F358235

General Info

Members Datasets Scaffolds Average Seq Length
246 189 246 86

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_11784358|Ga0207664_117843581
Length 103
Sequence MPVDWDQHKGQISAQGVLMRVSVSEAKGQLTDLVRRAEAGEEVVLTRHGHPAVRLVPAVQPPDKKSRRALLEAARASGSRRAKRGPTAAHSQDFLYGDDGLPR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
113 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
114 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
117 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
118 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
119 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
120 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
121 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
134 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
180 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
183 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
184 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
185 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
186 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.38
Nodule 0.41
Rhizoplane 1.22
Rhizosphere 75.61
Stem 0
Stem Tuber 0
Unclassified 11.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_456127 2162886007 Bacteria 2232
2 rootH1_10055447 3300003316 Bacteria 1123
3 rootH1_10055447 3300003323 Bacteria 11096
4 Ga0055536_1001516 3300003781 Bacteria 13931
5 Ga0055530_10014668 3300003791 Bacteria 2597
6 Ga0055540_1006810 3300003792 Bacteria 4456
7 Ga0065704_10083294 3300005289 Bacteria 3484
8 Ga0070683_100523877 3300005329 Bacteria 1133
9 Ga0070690_100126726 3300005330 Bacteria 1720
10 Ga0070680_100240033 3300005336 Bacteria 1532
11 Ga0070680_100996163 3300005336 Bacteria 724
12 Ga0070691_10048483 3300005341 Bacteria 2021
13 Ga0070661_100375459 3300005344 Bacteria 1120
14 Ga0070692_10466714 3300005345 Bacteria 811
15 Ga0070668_100072238 3300005347 Bacteria 2688
16 Ga0070669_100006008 3300005353 Bacteria 8754
17 Ga0070667_100000214 3300005367 Bacteria 67467
18 Ga0070714_100459732 3300005435 Bacteria 1210
19 Ga0070713_100181993 3300005436 Bacteria 1889
20 Ga0070708_101502284 3300005445 Bacteria 628
21 Ga0070663_100257661 3300005455 Bacteria 1383
22 Ga0070662_100184051 3300005457 Bacteria 1648
23 Ga0070681_10039151 3300005458 Bacteria 4753
24 Ga0070681_10040978 3300005458 Bacteria 4640
25 Ga0070681_10166016 3300005458 Bacteria 2130
26 Ga0070681_11594613 3300005458 Bacteria 578
27 Ga0070707_100017748 3300005468 Bacteria 6692
28 Ga0070698_100172144 3300005471 Bacteria 2106
29 Ga0070699_101859074 3300005518 Unclassified 551
30 Ga0070679_100024630 3300005530 Bacteria 5898
31 Ga0070679_100113625 3300005530 Bacteria 2693
32 Ga0070684_100867472 3300005535 Bacteria 845
33 Ga0068853_100226117 3300005539 Bacteria 1710
34 Ga0068853_101620064 3300005539 Bacteria 627
35 Ga0070693_101146802 3300005547 Bacteria 595
36 Ga0070665_100000538 3300005548 Bacteria 53355
37 Ga0070665_100111093 3300005548 Bacteria 2743
38 Ga0068855_100340721 3300005563 Bacteria 1653
39 Ga0068855_100575155 3300005563 Bacteria 1217
40 Ga0068856_100485420 3300005614 Bacteria 1256
41 Ga0068856_101130466 3300005614 Unclassified 800
42 Ga0068852_101863909 3300005616 Bacteria 624
43 Ga0068852_101877169 3300005616 Bacteria 621
44 Ga0068870_10831708 3300005840 Bacteria 647
45 Ga0068863_100054110 3300005841 Bacteria 3804
46 Ga0068860_100135301 3300005843 Bacteria 2366
47 Ga0081455_10302307 3300005937 Bacteria 1147
48 Ga0070717_11392676 3300006028 Bacteria 637
