F356836

General Info

Members Datasets Scaffolds Average Seq Length
244 158 223 226

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0000235|Ga0501031_0000235_3821_4606
Length 261
Sequence MTPDLWLYSTGVDAVWRVLESGRTVNSADRLVIDPPEGHRKVLLHSCCAPCSGEVMEAMGASGIDYTIFFYNPNIHPRKEYELRKEENIRFAEKSGVPFVDADYDTDNWFARVKGLEWEPERGARCTACFDMRFERTALYAHEHGFPVITSCLGISRWKNMEQINGCGQRAAARYPDLSYWTYNWRKGGGSSRMLEISKREEFYQQEYCGCIYSLRDTNKWRVAQGRGKIKLGVKFYGRNESDAPATSRVESAAGAAQAAD

Samples

Sample ID Description Type Environment
1 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
2 2643221569 Achromobacter sp. Root565 Isolate Unclassified
3 2643221594 Achromobacter sp. Root170 Isolate Unclassified
4 2643221621 Achromobacter sp. Root83 Isolate Unclassified
5 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
6 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
7 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
8 2855730933 Achromobacter sp. HZ28 Isolate Nodule
9 2855767633 Achromobacter sp. HZ34 Isolate Nodule
10 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
11 2858950400 Achromobacter sp. K91 Isolate Unclassified
12 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
13 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
14 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
15 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
16 2941479691
17 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
18 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
19 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
20 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
21 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
22 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
54 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
55 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
70 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
75 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
106 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
107 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
108 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
117 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
118 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
119 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
150 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
151 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
152 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
153 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
158 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.39
Metatranscriptomes 0
Isolates 8.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 7.38
Nodule 1.64
Rhizoplane 2.05
Rhizosphere 77.46
Stem 0
Stem Tuber 0
Unclassified 11.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10022759 3300001991 Bacteria 1203
2 JGI24033J26618_1000045 3300002155 Bacteria 17429
3 JGI25153J46596_10000975 3300003215 Bacteria 17374
4 rootH2_10001336 3300003320 Bacteria 12383
5 rootH1_10038148 3300003323 Bacteria 17884
6 Ga0055533_1000505 3300003756 Bacteria 14166
7 Ga0055542_1001253 3300003762 Bacteria 14041
8 Ga0070658_10057903 3300005327 Bacteria 3152
9 Ga0070683_100593607 3300005329 Bacteria 1060
10 Ga0070680_100040999 3300005336 Bacteria 3753
11 Ga0070680_100154074 3300005336 Bacteria 1930
12 Ga0070660_100396339 3300005339 Bacteria 1141
13 Ga0070661_100000325 3300005344 Bacteria 38388
14 Ga0070661_100337016 3300005344 Bacteria 1181
15 Ga0070671_100284753 3300005355 Bacteria 1406
16 Ga0070659_100002257 3300005366 Bacteria 13730
17 Ga0070678_100020253 3300005456 Bacteria 4360
18 Ga0070681_10050222 3300005458 Bacteria 4162
19 Ga0070679_100024508 3300005530 Bacteria 5912
20 Ga0070686_100440485 3300005544 Bacteria 999
21 Ga0068856_100003160 3300005614 Bacteria 16792
