F358378

General Info

Members Datasets Scaffolds Average Seq Length
246 172 492 159

Family's Representative Sequence

Representative Sequence 3300042993|Ga0439440_0043210|Ga0439440_0043210_477_1046
Length 189
Sequence VSLSISIGRHSLTKARYETFCERMPNETLPPFQKLLDEHGSDVLGFLVASVGPHDAEDCFQETFIAALRAYPRLEHGRNLRSWLLTVAHRKAIDHHRARQRRAVPAGAPEEVAGGQSSSNHRPDAVVASGDPELWTAVSGLPPKQRSAVVLRFATDMSYAGIARALDCSEDAARRSVHEGLQKLRGEFA

Samples

Sample ID Description Type Environment
1 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
75 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
156 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 4.88
Rhizosphere 91.46
Stem 0
Stem Tuber 0
Unclassified 10.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439440_0043210 3300042993 Bacteria 1105
2 Ga0070683_100652964 3300005329 Unclassified 1007
3 Ga0070682_100503262 3300005337 Bacteria 939
4 Ga0068868_100873060 3300005338 Bacteria 816
5 Ga0070691_10436722 3300005341 Bacteria 745
6 Ga0070668_100182711 3300005347 Bacteria 1714
7 Ga0070673_101567318 3300005364 Bacteria 622
8 Ga0070703_10288295 3300005406 Bacteria 680
9 Ga0070713_100097128 3300005436 Bacteria 2545
10 Ga0070710_10463953 3300005437 Bacteria 861
11 Ga0070711_100332493 3300005439 Unclassified 1217
12 Ga0070711_100570478 3300005439 Bacteria 941
13 Ga0070711_100688742 3300005439 Bacteria 860
14 Ga0070705_100180938 3300005440 Bacteria 1428
15 Ga0070705_100372073 3300005440 Bacteria 1049
16 Ga0070705_100850693 3300005440 Bacteria 730
17 Ga0070700_101074159 3300005441 Unclassified 666
18 Ga0070694_100176628 3300005444 Bacteria 1577
19 Ga0070662_100771300 3300005457 Unclassified 816
20 Ga0068867_100327518 3300005459 Bacteria 1271
21 Ga0070698_100349530 3300005471 Bacteria 1410
22 Ga0070679_100614509 3300005530 Bacteria 1030
23 Ga0070697_100109076 3300005536 Bacteria 2305
24 Ga0070695_100302897 3300005545 Bacteria 1182
25 Ga0070696_100248252 3300005546 Bacteria 1345
26 Ga0070704_100225335 3300005549 Bacteria 1526
27 Ga0068854_100658854 3300005578 Bacteria 900
28 Ga0068854_101551808 3300005578 Unclassified 602
29 Ga0081455_10011820 3300005937 Bacteria 8742
30 Ga0081455_10021885 3300005937 Bacteria 5988
31 Ga0081455_10031794 3300005937 Bacteria 4767
32 Ga0081455_10038733 3300005937 Bacteria 4220
33 Ga0081455_10054602 3300005937 Bacteria 3403
34 Ga0081538_10023649 3300005981 Bacteria 4409
35 Ga0081540_1001700 3300005983 Bacteria 18669
36 Ga0081540_1184828 3300005983 Bacteria 775
37 Ga0075363_100174977 3300006048 Unclassified 1220
38 Ga0075364_10025739 3300006051 Bacteria 3748
39 Ga0075364_10126952 3300006051 Bacteria 1711
40 Ga0070712_100013038 3300006175 Bacteria 5302
41 Ga0070712_100052947 3300006175 Bacteria 2833
42 Ga0075428_100267497 3300006844 Bacteria 1840
43 Ga0075428_100519428 3300006844 Bacteria 1274
44 Ga0075430_100021357 3300006846 Bacteria 5503
45 Ga0075431_100005383 3300006847 Bacteria 12638
46 Ga0075431_100010526 3300006847 Bacteria 9298
47 Ga0075434_100084909 3300006871 Bacteria 3165
48 Ga0075429_100006275 3300006880 Bacteria 10287