49 Ga0075365_10007783 3300006038 Bacteria 6035
50 Ga0075364_10988376 3300006051 Bacteria 572
51 Ga0070716_101606038 3300006173 Bacteria 534
52 Ga0070712_100321200 3300006175 Bacteria 1259
53 Ga0075362_10042395 3300006177 Bacteria 2011
54 Ga0075367_11110012 3300006178 Bacteria 506
55 Ga0075366_10375517 3300006195 Bacteria 874
56 Ga0068865_100585293 3300006881 Bacteria 941
57 Ga0105251_10001580 3300009011 Bacteria 19491
58 Ga0105240_10110019 3300009093 Bacteria 3335
59 Ga0105240_10119959 3300009093 Bacteria 3167
60 Ga0105240_10616112 3300009093 Bacteria 1193
61 Ga0105243_10555768 3300009148 Bacteria 1097
62 Ga0105241_10197017 3300009174 Bacteria 1680
63 Ga0105242_12833618 3300009176 Bacteria 535
64 Ga0105248_10072243 3300009177 Bacteria 3878
65 Ga0105237_12108101 3300009545 Bacteria 573
66 Ga0105238_10456898 3300009551 Bacteria 1274
67 Ga0105239_10577344 3300010375 Bacteria 1281
68 Ga0105239_12865906 3300010375 Bacteria 563
69 Ga0157370_10002161 3300013104 Bacteria 24001
70 Ga0157378_11067258 3300013297 Bacteria 844
71 Ga0213876_10046452 3300021384 Bacteria 2295
72 Ga0213876_10332976 3300021384 Bacteria 807
73 Ga0213875_10003404 3300021388 Bacteria 9054
74 Ga0213875_10071382 3300021388 Bacteria 1621
75 Ga0213871_10077008 3300021441 Bacteria 950
76 Ga0209676_1012114 3300025292 Bacteria 3418
77 Ga0209758_1000576 3300025297 Bacteria 57318
78 Ga0209758_1001021 3300025297 Bacteria 37026
79 Ga0209050_1004132 3300025298 Bacteria 10076
80 Ga0209050_1032865 3300025298 Bacteria 1586
81 Ga0209051_1001378 3300025303 Bacteria 20981
82 Ga0209257_1001268 3300025304 Bacteria 30983
83 Ga0207697_10216051 3300025315 Bacteria 845
84 Ga0207713_1002212 3300025735 Bacteria 14416
85 Ga0207699_10769570 3300025906 Bacteria 707
86 Ga0207643_10518062 3300025908 Bacteria 763
87 Ga0207705_10761289 3300025909 Bacteria 752
88 Ga0207707_10211932 3300025912 Bacteria 1687
89 Ga0207707_10675804 3300025912 Bacteria 869
90 Ga0207695_10000321 3300025913 Bacteria 116087
91 Ga0207695_10120709 3300025913 Unclassified 2590
92 Ga0207693_10383369 3300025915 Bacteria 1099
93 Ga0207660_10245183 3300025917 Bacteria 1413
94 Ga0207660_10445322 3300025917 Bacteria 1047
95 Ga0207649_10242651 3300025920 Bacteria 1294
96 Ga0207649_11435252 3300025920 Bacteria 546
97 Ga0207652_10291148 3300025921 Bacteria 1473
98 Ga0207681_10025864 3300025923 Bacteria 3780
99 Ga0207694_10397794 3300025924 Bacteria 1145
100 Ga0207700_10399045 3300025928 Bacteria 1205
101 Ga0207664_11784358 3300025929 Unclassified 538
102 Ga0207644_10490869 3300025931 Unclassified 1012
103 Ga0207709_10107173 3300025935 Bacteria 1860
104 Ga0207704_10520326 3300025938 Bacteria 962
105 Ga0207711_10002586 3300025941 Bacteria 16099
106 Ga0207679_10644518 3300025945 Bacteria 958
107 Ga0207667_10119707 3300025949 Bacteria 2713
108 Ga0207668_10011674 3300025972 Bacteria 5346
109 Ga0207640_10950622 3300025981 Bacteria 753
110 Ga0207658_10007503 3300025986 Bacteria 7428
111 Ga0207678_10345271 3300026067 Bacteria 1283
112 Ga0207641_10025076 3300026088 Bacteria 4916
113 Ga0207698_11900418 3300026142 Bacteria 610
114 Ga0268266_10000499 3300028379 Bacteria 56016
115 Ga0268264_10009439 3300028381 Bacteria 8080
116 Ga0265318_10000918 3300028577 Bacteria 19165
117 Ga0265330_10319846 3300031235 Unclassified 655
118 Ga0307408_102308311 3300031548 Unclassified 521
119 Ga0307410_11624801 3300031852 Bacteria 571
120 Ga0307414_10083996 3300032004 Bacteria 2340
121 Ga0307414_10287310 3300032004 Bacteria 1385
