F357490

General Info

Members Datasets Scaffolds Average Seq Length
245 193 226 152

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10175007|Ga0307508_101750072
Length 176
Sequence VAVSKDGPQCRFVIPGTRVGLMVSGRSLEVATALITGAFGAAVVVSSLDNGIGWSSAGVESGTFPFIVGLVILAGSLFNLVQGWLHARAVILGPSELRRLGILFVPAAVFVGIIPLIGMVPASACYVFGALAWHKRGSLLVAATAAIGAALALYLIFELTFQISLPRGVLGTLLGF

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
6 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
7 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
8 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
9 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
10 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
11 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
12 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
13 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
14 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
15 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
16 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
81 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
82 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
114 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
115 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
120 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
146 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
147 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
162 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
176 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
177 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
178 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
179 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
180 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
181 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
182 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
183 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
184 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
185 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
186 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
187 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
188 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
189 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
190 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
191 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
192 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
193 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.24
Metatranscriptomes 0
Isolates 7.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.24
Nodule 7.76
Rhizoplane 2.04
Rhizosphere 69.8
Stem 0
Stem Tuber 0
Unclassified 8.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10006286 3300003215 Bacteria 6056
2 Ga0070683_100000596 3300005329 Bacteria 25920
3 Ga0070670_101170418 3300005331 Bacteria 702
4 Ga0070680_100047327 3300005336 Bacteria 3502
5 Ga0070680_100118809 3300005336 Bacteria 2205
6 Ga0070682_101141917 3300005337 Bacteria 654
7 Ga0068868_100514345 3300005338 Bacteria 1050
8 Ga0070660_100263771 3300005339 Bacteria 1407
9 Ga0070691_10015275 3300005341 Bacteria 3528
10 Ga0070691_10015582 3300005341 Bacteria 3492
11 Ga0070668_100051233 3300005347 Bacteria 3180
12 Ga0070668_100853323 3300005347 Bacteria 812
13 Ga0070675_101150635 3300005354 Bacteria 714
14 Ga0070671_100556963 3300005355 Bacteria 989
15 Ga0070674_100174706 3300005356 Bacteria 1640
16 Ga0070674_100943220 3300005356 Bacteria 754
