F357163

General Info

Members Datasets Scaffolds Average Seq Length
245 184 490 170

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100017965|Ga0070706_1000179657
Length 187
Sequence MAQFPVNSTRLDPYKNFKFRVKWASQPGGPLQYVAGISKVSGLKRTTEVVKHRDGGDESSSRKSPGRTEYDPITLERGVTQDTEFEQWANKVWDYNNAQAPADQRTMEVSLADFRKEIIIDVFNEAGQKVLSYQVYRCWVSEYQALPDLDANANAIAIQHIKLENEGWMRDPSVKEQPEPSFTDPAP

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
97 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
102 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
108 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
109 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
130 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
131 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
132 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
133 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
134 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
135 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
136 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
145 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
174 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
175 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
176 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
177 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
178 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 2862574272 Streptomyces sp. AcE210 Isolate Nodule
180 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
181 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
182 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
183 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
184 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.33
Metatranscriptomes 1.22
Isolates 2.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.67
Nodule 0.41
Rhizoplane 2.04
Rhizosphere 87.76
Stem 0
Stem Tuber 0
Unclassified 2.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100017965 3300005467 Bacteria 6525
2 MBSR1b_contig_9352151 2162886012 Bacteria 13257
3 JGI24735J21928_10067412 3300002067 Bacteria 1026
4 JGI25406J46586_10001263 3300003203 Bacteria 11868
5 JGI25406J46586_10046961 3300003203 Bacteria 1475
6 Ga0055530_10000182 3300003791 Bacteria 56371
7 Ga0055531_10000165 3300003794 Bacteria 74768
8 Ga0065715_10000421 3300005293 Bacteria 13595
9 Ga0065715_10089042 3300005293 Bacteria 15803
10 Ga0065707_10153938 3300005295 Bacteria 1628
11 Ga0065707_10367995 3300005295 Bacteria 894
12 Ga0070683_100492979 3300005329 Bacteria 1170
13 Ga0070690_100232690 3300005330 Bacteria 1296
14 Ga0070692_10000125 3300005345 Bacteria 18001
15 Ga0070692_10389217 3300005345 Bacteria 877
16 Ga0070668_100039656 3300005347 Bacteria 3601
17 Ga0070668_100242176 3300005347 Bacteria 1494
18 Ga0070669_100033767 3300005353 Bacteria 3702
19 Ga0070669_100385314 3300005353 Bacteria 1144
20 Ga0070667_100094207 3300005367 Bacteria 2580
21 Ga0070667_100633133 3300005367 Bacteria 987