122 Ga0307414_10581884 3300032004 Bacteria 1002
123 Ga0307510_10210664 3300033180 Bacteria 1466
124 Ga0373941_0053735 3300035115 Bacteria 1289
125 Ga0373941_0227017 3300035115 Bacteria 720
126 Ga0373931_0575312 3300035691 Bacteria 734
127 Ga0373937_0513881 3300036401 Bacteria 1138
128 Ga0395900_0235576 3300037418 Bacteria 1839
129 Ga0395900_1361827 3300037418 Bacteria 623
130 Ga0395905_0018060 3300037471 Bacteria 6696
131 Ga0436364_0335931 3300037853 Bacteria 8325
132 Ga0436364_0413045 3300037853 Bacteria 2709
133 Ga0395901_1743374 3300038443 Bacteria 573
134 Ga0436365_0779181 3300039437 Bacteria 13451
135 Ga0436365_1883916 3300039437 Bacteria 1407
136 Ga0436360_0076876 3300039438 Bacteria 574
137 Ga0436360_0542178 3300039438 Bacteria 3690
138 Ga0436360_1277581 3300039438 Bacteria 557
139 Ga0436360_1330489 3300039438 Bacteria 2061
140 Ga0436361_0049279 3300039447 Bacteria 648
141 Ga0436361_0632545 3300039447 Unclassified 642
142 Ga0436361_0843098 3300039447 Bacteria 2446
143 Ga0436362_0013726 3300039453 Bacteria 1372
144 Ga0436362_0396610 3300039453 Bacteria 2340
145 Ga0436362_1156111 3300039453 Bacteria 1667
146 Ga0439436_0071846 3300041404 Bacteria 964
147 Ga0451798_0091096 3300041458 Bacteria 801
148 Ga0451839_0045971 3300041496 Bacteria 1274
149 Ga0451853_0936926 3300041512 Bacteria 1165
150 Ga0439433_0140439 3300041999 Bacteria 618
151 Ga0439441_056207 3300042001 Bacteria 820
152 Ga0439449_0116003 3300042007 Bacteria 993
153 Ga0439462_0020867 3300042015 Bacteria 1710
154 Ga0450923_090459 3300042125 Bacteria 697
155 Ga0439435_0014753 3300042436 Bacteria 1935
156 Ga0466970_0336803 3300044765 Bacteria 855
157 Ga0466959_0088740 3300045049 Bacteria 2223
158 Ga0495583_0000013 3300046506 Bacteria 323372
159 Ga0495616_0000053 3300046513 Bacteria 104389
160 Ga0495632_0000335 3300046519 Bacteria 44771
161 Ga0495632_0089247 3300046519 Bacteria 1463
162 Ga0495632_0262955 3300046519 Bacteria 771
163 Ga0495609_0078357 3300046538 Bacteria 1446
164 Ga0495668_0002197 3300046616 Bacteria 16632
165 Ga0495668_0599481 3300046616 Bacteria 608
166 Ga0495625_0205105 3300046660 Bacteria 1299
167 Ga0495659_0434580 3300046664 Bacteria 570
168 Ga0495600_0423539 3300046809 Bacteria 826
169 Ga0495672_0018210 3300047320 Bacteria 4673
170 Ga0495673_0000025 3300047469 Bacteria 512352
171 Ga0495681_0103428 3300047470 Bacteria 1242
172 Ga0496101_0887514 3300048904 Bacteria 702
173 Ga0496104_1883447 3300048907 Bacteria 500
174 Ga0496116_0284124 3300048919 Bacteria 799
175 Ga0496117_0159545 3300048920 Bacteria 1323
176 Ga0496118_0115244 3300048921 Bacteria 1769
177 Ga0496120_0302160 3300048923 Bacteria 733
178 Ga0496121_0011979 3300048924 Bacteria 9535
179 Ga0496121_0294821 3300048924 Bacteria 1103
180 Ga0496121_0884946 3300048924 Bacteria 515
181 Ga0496122_0060581 3300048925 Bacteria 2786
182 Ga0496123_0135766 3300048926 Unclassified 1354
183 Ga0496124_0053818 3300048927 Bacteria 3409
184 Ga0496124_0174407 3300048927 Bacteria 1661
185 Ga0496124_0735279 3300048927 Bacteria 620
186 Ga0496125_0086725 3300048928 Bacteria 2366
187 Ga0496125_0112624 3300048928 Bacteria 1965
188 Ga0496126_0003646 3300048929 Bacteria 19236
189 Ga0496126_0023115 3300048929 Bacteria 6026
190 Ga0501033_1099309 3300049570 Unclassified 529
191 Ga0501034_0028825 3300049571 Bacteria 5648
192 Ga0501034_0127541 3300049571 Bacteria 2529
193 Ga0501034_1040824 3300049571 Bacteria 701
194 Ga0501034_1546568 3300049571 Bacteria 537
195 Ga0501036_0575857 3300049572 Bacteria 935