17 Ga0070659_100267137 3300005366 Bacteria 1420
18 Ga0070714_101125578 3300005435 Bacteria 765
19 Ga0070710_10900081 3300005437 Bacteria 639
20 Ga0070705_100455198 3300005440 Bacteria 961
21 Ga0070663_100419233 3300005455 Bacteria 1098
22 Ga0070663_101750355 3300005455 Bacteria 556
23 Ga0070678_100088275 3300005456 Bacteria 2370
24 Ga0070662_101014670 3300005457 Bacteria 711
25 Ga0070681_10016000 3300005458 Bacteria 7479
26 Ga0070681_10036293 3300005458 Bacteria 4949
27 Ga0070681_10854577 3300005458 Bacteria 828
28 Ga0070681_11005033 3300005458 Bacteria 754
29 Ga0070685_10227167 3300005466 Bacteria 1226
30 Ga0070699_100688202 3300005518 Bacteria 934
31 Ga0070679_100060865 3300005530 Bacteria 3763
32 Ga0070679_100063994 3300005530 Bacteria 3665
33 Ga0070684_100033955 3300005535 Bacteria 4359
34 Ga0070684_100513306 3300005535 Bacteria 1110
35 Ga0070697_100115258 3300005536 Bacteria 2243
36 Ga0070693_100140233 3300005547 Bacteria 1521
37 Ga0070693_100181895 3300005547 Bacteria 1354
38 Ga0070665_100076802 3300005548 Bacteria 3347
39 Ga0070665_101931243 3300005548 Bacteria 596
40 Ga0068855_100208713 3300005563 Bacteria 2196
41 Ga0068855_100253968 3300005563 Bacteria 1960
42 Ga0068855_100932814 3300005563 Bacteria 915
43 Ga0070664_100278342 3300005564 Bacteria 1508
44 Ga0068857_100179444 3300005577 Bacteria 1927
45 Ga0068857_100250045 3300005577 Bacteria 1625
46 Ga0068854_100201189 3300005578 Bacteria 1566
47 Ga0068856_100084746 3300005614 Bacteria 3148
48 Ga0068856_102016988 3300005614 Bacteria 587
49 Ga0068852_100059005 3300005616 Bacteria 3326
50 Ga0081455_10008680 3300005937 Bacteria 10527
51 Ga0081540_1035669 3300005983 Bacteria 2663
52 Ga0081539_10022536 3300005985 Bacteria 4164
53 Ga0070717_11668042 3300006028 Bacteria 577
54 Ga0075365_10570286 3300006038 Bacteria 800
55 Ga0075368_10315324 3300006042 Bacteria 677
56 Ga0075367_10084780 3300006178 Bacteria 1922
57 Ga0075369_10029120 3300006186 Bacteria 2318
58 Ga0075369_10292561 3300006186 Bacteria 760
59 Ga0075436_100551544 3300006914 Bacteria 846
60 Ga0099794_10008959 3300007265 Bacteria 4176
61 Ga0099794_10048590 3300007265 Bacteria 2037
62 Ga0099794_10149694 3300007265 Bacteria 1184
63 Ga0099794_10193523 3300007265 Bacteria 1040
64 Ga0099795_10018077 3300007788 Bacteria 2259
65 Ga0099795_10153901 3300007788 Bacteria 944
66 Ga0105240_10050820 3300009093 Bacteria 5223
67 Ga0105240_11583661 3300009093 Bacteria 686
68 Ga0105243_11249969 3300009148 Bacteria 758
69 Ga0105241_10024416 3300009174 Bacteria 4488
70 Ga0105242_10734766 3300009176 Bacteria 970
71 Ga0105248_10132390 3300009177 Bacteria 2813
72 Ga0105237_10010048 3300009545 Bacteria 10094
73 Ga0105238_10226466 3300009551 Bacteria 1846
74 Ga0105249_12485789 3300009553 Bacteria 590
75 Ga0105239_10105028 3300010375 Bacteria 3128
76 Ga0105239_12799254 3300010375 Bacteria 569
77 Ga0157373_10400621 3300013100 Bacteria 983
78 Ga0157371_10158378 3300013102 Bacteria 1617
79 Ga0157369_10293837 3300013105 Bacteria 1691
80 Ga0157374_10284270 3300013296 Bacteria 1634
81 Ga0157372_10067540 3300013307 Bacteria 4017
82 Ga0157372_10501667 3300013307 Bacteria 1415
83 Ga0157375_11357549 3300013308 Bacteria 837
84 Ga0157380_10281843 3300014326 Bacteria 1521
85 Ga0157379_10024939 3300014968 Bacteria 5307
86 Ga0157379_10235431 3300014968 Bacteria 1660
87 Ga0157379_10546364 3300014968 Bacteria 1077
88 Ga0157376_10518901 3300014969 Bacteria 1174
89 Ga0157376_10790075 3300014969 Bacteria 961
90 Ga0163161_10450955 3300017792 Bacteria 1040