22 Ga0070703_10000136 3300005406 Bacteria 37632
23 Ga0070714_100000609 3300005435 Bacteria 25568
24 Ga0070714_100065707 3300005435 Bacteria 3125
25 Ga0070714_100142640 3300005435 Bacteria 2152
26 Ga0070714_100725504 3300005435 Bacteria 960
27 Ga0070713_100024800 3300005436 Bacteria 4679
28 Ga0070713_100521263 3300005436 Bacteria 1123
29 Ga0070710_10035980 3300005437 Bacteria 2704
30 Ga0070710_10572416 3300005437 Bacteria 783
31 Ga0070711_100118164 3300005439 Unclassified 1956
32 Ga0070711_100340206 3300005439 Bacteria 1204
33 Ga0070700_100067537 3300005441 Bacteria 2271
34 Ga0070694_100000339 3300005444 Bacteria 25087
35 Ga0070694_100485704 3300005444 Bacteria 981
36 Ga0070708_100009844 3300005445 Bacteria 7721
37 Ga0070662_100130916 3300005457 Bacteria 1934
38 Ga0070681_10450422 3300005458 Bacteria 1199
39 Ga0070706_100010058 3300005467 Bacteria 8786
40 Ga0070706_100080878 3300005467 Bacteria 3009
41 Ga0070706_100294376 3300005467 Bacteria 1515
42 Ga0070698_100023733 3300005471 Bacteria 6408
43 Ga0070698_100437568 3300005471 Bacteria 1243
44 Ga0070699_100061310 3300005518 Bacteria 3260
45 Ga0070684_100654977 3300005535 Bacteria 978
46 Ga0070684_101016290 3300005535 Bacteria 778
47 Ga0070697_100000013 3300005536 Bacteria 148364
48 Ga0070695_100000412 3300005545 Bacteria 22118
49 Ga0070695_100455939 3300005545 Bacteria 981
50 Ga0070696_100028220 3300005546 Bacteria 3829
51 Ga0070693_100258786 3300005547 Bacteria 1157
52 Ga0070704_100001842 3300005549 Bacteria 11691
53 Ga0070704_100453098 3300005549 Bacteria 1105
54 Ga0068852_100156545 3300005616 Bacteria 2123
55 Ga0068852_101772504 3300005616 Bacteria 640
56 Ga0068860_100057251 3300005843 Bacteria 3705
57 Ga0068862_100124454 3300005844 Bacteria 2275
58 Ga0081540_1173978 3300005983 Bacteria 815
59 Ga0081539_10000369 3300005985 Bacteria 98527
60 Ga0081539_10000828 3300005985 Bacteria 59752
61 Ga0081539_10002128 3300005985 Bacteria 29268
62 Ga0070717_10008750 3300006028 Bacteria 7576
63 Ga0070717_10168855 3300006028 Bacteria 1902
64 Ga0070717_10519883 3300006028 Bacteria 1077
65 Ga0070716_100343391 3300006173 Bacteria 1054
66 Ga0070712_100114047 3300006175 Unclassified 2022
67 Ga0070712_100749684 3300006175 Bacteria 835
68 Ga0070712_101018125 3300006175 Bacteria 717
69 Ga0075430_100531983 3300006846 Bacteria 969
70 Ga0075431_100006373 3300006847 Bacteria 11712
71 Ga0075431_100138016 3300006847 Bacteria 2514
72 Ga0075433_10284301 3300006852 Bacteria 1465
73 Ga0075434_100718697 3300006871 Bacteria 1016
74 Ga0075429_100308610 3300006880 Bacteria 1385
75 Ga0075435_100265014 3300007076 Bacteria 1464
76 Ga0105240_10004286 3300009093 Bacteria 21797
77 Ga0105245_10000791 3300009098 Bacteria 28716
78 Ga0105245_10728913 3300009098 Bacteria 1026
79 Ga0105247_11252496 3300009101 Bacteria 593
80 Ga0114129_10007917 3300009147 Bacteria 15130
81 Ga0114129_10347831 3300009147 Bacteria 1965
82 Ga0105243_10010985 3300009148 Bacteria 6846
83 Ga0105243_10236572 3300009148 Bacteria 1623
84 Ga0105241_10271413 3300009174 Bacteria 1445
