F358133

General Info

Members Datasets Scaffolds Average Seq Length
246 163 246 74

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_12093213|Ga0105248_120932132
Length 75
Sequence MEIARMPVTNKVRYNRFLRDEMSQAELAEKIGVSRQTIVAIEKGNYNPSIELALRLSRVLGTTVEELFQLGEETP

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
88 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
92 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
93 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
103 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
104 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
108 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
112 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
113 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
114 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
115 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
116 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
117 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
120 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
121 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
122 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
123 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
160 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
161 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
162 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
163 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.67
Nodule 0
Rhizoplane 2.85
Rhizosphere 74.8
Stem 0
Stem Tuber 0
Unclassified 5.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10029885 3300003320 Bacteria 8187
2 rootL2_10020294 3300003322 Bacteria 4604
3 rootH1_10030635 3300003323 Bacteria 1332
4 Ga0055541_1009194 3300003841 Bacteria 1541
5 Ga0070690_100114226 3300005330 Bacteria 1805
6 Ga0070666_10510088 3300005335 Bacteria 872
7 Ga0068868_100863163 3300005338 Bacteria 820
8 Ga0070660_100691122 3300005339 Bacteria 855
9 Ga0070689_100162792 3300005340 Bacteria 1804
10 Ga0070687_100308760 3300005343 Bacteria 1006
11 Ga0070661_100756694 3300005344 Bacteria 795
12 Ga0070674_100291128 3300005356 Unclassified 1298
13 Ga0070667_100899413 3300005367 Bacteria 824
14 Ga0070667_102130210 3300005367 Unclassified 528
15 Ga0070678_102028554 3300005456 Bacteria 544
16 Ga0070685_10548280 3300005466 Bacteria 825
17 Ga0070706_100004419 3300005467 Bacteria 13576
18 Ga0070707_100006223 3300005468 Bacteria 11113
19 Ga0070698_100099011 3300005471 Bacteria 2889
20 Ga0070699_100006892 3300005518 Bacteria 9882
21 Ga0070697_100517785 3300005536 Bacteria 1044
22 Ga0070686_100095607 3300005544 Bacteria 1996
23 Ga0068855_100639092 3300005563 Bacteria 1144
24 Ga0068857_100490446 3300005577 Bacteria 1152
25 Ga0068856_101477471 3300005614 Bacteria 694
26 Ga0068852_100447653 3300005616 Archaea 1278
27 Ga0068852_101544684 3300005616 Bacteria 686
28 Ga0068859_101329526 3300005617 Bacteria 792
29 Ga0068864_100892707 3300005618 Unclassified 877
30 Ga0068858_102254077 3300005842 Bacteria 538
31 Ga0070717_10081415 3300006028 Bacteria 2718
32 Ga0075365_10134765 3300006038 Bacteria 1711
33 Ga0075365_10766796 3300006038 Bacteria 681
34 Ga0075363_100098537 3300006048 Bacteria 1616
35 Ga0075363_100127423 3300006048 Bacteria 1426
36 Ga0075364_10118259 3300006051 Bacteria 1773
37 Ga0075364_10731960 3300006051 Bacteria 675
38 Ga0075364_10931534 3300006051 Bacteria 591
39 Ga0075362_10016839 3300006177 Bacteria 3001
40 Ga0075362_10040897 3300006177 Bacteria 2042
41 Ga0075367_10060306 3300006178 Bacteria 2261
42 Ga0075367_10778553 3300006178 Bacteria 609
43 Ga0075369_10411947 3300006186 Bacteria 638
44 Ga0075369_10476554 3300006186 Bacteria 592
45 Ga0075366_10055373 3300006195 Bacteria 2356
46 Ga0075366_10140351 3300006195 Bacteria 1461
47 Ga0075366_10179958 3300006195 Unclassified 1284
48 Ga0075370_10158474 3300006353 Bacteria 1328
49 Ga0075370_10480698 3300006353 Bacteria 749
50 Ga0068871_101601845 3300006358 Unclassified 616
51 Ga0075430_101049220 3300006846 Bacteria 671
52 Ga0075433_10429845 3300006852 Unclassified 1164
53 Ga0075434_101587021 3300006871 Unclassified 663
54 Ga0075429_101353717 3300006880 Unclassified 620
55 Ga0097620_101329723 3300006931 Bacteria 792
56 Ga0075435_100382642 3300007076 Bacteria 1209
57 Ga0105247_10302549 3300009101 Bacteria 1110
58 Ga0105247_11343010 3300009101 Unclassified 576
59 Ga0114129_10065161 3300009147 Bacteria 5086
60 Ga0105243_12004047 3300009148 Unclassified 613