91 Ga0214544_1014740 3300021320 Bacteria 8563
92 Ga0214542_1012551 3300021321 Bacteria 10825
93 Ga0214545_1035134 3300021324 Bacteria 1679
94 Ga0213872_10054449 3300021361 Bacteria 1814
95 Ga0209758_1000626 3300025297 Bacteria 54157
96 Ga0209758_1001635 3300025297 Bacteria 25463
97 Ga0209758_1031417 3300025297 Bacteria 2178
98 Ga0207692_10335643 3300025898 Bacteria 928
99 Ga0207705_10192401 3300025909 Bacteria 1543
100 Ga0207707_10011825 3300025912 Bacteria 7589
101 Ga0207707_10400363 3300025912 Bacteria 1178
102 Ga0207695_10033447 3300025913 Bacteria 5606
103 Ga0207671_10036622 3300025914 Bacteria 3639
104 Ga0207671_10126924 3300025914 Bacteria 1955
105 Ga0207660_10006100 3300025917 Bacteria 7823
106 Ga0207660_10041729 3300025917 Bacteria 3217
107 Ga0207657_10522909 3300025919 Bacteria 928
108 Ga0207649_10424626 3300025920 Bacteria 999
109 Ga0207652_10012086 3300025921 Bacteria 6971
110 Ga0207652_10208308 3300025921 Bacteria 1760
111 Ga0207694_10144429 3300025924 Bacteria 1915
112 Ga0207659_10953678 3300025926 Bacteria 738
113 Ga0207664_10815944 3300025929 Bacteria 839
114 Ga0207690_10313921 3300025932 Bacteria 1230
115 Ga0207686_10086792 3300025934 Bacteria 2056
116 Ga0207669_10478191 3300025937 Bacteria 992
117 Ga0207691_10050233 3300025940 Bacteria 3818
118 Ga0207711_10017728 3300025941 Bacteria 5917
119 Ga0207661_10005037 3300025944 Bacteria 9268
120 Ga0207679_10129777 3300025945 Bacteria 2020
121 Ga0207667_10071894 3300025949 Bacteria 3596
122 Ga0207667_10479857 3300025949 Bacteria 1262
123 Ga0207667_11022379 3300025949 Bacteria 813
124 Ga0207658_11244112 3300025986 Bacteria 681
125 Ga0207677_10498489 3300026023 Bacteria 1052
126 Ga0207678_10154170 3300026067 Bacteria 1962
127 Ga0207678_10368381 3300026067 Bacteria 1241
128 Ga0207702_10034124 3300026078 Bacteria 4253
129 Ga0207702_12075222 3300026078 Bacteria 558
130 Ga0207674_10180090 3300026116 Bacteria 2065
131 Ga0207674_10281827 3300026116 Bacteria 1610
132 Ga0207675_100026820 3300026118 Bacteria 5362
133 Ga0207683_10067452 3300026121 Bacteria 3156
134 Ga0207698_10263525 3300026142 Bacteria 1584
135 Ga0209389_1000264 3300027296 Bacteria 33236
136 Ga0209489_110133 3300027361 Bacteria 10933
137 Ga0209179_1028211 3300027512 Bacteria 1136
138 Ga0209588_1003466 3300027671 Bacteria 4379
139 Ga0209588_1011271 3300027671 Bacteria 2699
140 Ga0209588_1188018 3300027671 Bacteria 647
141 Ga0209813_10351937 3300027866 Bacteria 583
142 Ga0268266_10055839 3300028379 Bacteria 3396
143 Ga0268266_11324507 3300028379 Bacteria 696
144 Ga0268266_11751903 3300028379 Bacteria 596
145 Ga0265334_10023700 3300028573 Bacteria 2494
146 Ga0307517_10000066 3300028786 Bacteria 141370
147 Ga0265340_10124954 3300031247 Bacteria 1182
148 Ga0307513_10165425 3300031456 Bacteria 2097
149 Ga0307509_10094145 3300031507 Bacteria 3055
150 Ga0307509_10309439 3300031507 Bacteria 1323
151 Ga0307508_10158925 3300031616 Bacteria 1864
152 Ga0307508_10175007 3300031616 Bacteria 1749
153 Ga0307516_10088935 3300031730 Bacteria 2920
154 Ga0307516_10433189 3300031730 Bacteria 972
155 Ga0307416_100714759 3300032002 Bacteria 1092
156 Ga0307411_10074164 3300032005 Bacteria 2318
157 Ga0307510_10062581 3300033180 Bacteria 3801
158 Ga0307510_10092205 3300033180 Bacteria 2867
159 Ga0373942_0046621 3300035207 Bacteria 1202
160 Ga0395900_0281616 3300037418 Bacteria 1654
161 Ga0395898_1093173 3300037466 Bacteria 731
162 Ga0395905_0652098 3300037471 Bacteria 955
163 Ga0395901_0053669 3300038443 Bacteria 4188
164 Ga0395901_0327359 3300038443 Bacteria 1585