85 Ga0105242_10173688 3300009176 Bacteria 1895
86 Ga0105242_11981216 3300009176 Bacteria 624
87 Ga0105237_10253973 3300009545 Bacteria 1760
88 Ga0105238_10207347 3300009551 Bacteria 1936
89 Ga0105238_10646077 3300009551 Bacteria 1068
90 Ga0105249_10169599 3300009553 Bacteria 2115
91 Ga0105239_10777040 3300010375 Bacteria 1097
92 Ga0157374_10536440 3300013296 Bacteria 1177
93 Ga0157374_10768671 3300013296 Bacteria 978
94 Ga0157378_10123349 3300013297 Bacteria 2390
95 Ga0157378_10355631 3300013297 Bacteria 1432
96 Ga0163162_10111111 3300013306 Bacteria 2838
97 Ga0163162_10679721 3300013306 Bacteria 1152
98 Ga0157375_11783233 3300013308 Bacteria 729
99 Ga0183367_1011 3300015688 Bacteria 397353
100 Ga0209050_1000010 3300025298 Bacteria 980454
101 Ga0209257_1000027 3300025304 Bacteria 703541
102 Ga0207653_10000127 3300025885 Bacteria 54235
103 Ga0207692_10015635 3300025898 Bacteria 3344
104 Ga0207692_10443178 3300025898 Bacteria 816
105 Ga0207688_10317184 3300025901 Bacteria 956
106 Ga0207699_10016295 3300025906 Bacteria 3884
107 Ga0207699_10100227 3300025906 Bacteria 1837
108 Ga0207645_10021019 3300025907 Bacteria 4262
109 Ga0207684_10006216 3300025910 Bacteria 10904
110 Ga0207684_10011876 3300025910 Bacteria 7591
111 Ga0207684_10150836 3300025910 Bacteria 2000
112 Ga0207684_10195874 3300025910 Bacteria 1743
113 Ga0207684_10406998 3300025910 Bacteria 1169
114 Ga0207654_10067075 3300025911 Bacteria 2118
115 Ga0207695_10004956 3300025913 Bacteria 17927
116 Ga0207671_10275794 3300025914 Bacteria 1325
117 Ga0207693_10025070 3300025915 Bacteria 4730
118 Ga0207693_10026514 3300025915 Unclassified 4586
119 Ga0207663_10084711 3300025916 Bacteria 2085
120 Ga0207663_10313837 3300025916 Bacteria 1176
121 Ga0207660_10546551 3300025917 Bacteria 942
122 Ga0207681_10514272 3300025923 Bacteria 982
123 Ga0207681_11043106 3300025923 Bacteria 686
124 Ga0207694_10384964 3300025924 Bacteria 1164
125 Ga0207687_10001630 3300025927 Bacteria 15468
126 Ga0207687_10323070 3300025927 Bacteria 1250
127 Ga0207700_10014398 3300025928 Bacteria 5181
128 Ga0207700_10322933 3300025928 Bacteria 1338
129 Ga0207664_10013654 3300025929 Bacteria 5837
130 Ga0207664_10144654 3300025929 Bacteria 2015
131 Ga0207664_10870457 3300025929 Bacteria 809
132 Ga0207706_10298060 3300025933 Bacteria 1405
133 Ga0207686_11185568 3300025934 Bacteria 625
134 Ga0207709_10008691 3300025935 Bacteria 5605
135 Ga0207669_10863763 3300025937 Bacteria 754
136 Ga0207704_10955293 3300025938 Bacteria 723
137 Ga0207668_10211021 3300025972 Bacteria 1553
138 Ga0207658_10067057 3300025986 Bacteria 2702
139 Ga0207658_10246670 3300025986 Bacteria 1516
140 Ga0207698_10065521 3300026142 Bacteria 2854
141 Ga0207428_10093503 3300027907 Bacteria 2332
142 Ga0307515_10342163 3300028794 Bacteria 1147
143 Ga0265768_104196 3300030963 Bacteria 804
144 Ga0265331_10000182 3300031250 Bacteria 76975
145 Ga0265327_10240385 3300031251 Bacteria 809
146 Ga0307509_10297308 3300031507 Bacteria 1365
147 Ga0316575_10043872 3300031665 Bacteria 1773