196 Ga0501039_0557419 3300049575 Bacteria 899
197 Ga0501039_1122995 3300049575 Bacteria 609
198 Ga0501040_0862430 3300049576 Bacteria 656
199 Ga0501040_1193428 3300049576 Bacteria 552
200 Ga0501041_0326572 3300049577 Bacteria 968
201 Ga0501042_0741991 3300049578 Bacteria 714
202 Ga0501043_0465585 3300049579 Bacteria 948
203 Ga0501043_1192312 3300049579 Unclassified 535
204 Ga0501046_0286363 3300049580 Bacteria 1206
205 Ga0501047_0074218 3300049581 Bacteria 3275
206 Ga0501047_0096514 3300049581 Bacteria 2835
207 Ga0501047_0506254 3300049581 Bacteria 1034
208 Ga0501067_0052404 3300049583 Bacteria 2261
209 Ga0501068_0541376 3300049584 Bacteria 757
210 Ga0501069_0840134 3300049585 Bacteria 557
211 Ga0501070_0479714 3300049586 Bacteria 1000
212 Ga0501070_0873227 3300049586 Bacteria 703
213 Ga0501071_0549945 3300049587 Bacteria 887
214 Ga0501072_0825453 3300049588 Bacteria 725
215 Ga0501075_0698470 3300049591 Bacteria 773
216 Ga0501076_0783578 3300049592 Bacteria 787
217 Ga0501076_1268422 3300049592 Bacteria 606
218 Ga0501077_0412472 3300049593 Bacteria 864
219 Ga0501079_0663511 3300049741 Bacteria 821
220 Ga0501080_0179067 3300049742 Bacteria 1952
221 Ga0501081_0122017 3300049743 Bacteria 1857
222 Ga0501081_0760105 3300049743 Bacteria 729
223 Ga0501083_0252284 3300049744 Bacteria 1148
224 Ga0501269_040727 3300049766 Bacteria 618
225 Ga0501035_1507007 3300049822 Bacteria 513
226 Ga0501044_1028067 3300049823 Bacteria 695
227 Ga0501044_1295804 3300049823 Unclassified 595
228 Ga0501044_1667561 3300049823 Bacteria 502
229 Ga0501045_0711570 3300049824 Bacteria 741
230 nmdc:mga03683_208284_c1 3300050489 Bacteria 899
231 nmdc:mga00v17_551106_c1 3300050491 Bacteria 745
232 nmdc:mga0yw44_619072_c1 3300050492 Bacteria 736
233 nmdc:mga0k408_239616_c1 3300050493 Bacteria 1083
234 nmdc:mga07m45_483989_c1 3300050496 Bacteria 717
235 nmdc:mga0sz30_24008_c1 3300050516 Bacteria 1965
236 Ga0500610_0359428 3300053079 Unclassified 612
237 Ga0495619_0070944 3300053085 Bacteria 2330
238 Ga0500650_0203357 3300053098 Bacteria 901
239 Ga0500650_0204904 3300053098 Bacteria 897
240 Ga0500592_000069 3300053116 Bacteria 25892
241 Ga0500595_124552 3300053119 Unclassified 727
242 Ga0500627_0000060 3300053158 Bacteria 51122
243 Ga0500609_000477 3300053731 Bacteria 5968
244 Ga0501084_0813542 3300054114 Bacteria 787
245 Ga0501082_0336274 3300060353 Bacteria 1316
246 Ga0530510_0399392 3300061734 Bacteria 1036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2585427634 2586001777 80
2 3300005336 Ga0070680_100240033 Ga0070680_1002400333 82
3 3300005458 Ga0070681_10166016 Ga0070681_101660162 82
4 3300005530 Ga0070679_100113625 Ga0070679_1001136253 82
5 3300005535 Ga0070684_100867472 Ga0070684_1008674723 82
6 3300005539 Ga0068853_100226117 Ga0068853_1002261172 82
7 3300005563 Ga0068855_100575155 Ga0068855_1005751552 82
8 3300005614 Ga0068856_100485420 Ga0068856_1004854203 82
9 3300005616 Ga0068852_101863909 Ga0068852_1018639091 82
10 3300009093 Ga0105240_10616112 Ga0105240_106161122 82
11 3300009545 Ga0105237_12108101 Ga0105237_121081012 82
12 3300009551 Ga0105238_10456898 Ga0105238_104568982 82
13 3300010375 Ga0105239_12865906 Ga0105239_128659062 82
14 3300025912 Ga0207707_10211932 Ga0207707_102119323 82
15 3300025913 Ga0207695_10000321 Ga0207695_1000032188 82
16 3300025917 Ga0207660_10245183 Ga0207660_102451833 82
17 3300025920 Ga0207649_11435252 Ga0207649_114352522 82
18 3300025921 Ga0207652_10291148 Ga0207652_102911483 82
19 3300025924 Ga0207694_10397794 Ga0207694_103977943 82