165 Ga0436361_1007609 3300039447 Bacteria 3202
166 Ga0451837_0502283 3300041494 Bacteria 798
167 Ga0466972_0000186 3300044658 Bacteria 48162
168 Ga0466972_0011446 3300044658 Bacteria 4454
169 Ga0466965_0239068 3300044683 Bacteria 972
170 Ga0466961_0422558 3300044693 Bacteria 808
171 Ga0466968_0209228 3300044735 Bacteria 916
172 Ga0466970_0796272 3300044765 Bacteria 553
173 Ga0466957_1130130 3300044842 Bacteria 565
174 Ga0466960_0019327 3300044901 Bacteria 3000
175 Ga0466958_0401394 3300045836 Bacteria 885
176 Ga0495638_0002010 3300046460 Bacteria 17376
177 Ga0495650_0074474 3300046471 Bacteria 1324
178 Ga0495650_0082191 3300046471 Bacteria 1240
179 Ga0495605_0289825 3300046474 Bacteria 694
180 Ga0495596_0039273 3300046500 Bacteria 1870
181 Ga0495606_0294723 3300046507 Bacteria 881
182 Ga0495648_0201652 3300046524 Bacteria 995
183 Ga0495642_0227956 3300046528 Bacteria 814
184 Ga0495654_0197763 3300046530 Bacteria 862
185 Ga0495609_0090905 3300046538 Bacteria 1328
186 Ga0495622_0160328 3300046557 Bacteria 1015
187 Ga0495656_0104253 3300046615 Bacteria 1316
188 Ga0495611_0246106 3300046648 Bacteria 829
189 Ga0495661_0127972 3300046665 Bacteria 1395
190 Ga0495670_0134201 3300046691 Bacteria 1292
191 Ga0495636_0313480 3300047318 Bacteria 736
192 Ga0495672_0168732 3300047320 Bacteria 1118
193 Ga0495673_0164892 3300047469 Bacteria 848
194 Ga0495681_0059073 3300047470 Bacteria 1775
195 Ga0495626_0206307 3300048091 Bacteria 804
196 Ga0496100_0829576 3300048903 Bacteria 725
197 Ga0496103_0102914 3300048906 Bacteria 1809
198 Ga0496106_0561034 3300048909 Bacteria 916
199 Ga0496111_0047373 3300048914 Bacteria 3096
200 Ga0496115_0421209 3300048918 Bacteria 1082
201 Ga0496121_0084728 3300048924 Bacteria 2498
202 Ga0496124_0027881 3300048927 Bacteria 5059
203 Ga0496126_0354547 3300048929 Bacteria 1199
204 Ga0496126_0549388 3300048929 Bacteria 917
205 nmdc:mga03n38_569634_c1 3300050490 Bacteria 642
206 nmdc:mga06z11_194988_c1 3300050494 Bacteria 1174
207 nmdc:mga04h51_388910_c1 3300050495 Bacteria 582
208 nmdc:mga08x19_319063_c1 3300050514 Bacteria 1081
209 nmdc:mga0sz30_27071_c1 3300050516 Bacteria 2353
210 nmdc:mga0sz30_479490_c1 3300050516 Bacteria 559
211 Ga0495655_0090692 3300053083 Bacteria 890
212 Ga0500578_0311803 3300053086 Bacteria 930
213 Ga0500556_0059738 3300053104 Bacteria 1401
214 Ga0500569_033579 3300053109 Bacteria 1459
215 Ga0500572_000075 3300053111 Bacteria 31631
216 Ga0500595_002816 3300053119 Bacteria 8362
217 Ga0500595_053682 3300053119 Bacteria 1240
218 Ga0500559_0000075 3300053136 Bacteria 77303
219 Ga0500577_0457460 3300053142 Bacteria 558
220 Ga0500620_114001 3300053155 Bacteria 947
221 Ga0500622_0067287 3300053156 Bacteria 1817
222 Ga0500627_0145485 3300053158 Bacteria 1071
223 Ga0500634_0039274 3300053161 Bacteria 2573
224 Ga0500576_229545 3300053725 Bacteria 599
225 Ga0500596_001093 3300053735 Bacteria 5457
226 Ga0500599_000895 3300053736 Bacteria 3300

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0354547 Ga0496126_0354547_560_1027 123
2 3300006178 Ga0075367_10084780 Ga0075367_100847802 132
3 iso_pu_bacteria 2508501128 2509146523 132
4 iso_pu_bacteria 2513237141 2513892422 132
5 3300014968 Ga0157379_10546364 Ga0157379_105463642 133
6 3300035207 Ga0373942_0046621 Ga0373942_0046621_66_533 133
7 3300005347 Ga0070668_100051233 Ga0070668_1000512333 134
8 3300005457 Ga0070662_101014670 Ga0070662_1010146701 134
9 3300005466 Ga0070685_10227167 Ga0070685_102271672 134
10 3300009148 Ga0105243_11249969 Ga0105243_112499692 134