148 Ga0316579_10022212 3300031691 Bacteria 2836
149 Ga0316576_10020586 3300031727 Bacteria 4546
150 Ga0316576_10110649 3300031727 Bacteria 2059
151 Ga0316578_10021859 3300031728 Bacteria 3556
152 Ga0307516_10002372 3300031730 Bacteria 25244
153 Ga0316577_10019929 3300031733 Bacteria 3715
154 Ga0307518_10196400 3300031838 Bacteria 1346
155 Ga0307407_10288745 3300031903 Bacteria 1139
156 Ga0307412_10000138 3300031911 Bacteria 53149
157 Ga0307409_100392623 3300031995 Bacteria 1323
158 Ga0307411_10099835 3300032005 Bacteria 2050
159 Ga0316583_10087292 3300032133 Bacteria 1089
160 Ga0316580_10065303 3300032139 Bacteria 1116
161 Ga0316593_10006869 3300032168 Bacteria 3097
162 Ga0307510_10297909 3300033180 Bacteria 1076
163 Ga0373945_0095150 3300035116 Bacteria 1159
164 Ga0373955_0043649 3300035172 Bacteria 2412
165 Ga0316574_0139539 3300035398 Bacteria 1561
166 Ga0373931_0169256 3300035691 Bacteria 1286
167 Ga0373935_0073035 3300035692 Bacteria 2216
168 Ga0373933_0591004 3300035724 Bacteria 729
169 Ga0373933_0615970 3300035724 Bacteria 713
170 Ga0373947_0139989 3300035725 Bacteria 1551
171 Ga0316582_0006093 3300036647 Bacteria 6292
172 Ga0316584_0019940 3300036712 Bacteria 4853
173 Ga0316584_0248260 3300036712 Bacteria 1301
174 Ga0373925_0074977 3300037068 Bacteria 2563
175 Ga0373925_0536496 3300037068 Bacteria 962
176 Ga0395905_0021757 3300037471 Bacteria 6065
177 Ga0395905_0665058 3300037471 Bacteria 944
178 Ga0316581_0037526 3300037588 Bacteria 1472
179 Ga0436364_0764643 3300037853 Bacteria 844
180 Ga0436364_1302042 3300037853 Bacteria 6644
181 Ga0395901_0622296 3300038443 Bacteria 1086
182 Ga0436365_0520921 3300039437 Bacteria 2242
183 Ga0436361_0262064 3300039447 Bacteria 1020
184 Ga0451791_0351726 3300041451 Bacteria 626
185 Ga0451853_1673435 3300041512 Bacteria 4664
186 Ga0439431_0026689 3300041997 Bacteria 1416
187 Ga0439433_0159873 3300041999 Bacteria 583
188 Ga0439448_0071610 3300042005 Bacteria 1155
189 Ga0439450_011161 3300042008 Bacteria 1752
190 Ga0439463_002305 3300042016 Bacteria 4880
191 Ga0450902_047389 3300042137 Bacteria 735
192 Ga0439464_0006250 3300042439 Bacteria 3099
193 Ga0439460_0018113 3300042461 Bacteria 1893
194 Ga0451577_0000083 3300042876 Bacteria 213999
195 Ga0453684_0000533 3300044712 Bacteria 144782
196 Ga0451576_0381546 3300045051 Bacteria 1477
197 Ga0466958_0410492 3300045836 Bacteria 875
198 Ga0466967_0374096 3300045976 Bacteria 1382
199 Ga0466967_0531129 3300045976 Bacteria 1157
200 Ga0495629_0152402 3300046459 Bacteria 1607
201 Ga0495664_0359552 3300046477 Unclassified 876
202 Ga0495584_0048770 3300046491 Bacteria 2134
203 Ga0495585_0000166 3300046492 Bacteria 71084
204 Ga0495594_0513333 3300046499 Bacteria 680
205 Ga0495631_0194427 3300046518 Bacteria 868
206 Ga0495643_0065526 3300046522 Viruses 1918
207 Ga0495665_0183130 3300046531 Bacteria 1088
208 Ga0495586_0029235 3300046535 Bacteria 2949
209 Ga0495657_0205644 3300046675 Bacteria 1198
210 Ga0495599_0273540 3300046678 Bacteria 1024
211 Ga0495670_0233669 3300046691 Bacteria 978