61 Ga0105242_10472745 3300009176 Bacteria 1186
62 Ga0105242_11269523 3300009176 Bacteria 759
63 Ga0105248_10151763 3300009177 Bacteria 2614
64 Ga0105248_12093213 3300009177 Bacteria 643
65 Ga0105237_10994330 3300009545 Bacteria 846
66 Ga0105239_10403690 3300010375 Bacteria 1547
67 Ga0105246_10982892 3300011119 Bacteria 763
68 Ga0105246_11716297 3300011119 Bacteria 597
69 Ga0105246_11808459 3300011119 Unclassified 584
70 Ga0157371_10602271 3300013102 Bacteria 817
71 Ga0157374_11858585 3300013296 Archaea 628
72 Ga0157378_12183026 3300013297 Bacteria 605
73 Ga0157375_10188526 3300013308 Bacteria 2217
74 Ga0163163_10867451 3300014325 Bacteria 966
75 Ga0163163_10990392 3300014325 Bacteria 904
76 Ga0157380_11622252 3300014326 Unclassified 703
77 Ga0157380_11923676 3300014326 Bacteria 652
78 Ga0157380_12703480 3300014326 Bacteria 563
79 Ga0157380_13542629 3300014326 Unclassified 500
80 Ga0157379_10471815 3300014968 Bacteria 1161
81 Ga0209566_101499 3300025225 Bacteria 6603
82 Ga0209147_109053 3300025229 Bacteria 1203
83 Ga0209675_1011255 3300025291 Bacteria 2980
84 Ga0209025_1000043 3300025294 Bacteria 350458
85 Ga0209025_1002351 3300025294 Bacteria 20354
86 Ga0207705_10713407 3300025909 Bacteria 779
87 Ga0207684_10012253 3300025910 Bacteria 7465
88 Ga0207657_10911306 3300025919 Bacteria 677
89 Ga0207646_10001013 3300025922 Bacteria 35945
90 Ga0207659_10162077 3300025926 Archaea 1757
91 Ga0207686_11762104 3300025934 Bacteria 512
92 Ga0207670_10173848 3300025936 Bacteria 1617
93 Ga0207669_10654977 3300025937 Bacteria 859
94 Ga0207711_10352480 3300025941 Bacteria 1363
95 Ga0207711_11607177 3300025941 Bacteria 593
96 Ga0207711_11709173 3300025941 Bacteria 573
97 Ga0207689_10873816 3300025942 Bacteria 759
98 Ga0207679_11574000 3300025945 Bacteria 602
99 Ga0207667_10495522 3300025949 Bacteria 1239
100 Ga0207667_11053472 3300025949 Bacteria 798
101 Ga0207668_11156905 3300025972 Bacteria 694
102 Ga0207640_11107390 3300025981 Bacteria 701
103 Ga0207658_10746708 3300025986 Bacteria 886
104 Ga0207639_11451534 3300026041 Bacteria 644
105 Ga0207708_10557793 3300026075 Bacteria 967
106 Ga0207708_11759567 3300026075 Bacteria 544
107 Ga0207702_10632531 3300026078 Bacteria 1052
108 Ga0207648_10469728 3300026089 Bacteria 1148
109 Ga0207648_11065357 3300026089 Unclassified 758
110 Ga0207674_10665556 3300026116 Bacteria 1005
111 Ga0207674_12106563 3300026116 Bacteria 528
112 Ga0207683_11488365 3300026121 Bacteria 625
113 Ga0207683_12042103 3300026121 Bacteria 522
114 Ga0268266_11489519 3300028379 Bacteria 652
115 Ga0268265_11283919 3300028380 Bacteria 732
116 Ga0265323_10259631 3300028653 Bacteria 540
117 Ga0265329_10037053 3300031242 Bacteria 1571
118 Ga0307509_10363412 3300031507 Bacteria 1166
119 Ga0307408_101088433 3300031548 Bacteria 741
120 Ga0307508_10594272 3300031616 Unclassified 708
121 Ga0316576_10000621 3300031727 Bacteria 17080
122 Ga0316576_10543201 3300031727 Bacteria 852
123 Ga0316576_10783922 3300031727 Archaea 687
124 Ga0316578_10066666 3300031728 Bacteria 2127
125 Ga0316578_10402541 3300031728 Bacteria 811
126 Ga0307405_10194072 3300031731 Bacteria 1469
127 Ga0307405_12042038 3300031731 Bacteria 514
128 Ga0316577_10200171 3300031733 Unclassified 1129
129 Ga0316577_10386870 3300031733 Bacteria 795
130 Ga0307413_11110573 3300031824 Bacteria 683
131 Ga0307413_11171297 3300031824 Bacteria 667
132 Ga0307406_10045383 3300031901 Bacteria 2759
133 Ga0307406_10728607 3300031901 Bacteria 830
134 Ga0307409_100464619 3300031995 Bacteria 1224
135 Ga0307409_100906467 3300031995 Bacteria 895
136 Ga0307416_100421846 3300032002 Bacteria 1379
137 Ga0307416_101036934 3300032002 Bacteria 924
138 Ga0307411_11213426 3300032005 Unclassified 684
139 Ga0307411_12009051 3300032005 Bacteria 540
140 Ga0307415_100079113 3300032126 Bacteria 2341
141 Ga0307415_100135725 3300032126 Bacteria 1871
142 Ga0316583_10220757 3300032133 Bacteria 657
143 Ga0316580_10045624 3300032139 Unclassified 1351
144 Ga0316580_10121460 3300032139 Bacteria 800
145 Ga0316574_0071432 3300035398 Bacteria 2192
146 Ga0316574_0095591 3300035398 Bacteria 1899
147 Ga0316574_0235497 3300035398 Bacteria 1171
148 Ga0316574_0237015 3300035398 Unclassified 1167
149 Ga0316574_0402584 3300035398 Bacteria 862
150 Ga0373935_1346361 3300035692 Bacteria 533
151 Ga0373937_1782566 3300036401 Bacteria 562
152 Ga0316582_0176904 3300036647 Bacteria 1451
153 Ga0316584_0306320 3300036712 Bacteria 1149
154 Ga0316584_0520807 3300036712 Bacteria 833