49 Ga0075429_100119898 3300006880 Bacteria 2299
50 Ga0075435_100089521 3300007076 Bacteria 2538
51 Ga0075435_100132824 3300007076 Bacteria 2083
52 Ga0111539_10006256 3300009094 Bacteria 15368
53 Ga0105245_10138574 3300009098 Bacteria 2289
54 Ga0105245_10292750 3300009098 Bacteria 1595
55 Ga0105245_11645650 3300009098 Bacteria 694
56 Ga0105245_11745609 3300009098 Bacteria 675
57 Ga0114129_10001284 3300009147 Bacteria 33454
58 Ga0114129_10004531 3300009147 Bacteria 19614
59 Ga0114129_10081063 3300009147 Bacteria 4511
60 Ga0114129_11532926 3300009147 Bacteria 818
61 Ga0105243_10125937 3300009148 Bacteria 2167
62 Ga0105241_10856558 3300009174 Bacteria 841
63 Ga0105242_10201629 3300009176 Bacteria 1767
64 Ga0105242_10714813 3300009176 Bacteria 982
65 Ga0105242_10948038 3300009176 Bacteria 864
66 Ga0105237_10005724 3300009545 Bacteria 13971
67 Ga0105249_10683125 3300009553 Bacteria 1086
68 Ga0105249_10837636 3300009553 Bacteria 985
69 Ga0105249_12488659 3300009553 Bacteria 590
70 Ga0105033_101030 3300009986 Bacteria 2238
71 Ga0105239_13607963 3300010375 Bacteria 503
72 Ga0105246_11523639 3300011119 Bacteria 629
73 Ga0163162_10657649 3300013306 Bacteria 1171
74 Ga0163162_10746631 3300013306 Bacteria 1098
75 Ga0157372_10141240 3300013307 Bacteria 2774
76 Ga0157372_10965309 3300013307 Bacteria 988
77 Ga0163163_11034631 3300014325 Unclassified 884
78 Ga0157380_11121493 3300014326 Bacteria 826
79 Ga0157380_12249908 3300014326 Bacteria 609
80 Ga0157377_11755458 3300014745 Bacteria 502
81 Ga0163161_10026956 3300017792 Bacteria 4074
82 Ga0206356_11488231 3300020070 Bacteria 1913
83 Ga0206353_10856553 3300020082 Unclassified 734
84 Ga0213876_10117781 3300021384 Bacteria 1410
85 Ga0207699_10180106 3300025906 Bacteria 1420
86 Ga0207699_10286564 3300025906 Bacteria 1146
87 Ga0207699_10450508 3300025906 Bacteria 923
88 Ga0207654_10579330 3300025911 Bacteria 799
89 Ga0207671_10017511 3300025914 Bacteria 5521
90 Ga0207693_10060679 3300025915 Bacteria 2962
91 Ga0207693_10149400 3300025915 Unclassified 1837
92 Ga0207693_10556008 3300025915 Bacteria 895
93 Ga0207693_10897594 3300025915 Unclassified 680
94 Ga0207663_10040385 3300025916 Bacteria 2835
95 Ga0207687_10246034 3300025927 Bacteria 1419
96 Ga0207687_10471570 3300025927 Unclassified 1044
97 Ga0207700_10089206 3300025928 Bacteria 2430
98 Ga0207664_10769610 3300025929 Bacteria 866
99 Ga0207664_10977104 3300025929 Bacteria 759
100 Ga0207706_10664785 3300025933 Unclassified 892
101 Ga0207686_11091340 3300025934 Bacteria 650
102 Ga0207670_10072392 3300025936 Bacteria 2386
103 Ga0207704_10597416 3300025938 Bacteria 903
104 Ga0207665_10134657 3300025939 Unclassified 1757
105 Ga0207665_10322613 3300025939 Bacteria 1159
106 Ga0207665_10651838 3300025939 Bacteria 825
107 Ga0207668_10036726 3300025972 Bacteria 3273
108 Ga0207640_10898468 3300025981 Unclassified 773
109 Ga0207708_11034385 3300026075 Unclassified 714
110 Ga0207648_10344081 3300026089 Bacteria 1343
111 Ga0207698_11231762 3300026142 Unclassified 763
112 Ga0265337_1023288 3300028556 Bacteria 1906