212 Ga0495649_0379079 3300046694 Bacteria 712
213 Ga0495581_0007088 3300047315 Bacteria 6490
214 Ga0495674_0033637 3300047319 Bacteria 4642
215 Ga0495676_0005419 3300047321 Bacteria 11700
216 Ga0495684_0166312 3300047471 Bacteria 1642
217 Ga0495593_0584391 3300047673 Bacteria 561
218 Ga0496104_1051741 3300048907 Bacteria 718
219 Ga0496104_1066417 3300048907 Bacteria 712
220 Ga0496109_0257748 3300048912 Bacteria 1643
221 Ga0496111_0709521 3300048914 Bacteria 731
222 Ga0496120_0042463 3300048923 Bacteria 2655
223 Ga0496124_0000043 3300048927 Bacteria 300907
224 Ga0496126_0106888 3300048929 Bacteria 2441
225 nmdc:mga05p37_407717_c1 3300050507 Bacteria 1585
226 nmdc:mga05p37_994_c1 3300050507 Bacteria 32344
227 nmdc:mga09592_89135_c1 3300050508 Bacteria 2635
228 nmdc:mga06r32_117447_c1 3300050510 Bacteria 2622
229 nmdc:mga06r32_4792_c1 3300050510 Bacteria 12170
230 nmdc:mga08y16_76871_c1 3300050511 Bacteria 3480
231 nmdc:mga0n895_276418_c1 3300050512 Bacteria 1703
232 nmdc:mga0rr50_64022_c1 3300050513 Bacteria 2779
233 nmdc:mga0a205_204283_c1 3300050515 Bacteria 1865
234 Ga0500608_205180 3300053122 Bacteria 811
235 Ga0500618_000071 3300053125 Bacteria 85596
236 Ga0500658_0146372 3300053134 Bacteria 1063
237 Ga0500568_0010804 3300053139 Bacteria 4259
238 Ga0500604_0010769 3300053151 Unclassified 2449
239 Ga0587084_068235 3300059477 Bacteria 666
240 2862575952 2862574272 Bacteria 10567477
241 2866615748 2866612099 Bacteria 7543886
242 2870628089 2870628048 Bacteria 3696012
243 2899367536 2899359706 Bacteria 10940472
244 8006927031 8006926726 Bacteria 6749210
245 8025480455 8025478263 Bacteria 8209203
246 Ga0070706_100017965
247 MBSR1b_contig_9352151
248 JGI24735J21928_10067412
249 JGI25406J46586_10001263
250 JGI25406J46586_10046961
251 Ga0055530_10000182
252 Ga0055531_10000165
253 Ga0065715_10000421
254 Ga0065715_10089042
255 Ga0065707_10153938
256 Ga0065707_10367995
257 Ga0070683_100492979
258 Ga0070690_100232690
259 Ga0070692_10000125
260 Ga0070692_10389217
261 Ga0070668_100039656
262 Ga0070668_100242176
263 Ga0070669_100033767
264 Ga0070669_100385314
265 Ga0070667_100094207
266 Ga0070667_100633133
267 Ga0070703_10000136
268 Ga0070714_100000609
269 Ga0070714_100065707
270 Ga0070714_100142640
271 Ga0070714_100725504
272 Ga0070713_100024800
273 Ga0070713_100521263
274 Ga0070710_10035980
275 Ga0070710_10572416
276 Ga0070711_100118164
277 Ga0070711_100340206
278 Ga0070700_100067537
279 Ga0070694_100000339
280 Ga0070694_100485704
281 Ga0070708_100009844
282 Ga0070662_100130916
283 Ga0070681_10450422
284 Ga0070706_100010058
285 Ga0070706_100080878
286 Ga0070706_100294376
287 Ga0070698_100023733
288 Ga0070698_100437568
289 Ga0070699_100061310
290 Ga0070684_100654977
291 Ga0070684_101016290
292 Ga0070697_100000013
293 Ga0070695_100000412
294 Ga0070695_100455939
295 Ga0070696_100028220
296 Ga0070693_100258786
297 Ga0070704_100001842
298 Ga0070704_100453098
299 Ga0068852_100156545
300 Ga0068852_101772504
301 Ga0068860_100057251
302 Ga0068862_100124454