11 3300013296 Ga0157374_10284270 Ga0157374_102842702 134
12 3300014969 Ga0157376_10518901 Ga0157376_105189012 134
13 3300026067 Ga0207678_10154170 Ga0207678_101541701 134
14 3300032005 Ga0307411_10074164 Ga0307411_100741642 134
15 3300044658 Ga0466972_0000186 Ga0466972_0000186_16206_16688 134
16 3300044683 Ga0466965_0239068 Ga0466965_0239068_120_602 134
17 3300046471 Ga0495650_0074474 Ga0495650_0074474_834_1301 134
18 3300046474 Ga0495605_0289825 Ga0495605_0289825_189_656 134
19 3300046500 Ga0495596_0039273 Ga0495596_0039273_147_614 134
20 3300046538 Ga0495609_0090905 Ga0495609_0090905_411_878 134
21 3300046557 Ga0495622_0160328 Ga0495622_0160328_353_820 134
22 3300046648 Ga0495611_0246106 Ga0495611_0246106_256_723 134
23 3300046665 Ga0495661_0127972 Ga0495661_0127972_541_1008 134
24 3300046691 Ga0495670_0134201 Ga0495670_0134201_657_1124 134
25 3300047318 Ga0495636_0313480 Ga0495636_0313480_11_478 134
26 3300048903 Ga0496100_0829576 Ga0496100_0829576_59_526 134
27 3300048909 Ga0496106_0561034 Ga0496106_0561034_210_677 134
28 3300005548 Ga0070665_101931243 Ga0070665_1019312431 136
29 3300006914 Ga0075436_100551544 Ga0075436_1005515442 136
30 3300021361 Ga0213872_10054449 Ga0213872_100544492 136
31 3300028379 Ga0268266_11751903 Ga0268266_117519031 136
32 3300031507 Ga0307509_10094145 Ga0307509_100941453 136
33 3300031616 Ga0307508_10158925 Ga0307508_101589252 136
34 3300037466 Ga0395898_1093173 Ga0395898_1093173_46_510 136
35 3300038443 Ga0395901_0327359 Ga0395901_0327359_836_1300 136
36 3300039447 Ga0436361_1007609 Ga0436361_1007609_1853_2317 136
37 3300046528 Ga0495642_0227956 Ga0495642_0227956_183_650 136
38 3300046530 Ga0495654_0197763 Ga0495654_0197763_243_710 136
39 3300048091 Ga0495626_0206307 Ga0495626_0206307_22_489 136
40 3300050514 nmdc:mga08x19_319063_c1 nmdc:mga08x19_319063_c1_174_638 136
41 3300053109 Ga0500569_033579 Ga0500569_033579_225_692 136
42 3300053142 Ga0500577_0457460 Ga0500577_0457460_58_525 136
43 3300053158 Ga0500627_0145485 Ga0500627_0145485_248_715 136
44 3300053161 Ga0500634_0039274 Ga0500634_0039274_1122_1589 136
45 3300005329 Ga0070683_100000596 Ga0070683_1000005969 137
46 3300005331 Ga0070670_101170418 Ga0070670_1011704181 137
47 3300005336 Ga0070680_100047327 Ga0070680_1000473272 137
48 3300005336 Ga0070680_100118809 Ga0070680_1001188092 137
49 3300005337 Ga0070682_101141917 Ga0070682_1011419171 137
50 3300005338 Ga0068868_100514345 Ga0068868_1005143452 137
51 3300005339 Ga0070660_100263771 Ga0070660_1002637712 137
52 3300005341 Ga0070691_10015275 Ga0070691_100152751 137
53 3300005341 Ga0070691_10015582 Ga0070691_100155824 137
54 3300005347 Ga0070668_100853323 Ga0070668_1008533231 137
55 3300005354 Ga0070675_101150635 Ga0070675_1011506351 137
56 3300005355 Ga0070671_100556963 Ga0070671_1005569632 137
57 3300005356 Ga0070674_100174706 Ga0070674_1001747062 137
58 3300005356 Ga0070674_100943220 Ga0070674_1009432202 137
59 3300005366 Ga0070659_100267137 Ga0070659_1002671372 137
60 3300005435 Ga0070714_101125578 Ga0070714_1011255782 137
61 3300005440 Ga0070705_100455198 Ga0070705_1004551982 137
62 3300005455 Ga0070663_100419233 Ga0070663_1004192332 137
63 3300005455 Ga0070663_101750355 Ga0070663_1017503551 137
64 3300005456 Ga0070678_100088275 Ga0070678_1000882752 137
65 3300005458 Ga0070681_10016000 Ga0070681_100160002 137
66 3300005458 Ga0070681_10036293 Ga0070681_100362934 137
67 3300005458 Ga0070681_10854577 Ga0070681_108545771 137
68 3300005458 Ga0070681_11005033 Ga0070681_110050332 137
69 3300005518 Ga0070699_100688202 Ga0070699_1006882021 137