20 3300025949 Ga0207667_10119707 Ga0207667_101197073 82
21 3300025981 Ga0207640_10950622 Ga0207640_109506222 82
22 3300009093 Ga0105240_10119959 Ga0105240_101199593 83
23 3300021388 Ga0213875_10071382 Ga0213875_100713823 83
24 3300037853 Ga0436364_0413045 Ga0436364_0413045_1875_2129 83
25 3300049581 Ga0501047_0096514 Ga0501047_0096514_1381_1632 83
26 3300049583 Ga0501067_0052404 Ga0501067_0052404_44_295 83
27 3300049585 Ga0501069_0840134 Ga0501069_0840134_154_405 83
28 3300049586 Ga0501070_0479714 Ga0501070_0479714_98_349 83
29 3300049742 Ga0501080_0179067 Ga0501080_0179067_1643_1894 83
30 3300049744 Ga0501083_0252284 Ga0501083_0252284_880_1131 83
31 3300003781 Ga0055536_1001516 Ga0055536_10015162 84
32 3300003791 Ga0055530_10014668 Ga0055530_100146684 84
33 3300003792 Ga0055540_1006810 Ga0055540_10068105 84
34 3300025292 Ga0209676_1012114 Ga0209676_10121144 84
35 3300025297 Ga0209758_1000576 Ga0209758_100057639 84
36 3300025298 Ga0209050_1004132 Ga0209050_10041322 84
37 3300025303 Ga0209051_1001378 Ga0209051_10013789 84
38 3300025304 Ga0209257_1001268 Ga0209257_10012684 84
39 3300032004 Ga0307414_10581884 Ga0307414_105818841 84
40 3300048924 Ga0496121_0294821 Ga0496121_0294821_666_956 84
41 3300049766 Ga0501269_040727 Ga0501269_040727_69_326 84
42 2162886007 SwRhRL2b_contig_456127 SwRhRL2b_0214.00007710 85
43 3300003316 rootH1_10055447 rootH1_100554472 85
44 3300005289 Ga0065704_10083294 Ga0065704_100832946 85
45 3300005329 Ga0070683_100523877 Ga0070683_1005238772 85
46 3300005330 Ga0070690_100126726 Ga0070690_1001267264 85
47 3300005336 Ga0070680_100996163 Ga0070680_1009961632 85
48 3300005341 Ga0070691_10048483 Ga0070691_100484832 85
49 3300005344 Ga0070661_100375459 Ga0070661_1003754593 85
50 3300005345 Ga0070692_10466714 Ga0070692_104667142 85
51 3300005347 Ga0070668_100072238 Ga0070668_1000722382 85
52 3300005353 Ga0070669_100006008 Ga0070669_1000060086 85
53 3300005367 Ga0070667_100000214 Ga0070667_1000002144 85
54 3300005435 Ga0070714_100459732 Ga0070714_1004597322 85
55 3300005436 Ga0070713_100181993 Ga0070713_1001819932 85
56 3300005445 Ga0070708_101502284 Ga0070708_1015022841 85
57 3300005455 Ga0070663_100257661 Ga0070663_1002576614 85
58 3300005457 Ga0070662_100184051 Ga0070662_1001840514 85
59 3300005458 Ga0070681_10039151 Ga0070681_100391514 85
60 3300005458 Ga0070681_10040978 Ga0070681_100409783 85
61 3300005458 Ga0070681_11594613 Ga0070681_115946131 85
62 3300005468 Ga0070707_100017748 Ga0070707_1000177485 85
63 3300005471 Ga0070698_100172144 Ga0070698_1001721442 85
64 3300005518 Ga0070699_101859074 Ga0070699_1018590741 85
65 3300005530 Ga0070679_100024630 Ga0070679_1000246303 85
66 3300005539 Ga0068853_101620064 Ga0068853_1016200642 85
67 3300005547 Ga0070693_101146802 Ga0070693_1011468022 85
68 3300005548 Ga0070665_100000538 Ga0070665_1000005388 85
69 3300005548 Ga0070665_100111093 Ga0070665_1001110933 85
70 3300005563 Ga0068855_100340721 Ga0068855_1003407214 85
71 3300005614 Ga0068856_101130466 Ga0068856_1011304662 85
72 3300005616 Ga0068852_101877169 Ga0068852_1018771692 85
73 3300005840 Ga0068870_10831708 Ga0068870_108317082 85
74 3300005841 Ga0068863_100054110 Ga0068863_1000541106 85
75 3300005843 Ga0068860_100135301 Ga0068860_1001353013 85
76 3300005937 Ga0081455_10302307 Ga0081455_103023071 85
77 3300006028 Ga0070717_11392676 Ga0070717_113926762 85
78 3300006038 Ga0075365_10007783 Ga0075365_100077837 85
79 3300006051 Ga0075364_10988376 Ga0075364_109883762 85