303 Ga0081540_1173978
304 Ga0081539_10000369
305 Ga0081539_10000828
306 Ga0081539_10002128
307 Ga0070717_10008750
308 Ga0070717_10168855
309 Ga0070717_10519883
310 Ga0070716_100343391
311 Ga0070712_100114047
312 Ga0070712_100749684
313 Ga0070712_101018125
314 Ga0075430_100531983
315 Ga0075431_100006373
316 Ga0075431_100138016
317 Ga0075433_10284301
318 Ga0075434_100718697
319 Ga0075429_100308610
320 Ga0075435_100265014
321 Ga0105240_10004286
322 Ga0105245_10000791
323 Ga0105245_10728913
324 Ga0105247_11252496
325 Ga0114129_10007917
326 Ga0114129_10347831
327 Ga0105243_10010985
328 Ga0105243_10236572
329 Ga0105241_10271413
330 Ga0105242_10173688
331 Ga0105242_11981216
332 Ga0105237_10253973
333 Ga0105238_10207347
334 Ga0105238_10646077
335 Ga0105249_10169599
336 Ga0105239_10777040
337 Ga0157374_10536440
338 Ga0157374_10768671
339 Ga0157378_10123349
340 Ga0157378_10355631
341 Ga0163162_10111111
342 Ga0163162_10679721
343 Ga0157375_11783233
344 Ga0183367_1011
345 Ga0209050_1000010
346 Ga0209257_1000027
347 Ga0207653_10000127
348 Ga0207692_10015635
349 Ga0207692_10443178
350 Ga0207688_10317184
351 Ga0207699_10016295
352 Ga0207699_10100227
353 Ga0207645_10021019
354 Ga0207684_10006216
355 Ga0207684_10011876
356 Ga0207684_10150836
357 Ga0207684_10195874
358 Ga0207684_10406998
359 Ga0207654_10067075
360 Ga0207695_10004956
361 Ga0207671_10275794
362 Ga0207693_10025070
363 Ga0207693_10026514
364 Ga0207663_10084711
365 Ga0207663_10313837
366 Ga0207660_10546551
367 Ga0207681_10514272
368 Ga0207681_11043106
369 Ga0207694_10384964
370 Ga0207687_10001630
371 Ga0207687_10323070
372 Ga0207700_10014398
373 Ga0207700_10322933
374 Ga0207664_10013654
375 Ga0207664_10144654
376 Ga0207664_10870457
377 Ga0207706_10298060
378 Ga0207686_11185568
379 Ga0207709_10008691
380 Ga0207669_10863763
381 Ga0207704_10955293
382 Ga0207668_10211021
383 Ga0207658_10067057
384 Ga0207658_10246670
385 Ga0207698_10065521
386 Ga0207428_10093503
387 Ga0307515_10342163
388 Ga0265768_104196
389 Ga0265331_10000182
390 Ga0265327_10240385
391 Ga0307509_10297308
392 Ga0316575_10043872
393 Ga0316579_10022212
394 Ga0316576_10020586
395 Ga0316576_10110649
396 Ga0316578_10021859
397 Ga0307516_10002372
398 Ga0316577_10019929
399 Ga0307518_10196400
400 Ga0307407_10288745
401 Ga0307412_10000138
402 Ga0307409_100392623
403 Ga0307411_10099835
404 Ga0316583_10087292
405 Ga0316580_10065303
406 Ga0316593_10006869
407 Ga0307510_10297909
408 Ga0373945_0095150
409 Ga0373955_0043649
410 Ga0316574_0139539
411 Ga0373931_0169256
412 Ga0373935_0073035
413 Ga0373933_0591004
414 Ga0373933_0615970
415 Ga0373947_0139989
416 Ga0316582_0006093
417 Ga0316584_0019940
418 Ga0316584_0248260
419 Ga0373925_0074977
420 Ga0373925_0536496
421 Ga0395905_0021757
422 Ga0395905_0665058
423 Ga0316581_0037526
424 Ga0436364_0764643
425 Ga0436364_1302042
426 Ga0395901_0622296
427 Ga0436365_0520921
428 Ga0436361_0262064
429 Ga0451791_0351726
430 Ga0451853_1673435
431 Ga0439431_0026689
432 Ga0439433_0159873
433 Ga0439448_0071610