155 Ga0316584_0685674 3300036712 Bacteria 703
156 Ga0395899_0052321 3300037312 Bacteria 3027
157 Ga0395905_0618449 3300037471 Unclassified 985
158 Ga0400483_021185 3300039062 Bacteria 2190
159 Ga0400483_040815 3300039062 Bacteria 1740
160 Ga0400483_199737 3300039062 Bacteria 2281
161 Ga0400483_220738 3300039062 Bacteria 1851
162 Ga0439465_0091670 3300041413 Bacteria 1040
163 Ga0439465_0169502 3300041413 Bacteria 786
164 Ga0451793_1817109 3300041452 Bacteria 521
165 Ga0451797_0965579 3300041453 Bacteria 830
166 Ga0451800_0392476 3300041459 Bacteria 955
167 Ga0451800_1512548 3300041459 Bacteria 592
168 Ga0451802_1605701 3300041460 Bacteria 532
169 Ga0451837_0810363 3300041494 Bacteria 550
170 Ga0451853_2291240 3300041512 Bacteria 1041
171 Ga0451853_3817301 3300041512 Bacteria 625
172 Ga0439441_180683 3300042001 Bacteria 507
173 Ga0439445_0017891 3300042004 Bacteria 1755
174 Ga0439432_112455 3300042006 Bacteria 810
175 Ga0450908_060119 3300042184 Bacteria 667
176 Ga0439460_0170453 3300042461 Bacteria 733
177 Ga0451577_0017539 3300042876 Bacteria 6613
178 Ga0451577_0927826 3300042876 Bacteria 783
179 Ga0451577_1627978 3300042876 Unclassified 569
180 Ga0451577_2007921 3300042876 Bacteria 505
181 Ga0453683_0128318 3300044673 Bacteria 1597
182 Ga0466965_0809396 3300044683 Bacteria 542
183 Ga0466966_0210915 3300044684 Bacteria 1174
184 Ga0466961_0432184 3300044693 Bacteria 797
185 Ga0466961_0694741 3300044693 Bacteria 609
186 Ga0453684_0000873 3300044712 Bacteria 101078
187 Ga0453684_0004287 3300044712 Bacteria 30425
188 Ga0453684_0009811 3300044712 Bacteria 16595
189 Ga0453684_0011559 3300044712 Bacteria 14761
190 Ga0453684_0012284 3300044712 Bacteria 14177
191 Ga0453684_0013965 3300044712 Bacteria 12941
192 Ga0453684_0041257 3300044712 Bacteria 6247
193 Ga0453684_0195378 3300044712 Bacteria 2363
194 Ga0453684_0340815 3300044712 Bacteria 1692
195 Ga0453684_0776831 3300044712 Bacteria 1035
196 Ga0453684_0876974 3300044712 Unclassified 962
197 Ga0453684_1192688 3300044712 Bacteria 799
198 Ga0453684_1904626 3300044712 Unclassified 601
199 Ga0453684_1933536 3300044712 Unclassified 596
200 Ga0466960_0035162 3300044901 Bacteria 2339
201 Ga0466960_0411747 3300044901 Bacteria 780
202 Ga0466960_0879016 3300044901 Bacteria 546
203 Ga0451576_0000046 3300045051 Bacteria 334064
204 Ga0451576_0007694 3300045051 Bacteria 12816
205 Ga0451576_0101797 3300045051 Bacteria 2987
206 Ga0466958_0515493 3300045836 Bacteria 776
207 Ga0466967_0463435 3300045976 Bacteria 1240
208 Ga0466967_0942118 3300045976 Bacteria 859
209 Ga0466967_1789876 3300045976 Bacteria 611
210 Ga0495669_0274334 3300046684 Bacteria 811
211 Ga0495672_0013234 3300047320 Bacteria 5700
212 Ga0495686_0479562 3300047472 Bacteria 657
213 Ga0496107_1261300 3300048910 Bacteria 530
214 Ga0496110_1562962 3300048913 Bacteria 570
215 Ga0496116_0345481 3300048919 Bacteria 684
216 Ga0496126_0008069 3300048929 Bacteria 11405
217 Ga0501034_0261745 3300049571 Bacteria 1672
218 Ga0501034_0607087 3300049571 Bacteria 999
219 Ga0501069_0489413 3300049585 Bacteria 733
220 Ga0501072_0991697 3300049588 Bacteria 655
221 Ga0501080_0025649 3300049742 Bacteria 5475
222 Ga0501266_035555 3300049763 Bacteria 725
223 nmdc:mga03683_187793_c1 3300050489 Bacteria 945
224 nmdc:mga03683_215342_c1 3300050489 Bacteria 885
225 nmdc:mga03683_560779_c1 3300050489 Bacteria 556
226 nmdc:mga03n38_115285_c1 3300050490 Bacteria 1314
227 nmdc:mga00v17_11540_c1 3300050491 Bacteria 4858
228 nmdc:mga00v17_724886_c1 3300050491 Bacteria 636
229 nmdc:mga0yw44_675238_c1 3300050492 Bacteria 702
230 nmdc:mga0k408_172045_c1 3300050493 Unclassified 1291
231 nmdc:mga0k408_45367_c1 3300050493 Bacteria 2536
232 nmdc:mga06z11_145225_c1 3300050494 Bacteria 1344
233 nmdc:mga06z11_989897_c1 3300050494 Bacteria 512
234 nmdc:mga07m45_160786_c1 3300050496 Bacteria 1304
235 nmdc:mga07m45_908401_c1 3300050496 Bacteria 504
236 nmdc:mga05p37_476732_c1 3300050507 Bacteria 1438
237 nmdc:mga09592_1098759_c1 3300050508 Unclassified 661
238 nmdc:mga0n895_1759598_c1 3300050512 Unclassified 581
239 nmdc:mga0rr50_1484096_c1 3300050513 Unclassified 573
240 nmdc:mga08x19_847279_c1 3300050514 Bacteria 649
241 nmdc:mga0a205_702062_c2 3300050515 Unclassified 516
242 nmdc:mga0sz30_430049_c1 3300050516 Bacteria 592
243 Ga0500595_120439 3300053119 Unclassified 742
244 Ga0500628_147612 3300053129 Bacteria 656
245 Ga0500577_0077799 3300053142 Bacteria 1316
246 Ga0466962_0303841 3300061719 Bacteria 790

