3300009093 Bacteria 4472
50 Ga0105240_10270715 3300009093 Bacteria 1956
51 Ga0111539_10032807 3300009094 Bacteria 6305
52 Ga0114129_10080579 3300009147 Bacteria 4525
53 Ga0114129_10081407 3300009147 Bacteria 4500
54 Ga0105243_10043301 3300009148 Bacteria 3528
55 Ga0105242_10840966 3300009176 Bacteria 912
56 Ga0105248_10000106 3300009177 Bacteria 93898
57 Ga0105237_10000430 3300009545 Bacteria 59639
58 Ga0105237_10572657 3300009545 Bacteria 1136
59 Ga0105249_10031393 3300009553 Bacteria 4805
60 Ga0105239_10029647 3300010375 Bacteria 6016
61 Ga0163162_10045641 3300013306 Bacteria 4389
62 Ga0163163_10732415 3300014325 Bacteria 1052
63 Ga0157379_10053622 3300014968 Bacteria 3602
64 Ga0213872_10027462 3300021361 Unclassified 2613
65 Ga0213872_10083763 3300021361 Bacteria 1431
66 Ga0213876_10049205 3300021384 Bacteria 2227
67 Ga0213875_10000009 3300021388 Bacteria 451129
68 Ga0207685_10065044 3300025905 Bacteria 1459
69 Ga0207684_10058893 3300025910 Bacteria 3260
70 Ga0207695_10001549 3300025913 Bacteria 37807
71 Ga0207695_10049463 3300025913 Bacteria 4430
72 Ga0207671_10000523 3300025914 Bacteria 51846
73 Ga0207693_10026567 3300025915 Bacteria 4580
74 Ga0207693_10065358 3300025915 Bacteria 2849
75 Ga0207663_10013232 3300025916 Bacteria 4481
76 Ga0207646_10191921 3300025922 Bacteria 1845
77 Ga0207700_10125812 3300025928 Bacteria 2085
78 Ga0207700_10400522 3300025928 Bacteria 1203
79 Ga0207644_10244702 3300025931 Bacteria 1429
80 Ga0207706_10009049 3300025933 Bacteria 9162
81 Ga0207686_10026876 3300025934 Bacteria 3364
82 Ga0207665_10215234 3300025939 Bacteria 1406
83 Ga0207689_10014912 3300025942 Bacteria 6595
84 Ga0207712_10014523 3300025961 Bacteria 5069
85 Ga0207668_10233925 3300025972 Bacteria 1483
86 Ga0207708_10024544 3300026075 Bacteria 4561
87 Ga0209389_1007506 3300027296 Bacteria 9610
88 Ga0209489_111015 3300027361 Bacteria 9610
89 Ga0209700_110459 3300027363 Bacteria 9620
90 Ga0207428_10000733 3300027907 Bacteria 37786
91 Ga0207428_10057345 3300027907 Bacteria 3092
92 Ga0268265_10006558 3300028380 Bacteria 7876
93 Ga0268265_10332631 3300028380 Bacteria 1380
94 Ga0307517_10133402 3300028786 Bacteria 1776
95 Ga0307510_10010950 3300033180 Bacteria 10777
96 Ga0307510_10023753 3300033180 Bacteria 7101
97 Ga0315911_1000006 3300033442 Bacteria 414563
98 Ga0373936_0127427 3300035113 Bacteria 1092
99 Ga0373945_0005371 3300035116 Bacteria 4101
100 Ga0373935_0188900 3300035692 Bacteria 1418
101 Ga0373927_0071308 3300035695 Bacteria 2249
102 Ga0373947_0035252 3300035725 Bacteria 2962
103 Ga0373925_0018001 3300037068 Bacteria 5130
104 Ga0395900_0075111 3300037418 Bacteria 3474
105 Ga0395898_0090971 3300037466 Bacteria 2936
106 Ga0395905_0002674 3300037471 Bacteria 19542
107 Ga0395905_0113483 3300037471 Bacteria 2546
108 Ga0436364_1201245 3300037853 Bacteria 33298
109 Ga0395901_0003058 3300038443 Bacteria 16851
110 Ga0436365_0109263 3300039437 Bacteria 3855
111 Ga0436365_0780822 3300039437 Bacteria 2541
112 Ga0436361_0813175 3300039447 Bacteria 5693
113 Ga0436361_0893686 3300039447 Bacteria 4031
114 Ga0436361_1205038 3300039447 Bacteria 1392
115 Ga0436363_0937467 3300039450 Bacteria 1551
116 Ga0436363_1268008 3300039450 Bacteria 1872
117 Ga0436363_1380668 3300039450 Bacteria 1643
118 Ga0436363_1610190 3300039450 Bacteria 2358