113 Ga0265326_10012840 3300028558 Bacteria 2456
114 Ga0265319_1008702 3300028563 Bacteria 4413
115 Ga0265318_10003030 3300028577 Bacteria 8656
116 Ga0265336_10000004 3300028666 Bacteria 418303
117 Ga0265338_10000012 3300028800 Bacteria 418599
118 Ga0265338_10007915 3300028800 Bacteria 13022
119 Ga0265324_10018842 3300029957 Bacteria 2489
120 Ga0265340_10000001 3300031247 Bacteria 1647668
121 Ga0265339_10048148 3300031249 Bacteria 2338
122 Ga0265327_10246621 3300031251 Unclassified 796
123 Ga0265316_10008873 3300031344 Bacteria 9286
124 Ga0265316_10263521 3300031344 Bacteria 1263
125 Ga0307405_10235991 3300031731 Bacteria 1351
126 Ga0307413_10238842 3300031824 Bacteria 1340
127 Ga0307410_10027225 3300031852 Bacteria 3611
128 Ga0307409_100021906 3300031995 Bacteria 4393
129 Ga0307409_100711277 3300031995 Bacteria 1005
130 Ga0307416_100020479 3300032002 Bacteria 4722
131 Ga0307414_10430744 3300032004 Bacteria 1152
132 Ga0307415_100061036 3300032126 Bacteria 2608
133 Ga0373944_0143427 3300035089 Bacteria 837
134 Ga0373927_0419139 3300035695 Bacteria 884
135 Ga0373937_0907513 3300036401 Bacteria 830
136 Ga0373925_0291444 3300037068 Bacteria 1316
137 Ga0395898_0125836 3300037466 Bacteria 2455
138 Ga0395898_0149634 3300037466 Bacteria 2234
139 Ga0395898_0309263 3300037466 Bacteria 1507
140 Ga0395905_0788240 3300037471 Bacteria 853
141 Ga0395901_0134309 3300038443 Bacteria 2600
142 Ga0395901_0153202 3300038443 Bacteria 2421
143 Ga0395901_0227307 3300038443 Bacteria 1949
144 Ga0395901_0762768 3300038443 Unclassified 959
145 Ga0395901_0980453 3300038443 Bacteria 822
146 Ga0436365_0723573 3300039437 Bacteria 1429
147 Ga0436360_0215968 3300039438 Bacteria 1639
148 Ga0436361_0307299 3300039447 Bacteria 605
149 Ga0436362_1229192 3300039453 Bacteria 2169
150 Ga0451853_1238526 3300041512 Bacteria 4018
151 Ga0466963_0513891 3300044694 Bacteria 846
152 Ga0466957_0923987 3300044842 Bacteria 624
153 Ga0495603_0007864 3300046455 Bacteria 6429
154 Ga0495629_0918683 3300046459 Unclassified 573
155 Ga0495651_0090555 3300046462 Bacteria 2295
156 Ga0495653_0000499 3300046463 Bacteria 30327
157 Ga0495608_0502165 3300046511 Bacteria 734
158 Ga0495618_0000030 3300046514 Bacteria 108007
159 Ga0495630_0000627 3300046517 Bacteria 25585
160 Ga0495663_0038502 3300046525 Bacteria 1446
161 Ga0495665_0329316 3300046531 Bacteria 779
162 Ga0495598_0264910 3300046537 Bacteria 641
163 Ga0495633_0395824 3300046558 Bacteria 625
164 Ga0495657_0000017 3300046675 Bacteria 174558
165 Ga0495676_0763780 3300047321 Bacteria 623
166 Ga0495684_0075885 3300047471 Bacteria 2553
167 Ga0496100_0293726 3300048903 Bacteria 1215
168 Ga0496101_0557982 3300048904 Bacteria 906
169 Ga0496102_0483744 3300048905 Unclassified 1159
170 Ga0496103_0182751 3300048906 Bacteria 1348
171 Ga0496107_0266673 3300048910 Bacteria 1274
172 Ga0496110_0068980 3300048913 Bacteria 3130
173 Ga0496111_0110834 3300048914 Bacteria 2021
174 Ga0496111_0579340 3300048914 Unclassified 822
175 Ga0496112_0088954 3300048915 Unclassified 3056