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005330 Ga0070690_100114226 Ga0070690_1001142262 67
2 3300005335 Ga0070666_10510088 Ga0070666_105100882 67
3 3300005340 Ga0070689_100162792 Ga0070689_1001627922 67
4 3300005343 Ga0070687_100308760 Ga0070687_1003087602 67
5 3300005367 Ga0070667_100899413 Ga0070667_1008994132 67
6 3300005456 Ga0070678_102028554 Ga0070678_1020285541 67
7 3300005544 Ga0070686_100095607 Ga0070686_1000956073 67
8 3300005842 Ga0068858_102254077 Ga0068858_1022540771 67
9 3300009176 Ga0105242_10472745 Ga0105242_104727452 67
10 3300025934 Ga0207686_11762104 Ga0207686_117621042 67
11 3300025936 Ga0207670_10173848 Ga0207670_101738483 67
12 3300025937 Ga0207669_10654977 Ga0207669_106549772 67
13 3300025941 Ga0207711_11607177 Ga0207711_116071772 67
14 3300025986 Ga0207658_10746708 Ga0207658_107467082 67
15 3300026075 Ga0207708_11759567 Ga0207708_117595672 67
16 3300026121 Ga0207683_12042103 Ga0207683_120421032 67
17 3300036401 Ga0373937_1782566 Ga0373937_1782566_101_325 69
18 3300003841 Ga0055541_1009194 Ga0055541_10091943 70
19 3300005356 Ga0070674_100291128 Ga0070674_1002911282 70
20 3300005367 Ga0070667_102130210 Ga0070667_1021302102 70
21 3300005466 Ga0070685_10548280 Ga0070685_105482802 70
22 3300005467 Ga0070706_100004419 Ga0070706_1000044196 70
23 3300005468 Ga0070707_100006223 Ga0070707_1000062233 70
24 3300005471 Ga0070698_100099011 Ga0070698_1000990114 70
25 3300005518 Ga0070699_100006892 Ga0070699_1000068926 70
26 3300005536 Ga0070697_100517785 Ga0070697_1005177852 70
27 3300005616 Ga0068852_100447653 Ga0068852_1004476531 70
28 3300005617 Ga0068859_101329526 Ga0068859_1013295262 70
29 3300005618 Ga0068864_100892707 Ga0068864_1008927072 70
30 3300006028 Ga0070717_10081415 Ga0070717_100814154 70
31 3300006038 Ga0075365_10134765 Ga0075365_101347652 70
32 3300006051 Ga0075364_10731960 Ga0075364_107319602 70
33 3300006178 Ga0075367_10778553 Ga0075367_107785532 70
34 3300006186 Ga0075369_10411947 Ga0075369_104119472 70
35 3300006195 Ga0075366_10055373 Ga0075366_100553734 70
36 3300006195 Ga0075366_10179958 Ga0075366_101799582 70
37 3300006358 Ga0068871_101601845 Ga0068871_1016018451 70
38 3300006852 Ga0075433_10429845 Ga0075433_104298452 70
39 3300006871 Ga0075434_101587021 Ga0075434_1015870211 70
40 3300006931 Ga0097620_101329723 Ga0097620_1013297232 70
41 3300007076 Ga0075435_100382642 Ga0075435_1003826423 70
42 3300009101 Ga0105247_10302549 Ga0105247_103025492 70
43 3300009101 Ga0105247_11343010 Ga0105247_113430102 70
44 3300009148 Ga0105243_12004047 Ga0105243_120040472 70
45 3300010375 Ga0105239_10403690 Ga0105239_104036903 70
46 3300011119 Ga0105246_11808459 Ga0105246_118084592 70
47 3300013102 Ga0157371_10602271 Ga0157371_106022711 70
48 3300013296 Ga0157374_11858585 Ga0157374_118585852 70
49 3300013308 Ga0157375_10188526 Ga0157375_101885263 70
50 3300014326 Ga0157380_11622252 Ga0157380_116222522 70
51 3300025225 Ga0209566_101499 Ga0209566_1014994 70
52 3300025229 Ga0209147_109053 Ga0209147_1090532 70
53 3300025291 Ga0209675_1011255 Ga0209675_10112552 70
54 3300025294 Ga0209025_1000043 Ga0209025_100004348 70
55 3300025294 Ga0209025_1002351 Ga0209025_100235120 70
56 3300025910 Ga0207684_10012253 Ga0207684_100122533 70
57 3300025922 Ga0207646_10001013 Ga0207646_100010138 70
58 3300025926 Ga0207659_10162077 Ga0207659_101620771 70
59 3300026089 Ga0207648_11065357 Ga0207648_110653571 70
60 3300026121 Ga0207683_11488365 Ga0207683_114883651 70
61 3300028379 Ga0268266_11489519 Ga0268266_114895192 70
62 3300031242 Ga0265329_10037053 Ga0265329_100370533 70
63 3300031727 Ga0316576_10000621 Ga0316576_1000062113 70
64 3300031727 Ga0316576_10783922 Ga0316576_107839221 70
65 3300031728 Ga0316578_10402541 Ga0316578_104025412 70