119 Ga0495603_0003986 3300046455 Bacteria 8788
120 Ga0495629_0000130 3300046459 Bacteria 65355
121 Ga0495629_0033126 3300046459 Bacteria 3656
122 Ga0495629_0094804 3300046459 Bacteria 2082
123 Ga0495638_0208076 3300046460 Bacteria 1100
124 Ga0495641_0011920 3300046461 Bacteria 4905
125 Ga0495651_0002683 3300046462 Bacteria 13807
126 Ga0495651_0219972 3300046462 Bacteria 1315
127 Ga0495653_0000287 3300046463 Bacteria 40916
128 Ga0495653_0028181 3300046463 Bacteria 4492
129 Ga0495653_0223274 3300046463 Bacteria 1265
130 Ga0495580_0005931 3300046472 Bacteria 10018
131 Ga0495580_0044087 3300046472 Bacteria 3173
132 Ga0495580_0081045 3300046472 Bacteria 2262
133 Ga0495580_0255801 3300046472 Bacteria 1198
134 Ga0495580_0257847 3300046472 Bacteria 1193
135 Ga0495582_0036489 3300046473 Bacteria 2704
136 Ga0495582_0103867 3300046473 Bacteria 1592
137 Ga0495582_0236006 3300046473 Bacteria 1047
138 Ga0495662_0003730 3300046476 Bacteria 7676
139 Ga0495664_0001627 3300046477 Bacteria 11938
140 Ga0495664_0064830 3300046477 Bacteria 2177
141 Ga0495583_0000991 3300046506 Bacteria 32505
142 Ga0495606_0017630 3300046507 Bacteria 5389
143 Ga0495618_0002868 3300046514 Bacteria 10928
144 Ga0495618_0003817 3300046514 Bacteria 9327
145 Ga0495628_0006685 3300046516 Bacteria 10055
146 Ga0495628_0010938 3300046516 Bacteria 7684
147 Ga0495630_0003756 3300046517 Bacteria 10599
148 Ga0495630_0014716 3300046517 Bacteria 5704
149 Ga0495632_0010306 3300046519 Bacteria 5548
150 Ga0495643_0092395 3300046522 Bacteria 1560
151 Ga0495648_0016967 3300046524 Bacteria 5228
152 Ga0495648_0060601 3300046524 Bacteria 2251
153 Ga0495648_0168618 3300046524 Bacteria 1124
154 Ga0495666_0001210 3300046526 Bacteria 12464
155 Ga0495652_0011111 3300046529 Bacteria 8157
156 Ga0495665_0002391 3300046531 Bacteria 10136
157 Ga0495640_0024645 3300046533 Bacteria 4374
158 Ga0495640_0041939 3300046533 Bacteria 3195
159 Ga0495586_0002165 3300046535 Bacteria 10680
160 Ga0495587_0003300 3300046536 Bacteria 10777
161 Ga0495645_0003156 3300046543 Bacteria 11171
162 Ga0495645_0078889 3300046543 Bacteria 2366
163 Ga0495622_0064444 3300046557 Bacteria 1695
164 Ga0495634_0003748 3300046642 Bacteria 12107
165 Ga0495634_0012329 3300046642 Bacteria 6194
166 Ga0495625_0001932 3300046660 Bacteria 23427
167 Ga0495635_0002829 3300046663 Bacteria 11914
168 Ga0495635_0017617 3300046663 Bacteria 4989
169 Ga0495661_0003141 3300046665 Bacteria 12369
170 Ga0495588_0040114 3300046674 Bacteria 2387
171 Ga0495599_0004615 3300046678 Bacteria 8166
172 Ga0495646_0002143 3300046680 Bacteria 11987
173 Ga0495646_0053510 3300046680 Bacteria 2433
174 Ga0495613_0013630 3300046689 Bacteria 6033
175 Ga0495613_0165495 3300046689 Bacteria 1571
176 Ga0495624_0004212 3300046690 Bacteria 10562
177 Ga0495624_0007587 3300046690 Bacteria 7613
178 Ga0495624_0012107 3300046690 Bacteria 5906
179 Ga0495624_0028816 3300046690 Bacteria 3625
180 Ga0495589_0125996 3300046794 Bacteria 1232
181 Ga0495581_0000785 3300047315 Bacteria 16839
182 Ga0495604_0003789 3300047317 Bacteria 12033
183 Ga0495674_0012425 3300047319 Bacteria 8024
184 Ga0495674_0028625 3300047319 Bacteria 5076
185 Ga0495674_0064874 3300047319 Bacteria 3173
186 Ga0495672_0002118 3300047320 Bacteria 18607
187 Ga0495672_0093139 3300047320 Bacteria 1650