176 Ga0496112_0888912 3300048915 Unclassified 813
177 Ga0496113_0595706 3300048916 Unclassified 885
178 Ga0496113_1100285 3300048916 Bacteria 623
179 Ga0501031_0012134 3300049568 Bacteria 5617
180 Ga0501031_0173306 3300049568 Bacteria 1410
181 Ga0501032_0013778 3300049569 Bacteria 5736
182 Ga0501033_0015608 3300049570 Bacteria 5759
183 Ga0501034_0104981 3300049571 Bacteria 2818
184 Ga0501036_0001911 3300049572 Bacteria 16200
185 Ga0501036_0918200 3300049572 Bacteria 718
186 Ga0501036_1227109 3300049572 Bacteria 611
187 Ga0501037_0014443 3300049573 Bacteria 5811
188 Ga0501038_0020566 3300049574 Bacteria 5930
189 Ga0501039_0033880 3300049575 Bacteria 3940
190 Ga0501040_0112411 3300049576 Bacteria 1905
191 Ga0501042_0055382 3300049578 Bacteria 2830
192 Ga0501043_0017702 3300049579 Bacteria 5587
193 Ga0501046_0000447 3300049580 Bacteria 41432
194 Ga0501047_0001305 3300049581 Bacteria 24582
195 Ga0501048_0014803 3300049582 Bacteria 5769
196 Ga0501048_0083178 3300049582 Bacteria 2257
197 Ga0501067_0049680 3300049583 Bacteria 2324
198 Ga0501067_0288488 3300049583 Bacteria 914
199 Ga0501067_0560897 3300049583 Unclassified 640
200 Ga0501068_0037107 3300049584 Bacteria 2917
201 Ga0501068_0399390 3300049584 Bacteria 886
202 Ga0501069_0007590 3300049585 Bacteria 5693
203 Ga0501069_0026832 3300049585 Bacteria 3155
204 Ga0501070_0018540 3300049586 Bacteria 5838
205 Ga0501070_0171379 3300049586 Bacteria 1787
206 Ga0501072_0089068 3300049588 Bacteria 2449
207 Ga0501073_0014691 3300049589 Bacteria 5688
208 Ga0501073_0140792 3300049589 Bacteria 1672
209 Ga0501074_0030021 3300049590 Bacteria 3939
210 Ga0501074_0098012 3300049590 Bacteria 2098
211 Ga0501076_1091542 3300049592 Bacteria 657
212 Ga0501079_0005525 3300049741 Bacteria 9426
213 Ga0501079_0148776 3300049741 Bacteria 1825
214 Ga0501079_0977555 3300049741 Bacteria 667
215 Ga0501080_0050087 3300049742 Bacteria 3888
216 Ga0501080_0070066 3300049742 Bacteria 3261
217 Ga0501081_0912818 3300049743 Bacteria 662
218 Ga0501083_0013510 3300049744 Bacteria 5708
219 Ga0501271_019239 3300049768 Bacteria 784
220 Ga0501279_068050 3300049775 Bacteria 595
221 Ga0501035_0001414 3300049822 Bacteria 24605
222 Ga0501044_0014475 3300049823 Bacteria 8514
223 Ga0501044_0049171 3300049823 Bacteria 4353
224 Ga0501045_0096400 3300049824 Bacteria 2189
225 Ga0501045_0635769 3300049824 Bacteria 789
226 nmdc:mga03n38_182470_c1 3300050490 Unclassified 1076
227 nmdc:mga00v17_289274_c1 3300050491 Bacteria 1064
228 nmdc:mga00v17_73961_c1 3300050491 Bacteria 2117
229 nmdc:mga05p37_15899_c1 3300050507 Bacteria 6870
230 nmdc:mga05p37_1706686_c1 3300050507 Bacteria 613
231 nmdc:mga05p37_398828_c1 3300050507 Bacteria 1607
232 nmdc:mga05p37_81329_c1 3300050507 Bacteria 3990
233 nmdc:mga09592_1072153_c1 3300050508 Bacteria 671
234 nmdc:mga09592_16364_c1 3300050508 Bacteria 6066
235 nmdc:mga0qj67_11099_c1 3300050509 Bacteria 6746
236 nmdc:mga0qj67_79916_c1 3300050509 Bacteria 2619
237 nmdc:mga06r32_26975_c1 3300050510 Bacteria 5361
238 nmdc:mga06r32_435695_c1 3300050510 Bacteria 1291