70 3300005530 Ga0070679_100060865 Ga0070679_1000608652 137
71 3300005530 Ga0070679_100063994 Ga0070679_1000639942 137
72 3300005535 Ga0070684_100033955 Ga0070684_1000339552 137
73 3300005535 Ga0070684_100513306 Ga0070684_1005133062 137
74 3300005536 Ga0070697_100115258 Ga0070697_1001152582 137
75 3300005547 Ga0070693_100140233 Ga0070693_1001402332 137
76 3300005547 Ga0070693_100181895 Ga0070693_1001818952 137
77 3300005548 Ga0070665_100076802 Ga0070665_1000768025 137
78 3300005563 Ga0068855_100208713 Ga0068855_1002087132 137
79 3300005563 Ga0068855_100253968 Ga0068855_1002539682 137
80 3300005563 Ga0068855_100932814 Ga0068855_1009328142 137
81 3300005564 Ga0070664_100278342 Ga0070664_1002783422 137
82 3300005577 Ga0068857_100179444 Ga0068857_1001794442 137
83 3300005577 Ga0068857_100250045 Ga0068857_1002500452 137
84 3300005578 Ga0068854_100201189 Ga0068854_1002011892 137
85 3300005614 Ga0068856_100084746 Ga0068856_1000847464 137
86 3300005614 Ga0068856_102016988 Ga0068856_1020169882 137
87 3300005616 Ga0068852_100059005 Ga0068852_1000590052 137
88 3300005937 Ga0081455_10008680 Ga0081455_100086805 137
89 3300006028 Ga0070717_11668042 Ga0070717_116680421 137
90 3300006042 Ga0075368_10315324 Ga0075368_103153242 137
91 3300006186 Ga0075369_10029120 Ga0075369_100291202 137
92 3300006186 Ga0075369_10292561 Ga0075369_102925612 137
93 3300007265 Ga0099794_10008959 Ga0099794_100089593 137
94 3300007265 Ga0099794_10048590 Ga0099794_100485901 137
95 3300007265 Ga0099794_10149694 Ga0099794_101496942 137
96 3300007265 Ga0099794_10193523 Ga0099794_101935232 137
97 3300007788 Ga0099795_10018077 Ga0099795_100180773 137
98 3300007788 Ga0099795_10153901 Ga0099795_101539012 137
99 3300009093 Ga0105240_10050820 Ga0105240_100508204 137
100 3300009093 Ga0105240_11583661 Ga0105240_115836612 137
101 3300009176 Ga0105242_10734766 Ga0105242_107347662 137
102 3300009177 Ga0105248_10132390 Ga0105248_101323902 137
103 3300009545 Ga0105237_10010048 Ga0105237_100100482 137
104 3300009551 Ga0105238_10226466 Ga0105238_102264662 137
105 3300009553 Ga0105249_12485789 Ga0105249_124857892 137
106 3300010375 Ga0105239_10105028 Ga0105239_101050284 137
107 3300010375 Ga0105239_12799254 Ga0105239_127992541 137
108 3300013100 Ga0157373_10400621 Ga0157373_104006211 137
109 3300013102 Ga0157371_10158378 Ga0157371_101583781 137
110 3300013105 Ga0157369_10293837 Ga0157369_102938371 137
111 3300013307 Ga0157372_10067540 Ga0157372_100675402 137
112 3300013307 Ga0157372_10501667 Ga0157372_105016671 137
113 3300013308 Ga0157375_11357549 Ga0157375_113575491 137
114 3300014326 Ga0157380_10281843 Ga0157380_102818432 137
115 3300014968 Ga0157379_10024939 Ga0157379_100249392 137
116 3300014968 Ga0157379_10235431 Ga0157379_102354312 137
117 3300014969 Ga0157376_10790075 Ga0157376_107900752 137
118 3300017792 Ga0163161_10450955 Ga0163161_104509552 137
119 3300025297 Ga0209758_1001635 Ga0209758_100163518 137
120 3300025297 Ga0209758_1031417 Ga0209758_10314172 137
121 3300025909 Ga0207705_10192401 Ga0207705_101924012 137
122 3300025912 Ga0207707_10011825 Ga0207707_100118255 137
123 3300025912 Ga0207707_10400363 Ga0207707_104003632 137
124 3300025913 Ga0207695_10033447 Ga0207695_100334473 137
125 3300025914 Ga0207671_10036622 Ga0207671_100366223 137
126 3300025917 Ga0207660_10006100 Ga0207660_100061002 137
127 3300025917 Ga0207660_10041729 Ga0207660_100417292 137
128 3300025919 Ga0207657_10522909 Ga0207657_105229091 137
129 3300025920 Ga0207649_10424626 Ga0207649_104246262 137