188 Ga0495676_0014047 3300047321 Bacteria 7172
189 Ga0495680_0006981 3300047322 Bacteria 10416
190 Ga0495683_0095137 3300047323 Bacteria 1439
191 Ga0495687_000183 3300047443 Bacteria 91212
192 Ga0495679_003082 3300047446 Bacteria 8172
193 Ga0495679_010813 3300047446 Bacteria 3560
194 Ga0495681_0083662 3300047470 Bacteria 1420
195 Ga0495684_0010107 3300047471 Bacteria 7296
196 Ga0495684_0016169 3300047471 Bacteria 5746
197 Ga0495593_0006251 3300047673 Bacteria 6990
198 Ga0495593_0015300 3300047673 Bacteria 4348
199 Ga0495602_0015283 3300048088 Bacteria 7753
200 Ga0495614_0001609 3300048089 Bacteria 9815
201 Ga0496100_0053143 3300048903 Bacteria 2637
202 Ga0496101_0000701 3300048904 Bacteria 20112
203 Ga0496104_0012213 3300048907 Bacteria 7718
204 Ga0496105_0141379 3300048908 Bacteria 1981
205 Ga0496107_0125373 3300048910 Bacteria 1894
206 Ga0496114_0000664 3300048917 Bacteria 25510
207 Ga0496115_0237116 3300048918 Bacteria 1504
208 Ga0496121_0103513 3300048924 Bacteria 2190
209 Ga0496121_0124671 3300048924 Bacteria 1939
210 Ga0496126_0004460 3300048929 Bacteria 16727
211 Ga0495678_049128 3300049459 Bacteria 1641
212 nmdc:mga06z11_104523_c1 3300050494 Bacteria 1559
213 nmdc:mga05p37_27652_c1 3300050507 Bacteria 6909
214 nmdc:mga05p37_46880_c1 3300050507 Bacteria 5314
215 nmdc:mga09592_12509_c1 3300050508 Bacteria 6915
216 nmdc:mga0qj67_140706_c1 3300050509 Bacteria 1957
217 nmdc:mga0qj67_2286_c1 3300050509 Bacteria 13612
218 nmdc:mga06r32_6322_c1 3300050510 Bacteria 10636
219 nmdc:mga06r32_941_c1 3300050510 Bacteria 25910
220 nmdc:mga08y16_94046_c1 3300050511 Bacteria 3123
221 nmdc:mga0n895_7723_c1 3300050512 Bacteria 9257
222 nmdc:mga0n895_87596_c1 3300050512 Bacteria 3112
223 nmdc:mga0a205_105750_c1 3300050515 Bacteria 2713
224 nmdc:mga0a205_5094_c1 3300050515 Bacteria 11823
225 nmdc:mga0sz30_16310_c1 3300050516 Bacteria 2948
226 Ga0495601_0060676 3300053077 Bacteria 2399
227 Ga0495619_0024096 3300053085 Bacteria 3902
228 2513722200 2513237104 Bacteria 10034502
229 2513893757 2513237141 Bacteria 8496279
230 2517104969 2517093001 Bacteria 9002274
231 2585399336 2582581867 Bacteria 7184437
232 2617351599 2617270735 Bacteria 9163226
233 2824663967 2824661429 Bacteria 9877870
234 2847938946 2847930680 Bacteria 9342022
235 2874632571 2874628541 Bacteria 8630250
236 2885413960 2885409591 Bacteria 9235467
237 2903751352 2903748898 Bacteria 9972761
238 2903752643 2903748898 Bacteria 9972761
239 2903756657 2903748898 Bacteria 9972761
240 2904695313 2904690495 Bacteria 9412302
241 2906637267 2906635258 Bacteria 8601019
242 8016631181 8016630954 Bacteria 9217207
243 8019565937 8019565922 Bacteria 9639779
244 8046767891 8046767195 Bacteria 7547379
245 8046768880 8046767195 Bacteria 7547379
246 8057582581 8057575449 Bacteria 7367519
247 Ga0495631_0094937
248 JGI25406J46586_10000172
249 rootH2_10179199
250 JGI25404J52841_10000704
251 JGI25404J52841_10002917
252 Ga0065707_10110066
253 Ga0070691_10024467
254 Ga0070671_100141143
255 Ga0070710_10130680
256 Ga0070705_100159493
257 Ga0070694_100006670
258 Ga0070694_100012432
259 Ga0070662_100008591
260 Ga0070706_100085980
261 Ga0070707_100108053
262 Ga0070695_100050124
263 Ga0068861_100093431
264 Ga0068860_100017077
265 Ga0081540_1000136
266 Ga0081540_1000625
267 Ga0081540_1001429
268 Ga0081540_1006143