239 nmdc:mga08y16_39151_c1 3300050511 Bacteria 4974
240 nmdc:mga0n895_23260_c1 3300050512 Bacteria 5821
241 nmdc:mga0rr50_350127_c1 3300050513 Bacteria 1242
242 Ga0495619_0094870 3300053085 Bacteria 2024
243 Ga0501084_0103762 3300054114 Bacteria 2388
244 Ga0501084_1071128 3300054114 Bacteria 677
245 Ga0501082_0031443 3300060353 Bacteria 4577
246 Ga0530510_1462437 3300061734 Bacteria 525
247 Ga0439440_0043210
248 Ga0070683_100652964
249 Ga0070682_100503262
250 Ga0068868_100873060
251 Ga0070691_10436722
252 Ga0070668_100182711
253 Ga0070673_101567318
254 Ga0070703_10288295
255 Ga0070713_100097128
256 Ga0070710_10463953
257 Ga0070711_100332493
258 Ga0070711_100570478
259 Ga0070711_100688742
260 Ga0070705_100180938
261 Ga0070705_100372073
262 Ga0070705_100850693
263 Ga0070700_101074159
264 Ga0070694_100176628
265 Ga0070662_100771300
266 Ga0068867_100327518
267 Ga0070698_100349530
268 Ga0070679_100614509
269 Ga0070697_100109076
270 Ga0070695_100302897
271 Ga0070696_100248252
272 Ga0070704_100225335
273 Ga0068854_100658854
274 Ga0068854_101551808
275 Ga0081455_10011820
276 Ga0081455_10021885
277 Ga0081455_10031794
278 Ga0081455_10038733
279 Ga0081455_10054602
280 Ga0081538_10023649
281 Ga0081540_1001700
282 Ga0081540_1184828
283 Ga0075363_100174977
284 Ga0075364_10025739
285 Ga0075364_10126952
286 Ga0070712_100013038
287 Ga0070712_100052947
288 Ga0075428_100267497
289 Ga0075428_100519428
290 Ga0075430_100021357
291 Ga0075431_100005383
292 Ga0075431_100010526
293 Ga0075434_100084909
294 Ga0075429_100006275
295 Ga0075429_100119898
296 Ga0075435_100089521
297 Ga0075435_100132824
298 Ga0111539_10006256
299 Ga0105245_10138574
300 Ga0105245_10292750
301 Ga0105245_11645650
302 Ga0105245_11745609
303 Ga0114129_10001284
304 Ga0114129_10004531
305 Ga0114129_10081063
306 Ga0114129_11532926
307 Ga0105243_10125937
308 Ga0105241_10856558
309 Ga0105242_10201629
310 Ga0105242_10714813
311 Ga0105242_10948038
312 Ga0105237_10005724
313 Ga0105249_10683125
314 Ga0105249_10837636
315 Ga0105249_12488659
316 Ga0105033_101030
317 Ga0105239_13607963
318 Ga0105246_11523639
319 Ga0163162_10657649
320 Ga0163162_10746631
321 Ga0157372_10141240
322 Ga0157372_10965309
323 Ga0163163_11034631
324 Ga0157380_11121493
325 Ga0157380_12249908
326 Ga0157377_11755458
327 Ga0163161_10026956
328 Ga0206356_11488231
329 Ga0206353_10856553
330 Ga0213876_10117781
331 Ga0207699_10180106
332 Ga0207699_10286564
333 Ga0207699_10450508
334 Ga0207654_10579330
335 Ga0207671_10017511
336 Ga0207693_10060679
337 Ga0207693_10149400
338 Ga0207693_10556008
339 Ga0207693_10897594
340 Ga0207663_10040385
341 Ga0207687_10246034
342 Ga0207687_10471570
343 Ga0207700_10089206
344 Ga0207664_10769610
345 Ga0207664_10977104
346 Ga0207706_10664785
347 Ga0207686_11091340
348 Ga0207670_10072392
349 Ga0207704_10597416
350 Ga0207665_10134657
351 Ga0207665_10322613
352 Ga0207665_10651838
353 Ga0207668_10036726
354 Ga0207640_10898468
355 Ga0207708_11034385
356 Ga0207648_10344081
357 Ga0207698_11231762
358 Ga0265337_1023288
359 Ga0265326_10012840