80 3300006173 Ga0070716_101606038 Ga0070716_1016060381 85
81 3300006175 Ga0070712_100321200 Ga0070712_1003212002 85
82 3300006177 Ga0075362_10042395 Ga0075362_100423954 85
83 3300006178 Ga0075367_11110012 Ga0075367_111100122 85
84 3300006195 Ga0075366_10375517 Ga0075366_103755171 85
85 3300006881 Ga0068865_100585293 Ga0068865_1005852932 85
86 3300009011 Ga0105251_10001580 Ga0105251_1000158016 85
87 3300009093 Ga0105240_10110019 Ga0105240_101100194 85
88 3300009148 Ga0105243_10555768 Ga0105243_105557683 85
89 3300009174 Ga0105241_10197017 Ga0105241_101970172 85
90 3300009176 Ga0105242_12833618 Ga0105242_128336181 85
91 3300009177 Ga0105248_10072243 Ga0105248_100722433 85
92 3300010375 Ga0105239_10577344 Ga0105239_105773443 85
93 3300013104 Ga0157370_10002161 Ga0157370_100021614 85
94 3300013297 Ga0157378_11067258 Ga0157378_110672582 85
95 3300021384 Ga0213876_10046452 Ga0213876_100464522 85
96 3300021384 Ga0213876_10332976 Ga0213876_103329762 85
97 3300021388 Ga0213875_10003404 Ga0213875_100034045 85
98 3300021441 Ga0213871_10077008 Ga0213871_100770082 85
99 3300025297 Ga0209758_1001021 Ga0209758_100102123 85
100 3300025298 Ga0209050_1032865 Ga0209050_10328652 85
101 3300025315 Ga0207697_10216051 Ga0207697_102160512 85
102 3300025735 Ga0207713_1002212 Ga0207713_10022126 85
103 3300025906 Ga0207699_10769570 Ga0207699_107695702 85
104 3300025908 Ga0207643_10518062 Ga0207643_105180622 85
105 3300025909 Ga0207705_10761289 Ga0207705_107612892 85
106 3300025912 Ga0207707_10675804 Ga0207707_106758042 85
107 3300025913 Ga0207695_10120709 Ga0207695_101207092 85
108 3300025915 Ga0207693_10383369 Ga0207693_103833692 85
109 3300025917 Ga0207660_10445322 Ga0207660_104453222 85
110 3300025920 Ga0207649_10242651 Ga0207649_102426512 85
111 3300025923 Ga0207681_10025864 Ga0207681_100258646 85
112 3300025928 Ga0207700_10399045 Ga0207700_103990453 85
113 3300025929 Ga0207664_11784358 Ga0207664_117843581 85
114 3300025931 Ga0207644_10490869 Ga0207644_104908692 85
115 3300025935 Ga0207709_10107173 Ga0207709_101071731 85
116 3300025938 Ga0207704_10520326 Ga0207704_105203262 85
117 3300025941 Ga0207711_10002586 Ga0207711_100025868 85
118 3300025945 Ga0207679_10644518 Ga0207679_106445182 85
119 3300025972 Ga0207668_10011674 Ga0207668_100116747 85
120 3300025986 Ga0207658_10007503 Ga0207658_100075034 85
121 3300026067 Ga0207678_10345271 Ga0207678_103452712 85
122 3300026088 Ga0207641_10025076 Ga0207641_100250762 85
123 3300026142 Ga0207698_11900418 Ga0207698_119004182 85
124 3300028379 Ga0268266_10000499 Ga0268266_1000049951 85
125 3300028381 Ga0268264_10009439 Ga0268264_100094392 85
126 3300028577 Ga0265318_10000918 Ga0265318_1000091814 85
127 3300031235 Ga0265330_10319846 Ga0265330_103198461 85
128 3300031548 Ga0307408_102308311 Ga0307408_1023083112 85
129 3300031852 Ga0307410_11624801 Ga0307410_116248012 85
130 3300032004 Ga0307414_10083996 Ga0307414_100839962 85
131 3300032004 Ga0307414_10287310 Ga0307414_102873102 85
132 3300033180 Ga0307510_10210664 Ga0307510_102106641 85
133 3300035115 Ga0373941_0053735 Ga0373941_0053735_654_926 85
134 3300035115 Ga0373941_0227017 Ga0373941_0227017_230_487 85
135 3300035691 Ga0373931_0575312 Ga0373931_0575312_457_714 85
136 3300036401 Ga0373937_0513881 Ga0373937_0513881_75_332 85
137 3300037418 Ga0395900_0235576 Ga0395900_0235576_1006_1263 85
138 3300037418 Ga0395900_1361827 Ga0395900_1361827_349_606 85
139 3300037471 Ga0395905_0018060 Ga0395905_0018060_2936_3193 85
140 3300037853 Ga0436364_0335931 Ga0436364_0335931_955_1233 85