269 Ga0081540_1007009
270 Ga0081540_1008406
271 Ga0081540_1008813
272 Ga0081540_1101506
273 Ga0081539_10000003
274 Ga0070715_10064134
275 Ga0070716_100183331
276 Ga0070716_100204638
277 Ga0070712_100030993
278 Ga0075367_10049638
279 Ga0097621_100091117
280 Ga0097621_100350783
281 Ga0068871_100008799
282 Ga0075428_100075624
283 Ga0075428_100171559
284 Ga0075430_100003064
285 Ga0075430_100125164
286 Ga0075431_100033671
287 Ga0075433_10019020
288 Ga0075434_100014508
289 Ga0075429_100011546
290 Ga0099823_1039116
291 Ga0075435_100015624
292 Ga0075435_100148230
293 Ga0099795_10000922
294 Ga0105240_10001672
295 Ga0105240_10066475
296 Ga0105240_10270715
297 Ga0111539_10032807
298 Ga0114129_10080579
299 Ga0114129_10081407
300 Ga0105243_10043301
301 Ga0105242_10840966
302 Ga0105248_10000106
303 Ga0105237_10000430
304 Ga0105237_10572657
305 Ga0105249_10031393
306 Ga0105239_10029647
307 Ga0163162_10045641
308 Ga0163163_10732415
309 Ga0157379_10053622
310 Ga0213872_10027462
311 Ga0213872_10083763
312 Ga0213876_10049205
313 Ga0213875_10000009
314 Ga0207685_10065044
315 Ga0207684_10058893
316 Ga0207695_10001549
317 Ga0207695_10049463
318 Ga0207671_10000523
319 Ga0207693_10026567
320 Ga0207693_10065358
321 Ga0207663_10013232
322 Ga0207646_10191921
323 Ga0207700_10125812
324 Ga0207700_10400522
325 Ga0207644_10244702
326 Ga0207706_10009049
327 Ga0207686_10026876
328 Ga0207665_10215234
329 Ga0207689_10014912
330 Ga0207712_10014523
331 Ga0207668_10233925
332 Ga0207708_10024544
333 Ga0209389_1007506
334 Ga0209489_111015
335 Ga0209700_110459
336 Ga0207428_10000733
337 Ga0207428_10057345
338 Ga0268265_10006558
339 Ga0268265_10332631
340 Ga0307517_10133402
341 Ga0307510_10010950
342 Ga0307510_10023753
343 Ga0315911_1000006
344 Ga0373936_0127427
345 Ga0373945_0005371
346 Ga0373935_0188900
347 Ga0373927_0071308
348 Ga0373947_0035252
349 Ga0373925_0018001
350 Ga0395900_0075111
351 Ga0395898_0090971
352 Ga0395905_0002674
353 Ga0395905_0113483
354 Ga0436364_1201245
355 Ga0395901_0003058
356 Ga0436365_0109263
357 Ga0436365_0780822
358 Ga0436361_0813175
359 Ga0436361_0893686
360 Ga0436361_1205038
361 Ga0436363_0937467
362 Ga0436363_1268008
363 Ga0436363_1380668
364 Ga0436363_1610190
365 Ga0495603_0003986
366 Ga0495629_0000130
367 Ga0495629_0033126
368 Ga0495629_0094804
369 Ga0495638_0208076
370 Ga0495641_0011920
371 Ga0495651_0002683
372 Ga0495651_0219972
373 Ga0495653_0000287
374 Ga0495653_0028181
375 Ga0495653_0223274
376 Ga0495580_0005931
377 Ga0495580_0044087
378 Ga0495580_0081045
379 Ga0495580_0255801
380 Ga0495580_0257847
381 Ga0495582_0036489
382 Ga0495582_0103867
383 Ga0495582_0236006
384 Ga0495662_0003730
385 Ga0495664_0001627
386 Ga0495664_0064830
387 Ga0495583_0000991
388 Ga0495606_0017630
389 Ga0495618_0002868
390 Ga0495618_0003817
391 Ga0495628_0006685
392 Ga0495628_0010938
393 Ga0495630_0003756
394 Ga0495630_0014716
395 Ga0495632_0010306
396 Ga0495643_0092395
397 Ga0495648_0016967
398 Ga0495648_0060601
399 Ga0495648_0168618
400 Ga0495666_0001210
401 Ga0495652_0011111
402 Ga0495665_0002391
403 Ga0495640_0024645
404 Ga0495640_0041939
405 Ga0495586_0002165
406 Ga0495587_0003300
407 Ga0495645_0003156
408 Ga0495645_0078889
409 Ga0495622_0064444
410 Ga0495634_0003748
411 Ga0495634_0012329
412 Ga0495625_0001932
413 Ga0495635_0002829