434 Ga0439450_011161
435 Ga0439463_002305
436 Ga0450902_047389
437 Ga0439464_0006250
438 Ga0439460_0018113
439 Ga0451577_0000083
440 Ga0453684_0000533
441 Ga0451576_0381546
442 Ga0466958_0410492
443 Ga0466967_0374096
444 Ga0466967_0531129
445 Ga0495629_0152402
446 Ga0495664_0359552
447 Ga0495584_0048770
448 Ga0495585_0000166
449 Ga0495594_0513333
450 Ga0495631_0194427
451 Ga0495643_0065526
452 Ga0495665_0183130
453 Ga0495586_0029235
454 Ga0495657_0205644
455 Ga0495599_0273540
456 Ga0495670_0233669
457 Ga0495649_0379079
458 Ga0495581_0007088
459 Ga0495674_0033637
460 Ga0495676_0005419
461 Ga0495684_0166312
462 Ga0495593_0584391
463 Ga0496104_1051741
464 Ga0496104_1066417
465 Ga0496109_0257748
466 Ga0496111_0709521
467 Ga0496120_0042463
468 Ga0496124_0000043
469 Ga0496126_0106888
470 nmdc:mga05p37_407717_c1
471 nmdc:mga05p37_994_c1
472 nmdc:mga09592_89135_c1
473 nmdc:mga06r32_117447_c1
474 nmdc:mga06r32_4792_c1
475 nmdc:mga08y16_76871_c1
476 nmdc:mga0n895_276418_c1
477 nmdc:mga0rr50_64022_c1
478 nmdc:mga0a205_204283_c1
479 Ga0500608_205180
480 Ga0500618_000071
481 Ga0500658_0146372
482 Ga0500568_0010804
483 Ga0500604_0010769
484 Ga0587084_068235
485 2862575952
486 2866615748
487 2870628089
488 2899367536
489 8006927031
490 8025480455

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06841

Phage_T4_gp19

T4-like virus tail tube protein gp19

15

169

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ekr-assembly1.cif.gz_A the crystal structure of orange carotenoid binding protein 1 (ocp1) 0.7807 103 126
4pej-assembly2.cif.gz_B crystal structure of a computationally designed retro-aldolase, ra110.4 (cys free) 0.7657 103 124
3t69-assembly1.cif.gz_A crystal structure of a putative 2-dehydro-3-deoxygalactonokinase protein from sinorhizobium meliloti 0.7521 105 124
4pej-assembly1.cif.gz_A crystal structure of a computationally designed retro-aldolase, ra110.4 (cys free) 0.7371 103 124
1cqs-assembly1.cif.gz_B crystal structure of d103e mutant with equilenineof ksi in pseudomonas putida 0.7197 103 124
ID Description Score Start End Superfamily
af_P75677_1_79_3.30.160.130 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;ykff protein like domains 0.8438 104 125 3.30.160.130
af_D4AA77_1_352_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8369 105 127 2.130.10.10
2af5A02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3; 0.8266 104 125 3.90.930.1
af_Q9VF86_1_117_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8194 105 122 3.30.420.40
af_K7KQ43_71_310_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7977 105 123 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A1N6EB20-F1-model_v4 Conserved hypothetical phage tail region protein 0.7854 30 127 GO:0005198
AF-A0A2A8AYQ3-F1-model_v4 Phage tail protein 0.7604 30 74 GO:0005198
AF-A0A7V2X8A2-F1-model_v4 Phage tail protein 0.7587 19 130 GO:0005198
AF-A0A7Y8HCV6-F1-model_v4 Phage tail protein 0.7493 19 130 GO:0005198
AF-A0A356TP62-F1-model_v4 Phage tail protein 0.7397 18 133 GO:0005198

Map