66 3300031731 Ga0307405_10194072 Ga0307405_101940722 70
67 3300031733 Ga0316577_10200171 Ga0316577_102001712 70
68 3300031824 Ga0307413_11110573 Ga0307413_111105732 70
69 3300031824 Ga0307413_11171297 Ga0307413_111712971 70
70 3300031995 Ga0307409_100464619 Ga0307409_1004646192 70
71 3300032005 Ga0307411_11213426 Ga0307411_112134262 70
72 3300032005 Ga0307411_12009051 Ga0307411_120090512 70
73 3300032133 Ga0316583_10220757 Ga0316583_102207572 70
74 3300032139 Ga0316580_10045624 Ga0316580_100456242 70
75 3300035398 Ga0316574_0235497 Ga0316574_0235497_715_942 70
76 3300035398 Ga0316574_0237015 Ga0316574_0237015_807_1025 70
77 3300035398 Ga0316574_0402584 Ga0316574_0402584_368_592 70
78 3300036712 Ga0316584_0306320 Ga0316584_0306320_324_542 70
79 3300037312 Ga0395899_0052321 Ga0395899_0052321_2199_2423 70
80 3300039062 Ga0400483_021185 Ga0400483_021185_402_635 70
81 3300039062 Ga0400483_040815 Ga0400483_040815_255_482 70
82 3300039062 Ga0400483_199737 Ga0400483_199737_243_470 70
83 3300039062 Ga0400483_220738 Ga0400483_220738_953_1186 70
84 3300041453 Ga0451797_0965579 Ga0451797_0965579_390_611 70
85 3300042876 Ga0451577_0017539 Ga0451577_0017539_2581_2808 70
86 3300042876 Ga0451577_0927826 Ga0451577_0927826_267_494 70
87 3300042876 Ga0451577_1627978 Ga0451577_1627978_306_536 70
88 3300044673 Ga0453683_0128318 Ga0453683_0128318_350_577 70
89 3300044693 Ga0466961_0432184 Ga0466961_0432184_105_377 70
90 3300044712 Ga0453684_0000873 Ga0453684_0000873_5436_5663 70
91 3300044712 Ga0453684_0004287 Ga0453684_0004287_13184_13411 70
92 3300044712 Ga0453684_0009811 Ga0453684_0009811_12567_12800 70
93 3300044712 Ga0453684_0011559 Ga0453684_0011559_9051_9278 70
94 3300044712 Ga0453684_0012284 Ga0453684_0012284_6942_7169 70
95 3300044712 Ga0453684_0013965 Ga0453684_0013965_3833_4069 70
96 3300044712 Ga0453684_0041257 Ga0453684_0041257_5979_6206 70
97 3300044712 Ga0453684_0195378 Ga0453684_0195378_2072_2299 70
98 3300044712 Ga0453684_0340815 Ga0453684_0340815_1260_1487 70
99 3300044712 Ga0453684_0776831 Ga0453684_0776831_228_455 70
100 3300044712 Ga0453684_0876974 Ga0453684_0876974_233_460 70
101 3300044712 Ga0453684_1192688 Ga0453684_1192688_345_572 70
102 3300044712 Ga0453684_1933536 Ga0453684_1933536_158_394 70
103 3300045051 Ga0451576_0000046 Ga0451576_0000046_12675_12908 70
104 3300045051 Ga0451576_0007694 Ga0451576_0007694_658_903 70
105 3300045051 Ga0451576_0101797 Ga0451576_0101797_77_304 70
106 3300045976 Ga0466967_0463435 Ga0466967_0463435_506_739 70
107 3300046684 Ga0495669_0274334 Ga0495669_0274334_361_594 70
108 3300048910 Ga0496107_1261300 Ga0496107_1261300_40_264 70
109 3300048913 Ga0496110_1562962 Ga0496110_1562962_285_509 70
110 3300048919 Ga0496116_0345481 Ga0496116_0345481_285_509 70
111 3300050493 nmdc:mga0k408_172045_c1 nmdc:mga0k408_172045_c1_849_1082 70
112 3300050512 nmdc:mga0n895_1759598_c1 nmdc:mga0n895_1759598_c1_97_327 70
113 3300050513 nmdc:mga0rr50_1484096_c1 nmdc:mga0rr50_1484096_c1_264_485 70
114 3300050514 nmdc:mga08x19_847279_c1 nmdc:mga08x19_847279_c1_156_377 70
115 3300050515 nmdc:mga0a205_702062_c2 nmdc:mga0a205_702062_c2_135_362 70
116 3300053129 Ga0500628_147612 Ga0500628_147612_133_363 70
117 3300003323 rootH1_10030635 rootH1_100306353 71
118 3300005339 Ga0070660_100691122 Ga0070660_1006911222 71
119 3300005344 Ga0070661_100756694 Ga0070661_1007566941 71
120 3300005563 Ga0068855_100639092 Ga0068855_1006390922 71
121 3300005577 Ga0068857_100490446 Ga0068857_1004904462 71
122 3300006846 Ga0075430_101049220 Ga0075430_1010492202 71
123 3300009177 Ga0105248_10151763 Ga0105248_101517633 71
124 3300013297 Ga0157378_12183026 Ga0157378_121830262 71
125 3300014325 Ga0163163_10867451 Ga0163163_108674512 71