141 3300038443 Ga0395901_1743374 Ga0395901_1743374_77_334 85
142 3300039437 Ga0436365_0779181 Ga0436365_0779181_11748_12020 85
143 3300039437 Ga0436365_1883916 Ga0436365_1883916_52_309 85
144 3300039438 Ga0436360_0076876 Ga0436360_0076876_74_331 85
145 3300039438 Ga0436360_0542178 Ga0436360_0542178_3360_3617 85
146 3300039438 Ga0436360_1277581 Ga0436360_1277581_154_420 85
147 3300039438 Ga0436360_1330489 Ga0436360_1330489_767_1024 85
148 3300039447 Ga0436361_0049279 Ga0436361_0049279_253_513 85
149 3300039447 Ga0436361_0632545 Ga0436361_0632545_32_289 85
150 3300039447 Ga0436361_0843098 Ga0436361_0843098_36_293 85
151 3300039453 Ga0436362_0013726 Ga0436362_0013726_288_545 85
152 3300039453 Ga0436362_0396610 Ga0436362_0396610_125_382 85
153 3300039453 Ga0436362_1156111 Ga0436362_1156111_818_1075 85
154 3300041404 Ga0439436_0071846 Ga0439436_0071846_555_812 85
155 3300041458 Ga0451798_0091096 Ga0451798_0091096_63_320 85
156 3300041496 Ga0451839_0045971 Ga0451839_0045971_605_862 85
157 3300041512 Ga0451853_0936926 Ga0451853_0936926_709_984 85
158 3300041999 Ga0439433_0140439 Ga0439433_0140439_81_338 85
159 3300042001 Ga0439441_056207 Ga0439441_056207_12_269 85
160 3300042007 Ga0439449_0116003 Ga0439449_0116003_253_510 85
161 3300042015 Ga0439462_0020867 Ga0439462_0020867_1161_1418 85
162 3300042125 Ga0450923_090459 Ga0450923_090459_329_586 85
163 3300042436 Ga0439435_0014753 Ga0439435_0014753_46_303 85
164 3300044765 Ga0466970_0336803 Ga0466970_0336803_513_770 85
165 3300045049 Ga0466959_0088740 Ga0466959_0088740_379_636 85
166 3300046506 Ga0495583_0000013 Ga0495583_0000013_118954_119232 85
167 3300046513 Ga0495616_0000053 Ga0495616_0000053_53381_53659 85
168 3300046519 Ga0495632_0000335 Ga0495632_0000335_21430_21687 85
169 3300046519 Ga0495632_0089247 Ga0495632_0089247_891_1148 85
170 3300046519 Ga0495632_0262955 Ga0495632_0262955_278_568 85
171 3300046538 Ga0495609_0078357 Ga0495609_0078357_974_1252 85
172 3300046616 Ga0495668_0002197 Ga0495668_0002197_3247_3504 85
173 3300046616 Ga0495668_0599481 Ga0495668_0599481_223_480 85
174 3300046660 Ga0495625_0205105 Ga0495625_0205105_226_483 85
175 3300046664 Ga0495659_0434580 Ga0495659_0434580_203_460 85
176 3300046809 Ga0495600_0423539 Ga0495600_0423539_243_500 85
177 3300047320 Ga0495672_0018210 Ga0495672_0018210_113_400 85
178 3300047469 Ga0495673_0000025 Ga0495673_0000025_310836_311093 85
179 3300047470 Ga0495681_0103428 Ga0495681_0103428_429_686 85
180 3300048904 Ga0496101_0887514 Ga0496101_0887514_155_412 85
181 3300048907 Ga0496104_1883447 Ga0496104_1883447_184_483 85
182 3300048919 Ga0496116_0284124 Ga0496116_0284124_249_506 85
183 3300048920 Ga0496117_0159545 Ga0496117_0159545_787_1044 85
184 3300048921 Ga0496118_0115244 Ga0496118_0115244_921_1178 85
185 3300048923 Ga0496120_0302160 Ga0496120_0302160_274_531 85
186 3300048924 Ga0496121_0011979 Ga0496121_0011979_3895_4152 85
187 3300048924 Ga0496121_0884946 Ga0496121_0884946_123_380 85
188 3300048925 Ga0496122_0060581 Ga0496122_0060581_2337_2594 85
189 3300048926 Ga0496123_0135766 Ga0496123_0135766_433_690 85
190 3300048927 Ga0496124_0053818 Ga0496124_0053818_594_851 85
191 3300048927 Ga0496124_0174407 Ga0496124_0174407_616_873 85
192 3300048927 Ga0496124_0735279 Ga0496124_0735279_153_410 85
193 3300048928 Ga0496125_0086725 Ga0496125_0086725_204_461 85
194 3300048928 Ga0496125_0112624 Ga0496125_0112624_1102_1359 85
195 3300048929 Ga0496126_0003646 Ga0496126_0003646_13158_13415 85