130 3300025921 Ga0207652_10012086 Ga0207652_100120864 137
131 3300025921 Ga0207652_10208308 Ga0207652_102083082 137
132 3300025924 Ga0207694_10144429 Ga0207694_101444292 137
133 3300025926 Ga0207659_10953678 Ga0207659_109536782 137
134 3300025929 Ga0207664_10815944 Ga0207664_108159442 137
135 3300025932 Ga0207690_10313921 Ga0207690_103139212 137
136 3300025934 Ga0207686_10086792 Ga0207686_100867923 137
137 3300025937 Ga0207669_10478191 Ga0207669_104781911 137
138 3300025940 Ga0207691_10050233 Ga0207691_100502332 137
139 3300025941 Ga0207711_10017728 Ga0207711_100177284 137
140 3300025944 Ga0207661_10005037 Ga0207661_1000503710 137
141 3300025945 Ga0207679_10129777 Ga0207679_101297773 137
142 3300025949 Ga0207667_10071894 Ga0207667_100718941 137
143 3300025949 Ga0207667_10479857 Ga0207667_104798572 137
144 3300025949 Ga0207667_11022379 Ga0207667_110223792 137
145 3300025986 Ga0207658_11244112 Ga0207658_112441121 137
146 3300026023 Ga0207677_10498489 Ga0207677_104984892 137
147 3300026067 Ga0207678_10368381 Ga0207678_103683812 137
148 3300026078 Ga0207702_10034124 Ga0207702_100341242 137
149 3300026078 Ga0207702_12075222 Ga0207702_120752221 137
150 3300026116 Ga0207674_10180090 Ga0207674_101800902 137
151 3300026116 Ga0207674_10281827 Ga0207674_102818272 137
152 3300026118 Ga0207675_100026820 Ga0207675_1000268203 137
153 3300026121 Ga0207683_10067452 Ga0207683_100674522 137
154 3300026142 Ga0207698_10263525 Ga0207698_102635252 137
155 3300027512 Ga0209179_1028211 Ga0209179_10282111 137
156 3300027671 Ga0209588_1003466 Ga0209588_10034665 137
157 3300027671 Ga0209588_1011271 Ga0209588_10112712 137
158 3300027671 Ga0209588_1188018 Ga0209588_11880182 137
159 3300027866 Ga0209813_10351937 Ga0209813_103519371 137
160 3300028379 Ga0268266_10055839 Ga0268266_100558394 137
161 3300028379 Ga0268266_11324507 Ga0268266_113245072 137
162 3300028573 Ga0265334_10023700 Ga0265334_100237002 137
163 3300028786 Ga0307517_10000066 Ga0307517_10000066120 137
164 3300031247 Ga0265340_10124954 Ga0265340_101249541 137
165 3300031456 Ga0307513_10165425 Ga0307513_101654252 137
166 3300031507 Ga0307509_10309439 Ga0307509_103094392 137
167 3300031616 Ga0307508_10175007 Ga0307508_101750072 137
168 3300031730 Ga0307516_10088935 Ga0307516_100889352 137
169 3300031730 Ga0307516_10433189 Ga0307516_104331892 137
170 3300033180 Ga0307510_10092205 Ga0307510_100922052 137
171 3300037418 Ga0395900_0281616 Ga0395900_0281616_1066_1533 137
172 3300037471 Ga0395905_0652098 Ga0395905_0652098_363_830 137
173 3300038443 Ga0395901_0053669 Ga0395901_0053669_884_1351 137
174 3300041494 Ga0451837_0502283 Ga0451837_0502283_60_527 137
175 3300045836 Ga0466958_0401394 Ga0466958_0401394_258_725 137
176 3300046615 Ga0495656_0104253 Ga0495656_0104253_265_732 137
177 3300047320 Ga0495672_0168732 Ga0495672_0168732_337_804 137
178 3300047469 Ga0495673_0164892 Ga0495673_0164892_27_497 137
179 3300047470 Ga0495681_0059073 Ga0495681_0059073_1206_1673 137
180 3300048906 Ga0496103_0102914 Ga0496103_0102914_124_591 137
181 3300048914 Ga0496111_0047373 Ga0496111_0047373_2510_2977 137
182 3300048918 Ga0496115_0421209 Ga0496115_0421209_47_514 137
183 3300048924 Ga0496121_0084728 Ga0496121_0084728_195_662 137
184 3300048927 Ga0496124_0027881 Ga0496124_0027881_4477_4944 137
185 3300048929 Ga0496126_0549388 Ga0496126_0549388_83_550 137
186 3300050490 nmdc:mga03n38_569634_c1 nmdc:mga03n38_569634_c1_150_617 137
187 3300050494 nmdc:mga06z11_194988_c1 nmdc:mga06z11_194988_c1_21_488 137
188 3300050495 nmdc:mga04h51_388910_c1 nmdc:mga04h51_388910_c1_66_533 137