414 Ga0495635_0017617
415 Ga0495661_0003141
416 Ga0495588_0040114
417 Ga0495599_0004615
418 Ga0495646_0002143
419 Ga0495646_0053510
420 Ga0495613_0013630
421 Ga0495613_0165495
422 Ga0495624_0004212
423 Ga0495624_0007587
424 Ga0495624_0012107
425 Ga0495624_0028816
426 Ga0495589_0125996
427 Ga0495581_0000785
428 Ga0495604_0003789
429 Ga0495674_0012425
430 Ga0495674_0028625
431 Ga0495674_0064874
432 Ga0495672_0002118
433 Ga0495672_0093139
434 Ga0495676_0014047
435 Ga0495680_0006981
436 Ga0495683_0095137
437 Ga0495687_000183
438 Ga0495679_003082
439 Ga0495679_010813
440 Ga0495681_0083662
441 Ga0495684_0010107
442 Ga0495684_0016169
443 Ga0495593_0006251
444 Ga0495593_0015300
445 Ga0495602_0015283
446 Ga0495614_0001609
447 Ga0496100_0053143
448 Ga0496101_0000701
449 Ga0496104_0012213
450 Ga0496105_0141379
451 Ga0496107_0125373
452 Ga0496114_0000664
453 Ga0496115_0237116
454 Ga0496121_0103513
455 Ga0496121_0124671
456 Ga0496126_0004460
457 Ga0495678_049128
458 nmdc:mga06z11_104523_c1
459 nmdc:mga05p37_27652_c1
460 nmdc:mga05p37_46880_c1
461 nmdc:mga09592_12509_c1
462 nmdc:mga0qj67_140706_c1
463 nmdc:mga0qj67_2286_c1
464 nmdc:mga06r32_6322_c1
465 nmdc:mga06r32_941_c1
466 nmdc:mga08y16_94046_c1
467 nmdc:mga0n895_7723_c1
468 nmdc:mga0n895_87596_c1
469 nmdc:mga0a205_105750_c1
470 nmdc:mga0a205_5094_c1
471 nmdc:mga0sz30_16310_c1
472 Ga0495601_0060676
473 Ga0495619_0024096
474 2513722200
475 2513893757
476 2517104969
477 2585399336
478 2617351599
479 2824663967
480 2847938946
481 2874632571
482 2885413960
483 2903751352
484 2903752643
485 2903756657
486 2904695313
487 2906637267
488 8016631181
489 8019565937
490 8046767891
491 8046768880
492 8057582581

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v65-assembly1.cif.gz_B crystal structure of agrin and lrp4 complex 0.9057 18 305
3v65-assembly1.cif.gz_D crystal structure of agrin and lrp4 complex 0.9051 18 304
3s2k-assembly1.cif.gz_B structural basis of wnt signaling inhibition by dickkopf binding to lrp5/6. 0.9037 19 305
8dvn-assembly1.cif.gz_A crystal structure of lrp6 e3e4 in complex with disulfide constrained peptide e3.10 0.9029 18 305
8dvl-assembly1.cif.gz_A crystal structure of lrp6 e3e4 in complex with disulfide constrained peptide e3.18 0.9014 18 304
ID Description Score Start End Superfamily
af_A0A0R4IL75_2_237_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9075 77 301 2.120.10.30
af_A0A2R8PYI8_197_421_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9063 96 303 2.120.10.30
3v65D02 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9051 18 304 2.120.10.30
3v64C02 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9008 18 305 2.120.10.30
af_A0A140LGI0_481_782_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8947 18 305 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A841P3J1-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9858 19 305 GO:0005886
GO:0017147
GO:0042813
GO:0060070
AF-A0A560DPE6-F1-model_v4 Uncharacterized protein 0.9858 201 307
AF-A0A5N5X017-F1-model_v4 Uncharacterized protein 0.9818 20 170
AF-A0A534WEQ0-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9758 147 307 GO:0005886
GO:0017147
GO:0042813
GO:0060070
AF-A0A841P3J1-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9756 19 305 GO:0005886
GO:0017147
GO:0042813
GO:0060070

Map