126 3300014325 Ga0163163_10990392 Ga0163163_109903922 71
127 3300014326 Ga0157380_12703480 Ga0157380_127034802 71
128 3300014968 Ga0157379_10471815 Ga0157379_104718152 71
129 3300025909 Ga0207705_10713407 Ga0207705_107134072 71
130 3300025919 Ga0207657_10911306 Ga0207657_109113062 71
131 3300025941 Ga0207711_10352480 Ga0207711_103524802 71
132 3300025945 Ga0207679_11574000 Ga0207679_115740002 71
133 3300025949 Ga0207667_11053472 Ga0207667_110534722 71
134 3300025972 Ga0207668_11156905 Ga0207668_111569052 71
135 3300026041 Ga0207639_11451534 Ga0207639_114515342 71
136 3300026075 Ga0207708_10557793 Ga0207708_105577932 71
137 3300026089 Ga0207648_10469728 Ga0207648_104697282 71
138 3300026116 Ga0207674_10665556 Ga0207674_106655562 71
139 3300026116 Ga0207674_12106563 Ga0207674_121065632 71
140 3300028380 Ga0268265_11283919 Ga0268265_112839192 71
141 3300028653 Ga0265323_10259631 Ga0265323_102596311 71
142 3300031507 Ga0307509_10363412 Ga0307509_103634122 71
143 3300031548 Ga0307408_101088433 Ga0307408_1010884332 71
144 3300031616 Ga0307508_10594272 Ga0307508_105942721 71
145 3300031727 Ga0316576_10543201 Ga0316576_105432012 71
146 3300031728 Ga0316578_10066666 Ga0316578_100666662 71
147 3300031731 Ga0307405_12042038 Ga0307405_120420382 71
148 3300031733 Ga0316577_10386870 Ga0316577_103868702 71
149 3300031901 Ga0307406_10045383 Ga0307406_100453834 71
150 3300031901 Ga0307406_10728607 Ga0307406_107286072 71
151 3300031995 Ga0307409_100906467 Ga0307409_1009064671 71
152 3300032002 Ga0307416_100421846 Ga0307416_1004218462 71
153 3300032002 Ga0307416_101036934 Ga0307416_1010369342 71
154 3300032126 Ga0307415_100079113 Ga0307415_1000791133 71
155 3300032126 Ga0307415_100135725 Ga0307415_1001357253 71
156 3300032139 Ga0316580_10121460 Ga0316580_101214602 71
157 3300035398 Ga0316574_0071432 Ga0316574_0071432_374_592 71
158 3300035398 Ga0316574_0095591 Ga0316574_0095591_1608_1832 71
159 3300036647 Ga0316582_0176904 Ga0316582_0176904_865_1089 71
160 3300036712 Ga0316584_0520807 Ga0316584_0520807_471_695 71
161 3300036712 Ga0316584_0685674 Ga0316584_0685674_10_234 71
162 3300041452 Ga0451793_1817109 Ga0451793_1817109_193_411 71
163 3300041459 Ga0451800_0392476 Ga0451800_0392476_520_747 71
164 3300041459 Ga0451800_1512548 Ga0451800_1512548_319_543 71
165 3300041460 Ga0451802_1605701 Ga0451802_1605701_288_515 71
166 3300041512 Ga0451853_3817301 Ga0451853_3817301_284_508 71
167 3300042001 Ga0439441_180683 Ga0439441_180683_269_487 71
168 3300042184 Ga0450908_060119 Ga0450908_060119_115_339 71
169 3300042461 Ga0439460_0170453 Ga0439460_0170453_99_323 71
170 3300042876 Ga0451577_2007921 Ga0451577_2007921_118_345 71
171 3300044683 Ga0466965_0809396 Ga0466965_0809396_314_532 71
172 3300044684 Ga0466966_0210915 Ga0466966_0210915_473_691 71
173 3300044693 Ga0466961_0694741 Ga0466961_0694741_271_489 71
174 3300044712 Ga0453684_1904626 Ga0453684_1904626_347_565 71
175 3300044901 Ga0466960_0035162 Ga0466960_0035162_44_268 71
176 3300044901 Ga0466960_0411747 Ga0466960_0411747_206_424 71
177 3300044901 Ga0466960_0879016 Ga0466960_0879016_79_303 71
178 3300045836 Ga0466958_0515493 Ga0466958_0515493_471_689 71
179 3300045976 Ga0466967_0942118 Ga0466967_0942118_519_752 71
180 3300045976 Ga0466967_1789876 Ga0466967_1789876_197_415 71
181 3300047320 Ga0495672_0013234 Ga0495672_0013234_3602_3826 71
182 3300048929 Ga0496126_0008069 Ga0496126_0008069_6603_6827 71
183 3300049571 Ga0501034_0607087 Ga0501034_0607087_528_752 71
184 3300049585 Ga0501069_0489413 Ga0501069_0489413_104_322 71
185 3300049588 Ga0501072_0991697 Ga0501072_0991697_184_402 71
186 3300049742 Ga0501080_0025649 Ga0501080_0025649_3422_3640 71
187 3300050507 nmdc:mga05p37_476732_c1 nmdc:mga05p37_476732_c1_810_1028 71