189 3300050516 nmdc:mga0sz30_27071_c1 nmdc:mga0sz30_27071_c1_1094_1561 137
190 3300050516 nmdc:mga0sz30_479490_c1 nmdc:mga0sz30_479490_c1_28_495 137
191 3300053083 Ga0495655_0090692 Ga0495655_0090692_412_879 137
192 3300053119 Ga0500595_002816 Ga0500595_002816_6795_7262 137
193 3300053119 Ga0500595_053682 Ga0500595_053682_243_710 137
194 3300053155 Ga0500620_114001 Ga0500620_114001_330_797 137
195 iso_pu_bacteria 2507262055 2507508733 138
196 iso_pu_bacteria 2513237092 2513623180 138
197 iso_pu_bacteria 2791355196 2793064258 138
198 iso_pu_bacteria 2847930680 2847936075 138
199 iso_pu_bacteria 2879083081 2879090053 138
200 iso_pu_bacteria 2881364244 2881367080 138
201 iso_pu_bacteria 2885409591 2885416289 138
202 iso_pu_bacteria 2906643746 2906648581 138
203 iso_pu_bacteria 2935769743 2935773156 138
204 iso_pu_bacteria 2935785616 2935790479 138
205 iso_pu_bacteria 2935793552 2935798208 138
206 iso_pu_bacteria 2935959822 2935966339 138
207 iso_pu_bacteria 2935984226 2935988319 138
208 iso_pu_bacteria 8016622563 8016626689 138
209 iso_pu_bacteria 8019547302 8019553803 138
210 iso_pu_bacteria 8056673599 8056674113 138
211 3300027296 Ga0209389_1000264 Ga0209389_100026410 140
212 3300027361 Ga0209489_110133 Ga0209489_11013310 140
213 3300003215 JGI25153J46596_10006286 JGI25153J46596_100062862 142
214 3300005437 Ga0070710_10900081 Ga0070710_109000811 142
215 3300005983 Ga0081540_1035669 Ga0081540_10356692 142
216 3300005985 Ga0081539_10022536 Ga0081539_100225363 142
217 3300006038 Ga0075365_10570286 Ga0075365_105702862 142
218 3300009174 Ga0105241_10024416 Ga0105241_100244162 142
219 3300021320 Ga0214544_1014740 Ga0214544_101474010 142
220 3300021321 Ga0214542_1012551 Ga0214542_101255110 142
221 3300021324 Ga0214545_1035134 Ga0214545_10351342 142
222 3300025297 Ga0209758_1000626 Ga0209758_100062616 142
223 3300025898 Ga0207692_10335643 Ga0207692_103356432 142
224 3300025914 Ga0207671_10126924 Ga0207671_101269242 142
225 3300032002 Ga0307416_100714759 Ga0307416_1007147592 142
226 3300033180 Ga0307510_10062581 Ga0307510_100625811 142
227 3300044658 Ga0466972_0011446 Ga0466972_0011446_2328_2810 142
228 3300044693 Ga0466961_0422558 Ga0466961_0422558_155_637 142
229 3300044735 Ga0466968_0209228 Ga0466968_0209228_283_765 142
230 3300044765 Ga0466970_0796272 Ga0466970_0796272_26_508 142
231 3300044842 Ga0466957_1130130 Ga0466957_1130130_34_516 142
232 3300044901 Ga0466960_0019327 Ga0466960_0019327_2163_2645 142
233 3300046460 Ga0495638_0002010 Ga0495638_0002010_7554_8036 142
234 3300046471 Ga0495650_0082191 Ga0495650_0082191_97_579 142
235 3300046507 Ga0495606_0294723 Ga0495606_0294723_306_788 142
236 3300046524 Ga0495648_0201652 Ga0495648_0201652_209_691 142
237 3300053086 Ga0500578_0311803 Ga0500578_0311803_44_526 142
238 3300053104 Ga0500556_0059738 Ga0500556_0059738_600_1082 142
239 3300053111 Ga0500572_000075 Ga0500572_000075_10958_11440 142
240 3300053136 Ga0500559_0000075 Ga0500559_0000075_18846_19328 142
241 3300053156 Ga0500622_0067287 Ga0500622_0067287_332_814 142
242 3300053725 Ga0500576_229545 Ga0500576_229545_19_501 142
243 3300053735 Ga0500596_001093 Ga0500596_001093_4868_5350 142
244 3300053736 Ga0500599_000895 Ga0500599_000895_655_1137 142
245 iso_pu_bacteria 2508501042 2508691414 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07331

TctB

Tripartite tricarboxylate transporter TctB family

27

166

0.78

Feature Viewer

pLDDT pTM Quality
74.47 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map