360 Ga0265319_1008702
361 Ga0265318_10003030
362 Ga0265336_10000004
363 Ga0265338_10000012
364 Ga0265338_10007915
365 Ga0265324_10018842
366 Ga0265340_10000001
367 Ga0265339_10048148
368 Ga0265327_10246621
369 Ga0265316_10008873
370 Ga0265316_10263521
371 Ga0307405_10235991
372 Ga0307413_10238842
373 Ga0307410_10027225
374 Ga0307409_100021906
375 Ga0307409_100711277
376 Ga0307416_100020479
377 Ga0307414_10430744
378 Ga0307415_100061036
379 Ga0373944_0143427
380 Ga0373927_0419139
381 Ga0373937_0907513
382 Ga0373925_0291444
383 Ga0395898_0125836
384 Ga0395898_0149634
385 Ga0395898_0309263
386 Ga0395905_0788240
387 Ga0395901_0134309
388 Ga0395901_0153202
389 Ga0395901_0227307
390 Ga0395901_0762768
391 Ga0395901_0980453
392 Ga0436365_0723573
393 Ga0436360_0215968
394 Ga0436361_0307299
395 Ga0436362_1229192
396 Ga0451853_1238526
397 Ga0466963_0513891
398 Ga0466957_0923987
399 Ga0495603_0007864
400 Ga0495629_0918683
401 Ga0495651_0090555
402 Ga0495653_0000499
403 Ga0495608_0502165
404 Ga0495618_0000030
405 Ga0495630_0000627
406 Ga0495663_0038502
407 Ga0495665_0329316
408 Ga0495598_0264910
409 Ga0495633_0395824
410 Ga0495657_0000017
411 Ga0495676_0763780
412 Ga0495684_0075885
413 Ga0496100_0293726
414 Ga0496101_0557982
415 Ga0496102_0483744
416 Ga0496103_0182751
417 Ga0496107_0266673
418 Ga0496110_0068980
419 Ga0496111_0110834
420 Ga0496111_0579340
421 Ga0496112_0088954
422 Ga0496112_0888912
423 Ga0496113_0595706
424 Ga0496113_1100285
425 Ga0501031_0012134
426 Ga0501031_0173306
427 Ga0501032_0013778
428 Ga0501033_0015608
429 Ga0501034_0104981
430 Ga0501036_0001911
431 Ga0501036_0918200
432 Ga0501036_1227109
433 Ga0501037_0014443
434 Ga0501038_0020566
435 Ga0501039_0033880
436 Ga0501040_0112411
437 Ga0501042_0055382
438 Ga0501043_0017702
439 Ga0501046_0000447
440 Ga0501047_0001305
441 Ga0501048_0014803
442 Ga0501048_0083178
443 Ga0501067_0049680
444 Ga0501067_0288488
445 Ga0501067_0560897
446 Ga0501068_0037107
447 Ga0501068_0399390
448 Ga0501069_0007590
449 Ga0501069_0026832
450 Ga0501070_0018540
451 Ga0501070_0171379
452 Ga0501072_0089068
453 Ga0501073_0014691
454 Ga0501073_0140792
455 Ga0501074_0030021
456 Ga0501074_0098012
457 Ga0501076_1091542
458 Ga0501079_0005525
459 Ga0501079_0148776
460 Ga0501079_0977555
461 Ga0501080_0050087
462 Ga0501080_0070066
463 Ga0501081_0912818
464 Ga0501083_0013510
465 Ga0501271_019239
466 Ga0501279_068050
467 Ga0501035_0001414
468 Ga0501044_0014475
469 Ga0501044_0049171
470 Ga0501045_0096400
471 Ga0501045_0635769
472 nmdc:mga03n38_182470_c1
473 nmdc:mga00v17_289274_c1
474 nmdc:mga00v17_73961_c1
475 nmdc:mga05p37_15899_c1
476 nmdc:mga05p37_1706686_c1
477 nmdc:mga05p37_398828_c1
478 nmdc:mga05p37_81329_c1
479 nmdc:mga09592_1072153_c1
480 nmdc:mga09592_16364_c1
481 nmdc:mga0qj67_11099_c1
482 nmdc:mga0qj67_79916_c1
483 nmdc:mga06r32_26975_c1
484 nmdc:mga06r32_435695_c1
485 nmdc:mga08y16_39151_c1
486 nmdc:mga0n895_23260_c1
487 nmdc:mga0rr50_350127_c1
488 Ga0495619_0094870
489 Ga0501084_0103762
490 Ga0501084_1071128
491 Ga0501082_0031443
492 Ga0530510_1462437