188 3300053142 Ga0500577_0077799 Ga0500577_0077799_148_372 71
189 3300061719 Ga0466962_0303841 Ga0466962_0303841_202_420 71
190 3300003320 rootH2_10029885 rootH2_100298856 72
191 3300003322 rootL2_10020294 rootL2_100202946 72
192 3300005338 Ga0068868_100863163 Ga0068868_1008631632 72
193 3300005614 Ga0068856_101477471 Ga0068856_1014774711 72
194 3300005616 Ga0068852_101544684 Ga0068852_1015446842 72
195 3300006038 Ga0075365_10766796 Ga0075365_107667962 72
196 3300006048 Ga0075363_100098537 Ga0075363_1000985371 72
197 3300006048 Ga0075363_100127423 Ga0075363_1001274233 72
198 3300006051 Ga0075364_10118259 Ga0075364_101182593 72
199 3300006051 Ga0075364_10931534 Ga0075364_109315342 72
200 3300006177 Ga0075362_10016839 Ga0075362_100168393 72
201 3300006177 Ga0075362_10040897 Ga0075362_100408973 72
202 3300006178 Ga0075367_10060306 Ga0075367_100603062 72
203 3300006186 Ga0075369_10476554 Ga0075369_104765542 72
204 3300006195 Ga0075366_10140351 Ga0075366_101403513 72
205 3300006353 Ga0075370_10158474 Ga0075370_101584742 72
206 3300006353 Ga0075370_10480698 Ga0075370_104806982 72
207 3300006880 Ga0075429_101353717 Ga0075429_1013537172 72
208 3300009147 Ga0114129_10065161 Ga0114129_100651613 72
209 3300009176 Ga0105242_11269523 Ga0105242_112695232 72
210 3300009177 Ga0105248_12093213 Ga0105248_120932132 72
211 3300009545 Ga0105237_10994330 Ga0105237_109943302 72
212 3300011119 Ga0105246_10982892 Ga0105246_109828922 72
213 3300011119 Ga0105246_11716297 Ga0105246_117162971 72
214 3300014326 Ga0157380_11923676 Ga0157380_119236761 72
215 3300014326 Ga0157380_13542629 Ga0157380_135426292 72
216 3300025941 Ga0207711_11709173 Ga0207711_117091732 72
217 3300025942 Ga0207689_10873816 Ga0207689_108738161 72
218 3300025949 Ga0207667_10495522 Ga0207667_104955222 72
219 3300025981 Ga0207640_11107390 Ga0207640_111073902 72
220 3300026078 Ga0207702_10632531 Ga0207702_106325312 72
221 3300035692 Ga0373935_1346361 Ga0373935_1346361_77_304 72
222 3300037471 Ga0395905_0618449 Ga0395905_0618449_421_648 72
223 3300041413 Ga0439465_0091670 Ga0439465_0091670_554_781 72
224 3300041413 Ga0439465_0169502 Ga0439465_0169502_20_241 72
225 3300041494 Ga0451837_0810363 Ga0451837_0810363_27_245 72
226 3300041512 Ga0451853_2291240 Ga0451853_2291240_511_738 72
227 3300042004 Ga0439445_0017891 Ga0439445_0017891_49_267 72
228 3300042006 Ga0439432_112455 Ga0439432_112455_91_309 72
229 3300047472 Ga0495686_0479562 Ga0495686_0479562_176_394 72
230 3300049571 Ga0501034_0261745 Ga0501034_0261745_101_319 72
231 3300049763 Ga0501266_035555 Ga0501266_035555_208_426 72
232 3300050489 nmdc:mga03683_187793_c1 nmdc:mga03683_187793_c1_164_382 72
233 3300050489 nmdc:mga03683_215342_c1 nmdc:mga03683_215342_c1_347_571 72
234 3300050489 nmdc:mga03683_560779_c1 nmdc:mga03683_560779_c1_218_445 72
235 3300050490 nmdc:mga03n38_115285_c1 nmdc:mga03n38_115285_c1_868_1086 72
236 3300050491 nmdc:mga00v17_11540_c1 nmdc:mga00v17_11540_c1_3383_3601 72
237 3300050491 nmdc:mga00v17_724886_c1 nmdc:mga00v17_724886_c1_243_467 72
238 3300050492 nmdc:mga0yw44_675238_c1 nmdc:mga0yw44_675238_c1_164_382 72
239 3300050493 nmdc:mga0k408_45367_c1 nmdc:mga0k408_45367_c1_1566_1784 72
240 3300050494 nmdc:mga06z11_145225_c1 nmdc:mga06z11_145225_c1_624_842 72
241 3300050494 nmdc:mga06z11_989897_c1 nmdc:mga06z11_989897_c1_96_323 72
242 3300050496 nmdc:mga07m45_160786_c1 nmdc:mga07m45_160786_c1_1061_1279 72
243 3300050496 nmdc:mga07m45_908401_c1 nmdc:mga07m45_908401_c1_83_307 72
244 3300050508 nmdc:mga09592_1098759_c1 nmdc:mga09592_1098759_c1_286_519 72
245 3300050516 nmdc:mga0sz30_430049_c1 nmdc:mga0sz30_430049_c1_116_334 72
246 3300053119 Ga0500595_120439 Ga0500595_120439_256_483 72