196 3300048929 Ga0496126_0023115 Ga0496126_0023115_726_983 85
197 3300049570 Ga0501033_1099309 Ga0501033_1099309_235_492 85
198 3300049571 Ga0501034_0028825 Ga0501034_0028825_2446_2703 85
199 3300049571 Ga0501034_0127541 Ga0501034_0127541_2162_2425 85
200 3300049571 Ga0501034_1040824 Ga0501034_1040824_133_390 85
201 3300049571 Ga0501034_1546568 Ga0501034_1546568_222_479 85
202 3300049572 Ga0501036_0575857 Ga0501036_0575857_342_599 85
203 3300049575 Ga0501039_0557419 Ga0501039_0557419_115_372 85
204 3300049575 Ga0501039_1122995 Ga0501039_1122995_65_322 85
205 3300049576 Ga0501040_0862430 Ga0501040_0862430_358_615 85
206 3300049576 Ga0501040_1193428 Ga0501040_1193428_205_513 85
207 3300049577 Ga0501041_0326572 Ga0501041_0326572_213_470 85
208 3300049578 Ga0501042_0741991 Ga0501042_0741991_447_704 85
209 3300049579 Ga0501043_0465585 Ga0501043_0465585_26_283 85
210 3300049579 Ga0501043_1192312 Ga0501043_1192312_132_389 85
211 3300049580 Ga0501046_0286363 Ga0501046_0286363_900_1157 85
212 3300049581 Ga0501047_0074218 Ga0501047_0074218_2314_2571 85
213 3300049581 Ga0501047_0506254 Ga0501047_0506254_64_321 85
214 3300049584 Ga0501068_0541376 Ga0501068_0541376_343_600 85
215 3300049586 Ga0501070_0873227 Ga0501070_0873227_374_631 85
216 3300049587 Ga0501071_0549945 Ga0501071_0549945_264_521 85
217 3300049588 Ga0501072_0825453 Ga0501072_0825453_31_288 85
218 3300049591 Ga0501075_0698470 Ga0501075_0698470_327_584 85
219 3300049592 Ga0501076_0783578 Ga0501076_0783578_243_500 85
220 3300049592 Ga0501076_1268422 Ga0501076_1268422_14_271 85
221 3300049593 Ga0501077_0412472 Ga0501077_0412472_405_662 85
222 3300049741 Ga0501079_0663511 Ga0501079_0663511_327_635 85
223 3300049743 Ga0501081_0122017 Ga0501081_0122017_1576_1833 85
224 3300049743 Ga0501081_0760105 Ga0501081_0760105_210_518 85
225 3300049822 Ga0501035_1507007 Ga0501035_1507007_213_470 85
226 3300049823 Ga0501044_1028067 Ga0501044_1028067_382_639 85
227 3300049823 Ga0501044_1295804 Ga0501044_1295804_194_451 85
228 3300049823 Ga0501044_1667561 Ga0501044_1667561_221_478 85
229 3300049824 Ga0501045_0711570 Ga0501045_0711570_193_450 85
230 3300050489 nmdc:mga03683_208284_c1 nmdc:mga03683_208284_c1_286_564 85
231 3300050491 nmdc:mga00v17_551106_c1 nmdc:mga00v17_551106_c1_166_444 85
232 3300050492 nmdc:mga0yw44_619072_c1 nmdc:mga0yw44_619072_c1_220_495 85
233 3300050493 nmdc:mga0k408_239616_c1 nmdc:mga0k408_239616_c1_510_767 85
234 3300050496 nmdc:mga07m45_483989_c1 nmdc:mga07m45_483989_c1_386_643 85
235 3300050516 nmdc:mga0sz30_24008_c1 nmdc:mga0sz30_24008_c1_551_826 85
236 3300053079 Ga0500610_0359428 Ga0500610_0359428_125_409 85
237 3300053085 Ga0495619_0070944 Ga0495619_0070944_661_918 85
238 3300053098 Ga0500650_0203357 Ga0500650_0203357_191_448 85
239 3300053098 Ga0500650_0204904 Ga0500650_0204904_358_642 85
240 3300053116 Ga0500592_000069 Ga0500592_000069_9849_10106 85
241 3300053119 Ga0500595_124552 Ga0500595_124552_232_492 85
242 3300053158 Ga0500627_0000060 Ga0500627_0000060_9899_10156 85
243 3300053731 Ga0500609_000477 Ga0500609_000477_4769_5047 85
244 3300054114 Ga0501084_0813542 Ga0501084_0813542_401_658 85
245 3300060353 Ga0501082_0336274 Ga0501082_0336274_440_697 85
246 3300061734 Ga0530510_0399392 Ga0530510_0399392_486_743 85

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02604

PhdYeFM_antitox

Antitoxin Phd_YefM, type II toxin-antitoxin system

19

90

0.82

Feature Viewer

pLDDT pTM Quality
83.83 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map