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

137

186

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

132

184

0.97

PF04542

Sigma70_r2

Sigma-70 region 2

35

102

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h27-assembly2.cif.gz_D crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna 0.9719 116 168
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9431 115 166
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9427 116 167
3vep-assembly4.cif.gz_H crystal structure of sigd4 in complex with its negative regulator rsda 0.9394 114 168
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9294 114 166
ID Description Score Start End Superfamily
2h27D00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9719 116 168 1.10.10.10
af_P0AGB6_121_191_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9715 116 168 1.10.10.10
1or7A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.965 116 168 1.10.10.10
1or7B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9618 116 168 1.10.10.10
af_P13445_245_318_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9556 114 169 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W1KA76-F1-model_v4 RNA polymerase sigma factor 0.9053 1 82 GO:0006352
GO:0016987
AF-A0A7W1KA76-F1-model_v4 RNA polymerase sigma factor 0.8841 1 82 GO:0006352
GO:0016987
AF-A0A2W2B006-F1-model_v4 RNA polymerase subunit sigma 0.7733 4 97 GO:0006352
GO:0016987
AF-A0A2W2B006-F1-model_v4 RNA polymerase subunit sigma 0.7498 4 97 GO:0006352
GO:0016987
AF-A0A2V7CE45-F1-model_v4 RNA polymerase subunit sigma-24 0.7121 6 124 GO:0006352
GO:0016987

Map