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

16

67

0.95

PF12844

HTH_19

Helix-turn-helix domain

16

73

0.94

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

16

73

0.94

PF13560

HTH_31

Helix-turn-helix domain

15

70

0.93

PF07022

Phage_CI_repr

Bacteriophage CI repressor helix-turn-helix domain

20

75

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jxc-assembly1.cif.gz_L crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+ 0.9674 12 65
1adr-assembly1.cif.gz_A determination of the nuclear magnetic resonance structure of the dna-binding domain of the p22 c2 repressor (1-76) in solution and comparison with the dna-binding domain of the 434 repressor 0.9414 12 65
3f51-assembly1.cif.gz_A crystal structure of the clp gene regulator clgr from corynebacterium glutamicum 0.9412 11 64
3u3w-assembly1.cif.gz_B crystal structure of bacillus thuringiensis plcr in complex with the peptide papr7 and dna 0.9391 12 64
1y7y-assembly1.cif.gz_B high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.9363 12 66
ID Description Score Start End Superfamily
2r1jL00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9671 12 65 1.10.260.40
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9469 9 72 1.10.260.40
1adrA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9414 12 65 1.10.260.40
3f51A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9412 11 64 1.10.260.40
3u3wB01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9391 12 64 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A3N5XZ18-F1-model_v4 Transcriptional regulator 1.011 8 70 GO:0003677
AF-A0A2T6D2C2-F1-model_v4 Transcriptional regulator 1.009 8 68 GO:0003677
AF-A0A1I0DGC6-F1-model_v4 Putative transcriptional regulator 1.008 8 70 GO:0003677
AF-A0A6N7QWD9-F1-model_v4 Helix-turn-helix domain-containing protein 1.008 7 70 GO:0003677
AF-A0A0S8KX06-F1-model_v4 HTH cro/C1-type domain-containing protein 1.008 8 68 GO:0003677

Feature Viewer

pLDDT pTM Quality
91.84 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map