22 Ga0068852_100051615 3300005616 Bacteria 3530
23 Ga0075364_10000886 3300006051 Bacteria 15806
24 Ga0075364_10024750 3300006051 Bacteria 3815
25 Ga0075364_10059920 3300006051 Bacteria 2496
26 Ga0079104_1000249 3300006946 Bacteria 72153
27 Ga0105251_10003725 3300009011 Bacteria 10912
28 Ga0105243_10091637 3300009148 Bacteria 2503
29 Ga0157374_10151174 3300013296 Bacteria 2257
30 Ga0157378_10023623 3300013297 Bacteria 5408
31 Ga0157378_10107750 3300013297 Bacteria 2550
32 Ga0157375_10296381 3300013308 Bacteria 1780
33 Ga0182006_1011942 3300015261 Bacteria 3803
34 Ga0163161_10011224 3300017792 Bacteria 6206
35 Ga0213876_10113261 3300021384 Bacteria 1440
36 Ga0209566_100846 3300025225 Bacteria 15247
37 Ga0209674_100577 3300025226 Bacteria 14260
38 Ga0209646_1000063 3300025246 Bacteria 248065
39 Ga0209026_1002961 3300025250 Bacteria 5914
40 Ga0209148_1000019 3300025254 Bacteria 748518
41 Ga0209759_1002107 3300025256 Bacteria 9250
42 Ga0209758_1000036 3300025297 Bacteria 441671
43 Ga0209050_1005390 3300025298 Bacteria 8078
44 Ga0209051_1042327 3300025303 Bacteria 1611
45 Ga0207713_1004533 3300025735 Bacteria 8993
46 Ga0207705_10130883 3300025909 Bacteria 1867
47 Ga0207707_10203877 3300025912 Bacteria 1724
48 Ga0207659_10143538 3300025926 Bacteria 1856
49 Ga0207664_10391753 3300025929 Bacteria 1234
50 Ga0207690_10010296 3300025932 Bacteria 5551
51 Ga0207702_10002639 3300026078 Bacteria 16843
52 Ga0207702_10502820 3300026078 Bacteria 1182
53 Ga0207674_10966807 3300026116 Bacteria 820
54 Ga0207683_10041401 3300026121 Bacteria 4023
55 Ga0209281_1000048 3300027111 Bacteria 322698
56 Ga0265337_1001039 3300028556 Bacteria 14391
57 Ga0265319_1000533 3300028563 Bacteria 26038
58 Ga0265319_1004724 3300028563 Bacteria 6674
59 Ga0265336_10037639 3300028666 Bacteria 1487
60 Ga0265338_10010044 3300028800 Bacteria 11185
61 Ga0265338_10015085 3300028800 Bacteria 8526
62 Ga0265338_10098321 3300028800 Bacteria 2395
63 Ga0265338_10214859 3300028800 Bacteria 1441
64 Ga0307511_10089662 3300030521 Bacteria 2094
65 Ga0316176_1002853 3300030732 Bacteria 37876
66 Ga0265330_10019970 3300031235 Bacteria 3064
67 Ga0265332_10023637 3300031238 Bacteria 2711
68 Ga0265320_10002755 3300031240 Bacteria 12135
69 Ga0265331_10000627 3300031250 Bacteria 30708
70 Ga0265331_10007109 3300031250 Bacteria 6518
71 Ga0265327_10001601 3300031251 Bacteria 27504
72 Ga0265316_10722074 3300031344 Bacteria 701
73 Ga0265313_10000413 3300031595 Bacteria 45863
74 Ga0265314_10030261 3300031711 Bacteria 4009
75 Ga0265342_10007727 3300031712 Bacteria 7828
76 Ga0307414_10073696 3300032004 Bacteria 2471
77 Ga0373943_0343473 3300035170 Bacteria 854
78 Ga0373937_0391927 3300036401 Bacteria 1317
79 Ga0395899_0000075 3300037312 Bacteria 178317
80 Ga0395900_0000017 3300037418 Bacteria 369602
81 Ga0395900_0340366 3300037418 Bacteria 1476
82 Ga0395898_0000026 3300037466 Bacteria 374440
83 Ga0395898_0000030 3300037466 Bacteria 369577
84 Ga0395905_0000056 3300037471 Bacteria 209230
85 Ga0395901_0000015 3300038443 Bacteria 373388
86 Ga0395901_0125375 3300038443 Bacteria 2699
87 Ga0395901_0187275 3300038443 Bacteria 2171
88 Ga0436361_0169273 3300039447 Bacteria 77139
89 Ga0436361_0955183 3300039447 Bacteria 789
90 Ga0436363_1430310 3300039450 Bacteria 1210
91 Ga0436362_0126827 3300039453 Bacteria 896
92 Ga0466964_0058244 3300044706 Bacteria 1601
93 Ga0466971_0000018 3300044719 Bacteria 80190
94 Ga0466970_0389845 3300044765 Bacteria 794
95 Ga0466957_0014131 3300044842 Bacteria 4644
96 Ga0466957_0063749 3300044842 Bacteria 2266
97 Ga0466957_0126640 3300044842 Bacteria 1632
98 Ga0495664_0101883 3300046477 Bacteria 1730
99 Ga0495583_0000737 3300046506 Bacteria 41596
100 Ga0495606_0317160 3300046507 Bacteria 839
101 Ga0495668_0000002 3300046616 Bacteria 763179
102 Ga0495668_0069289 3300046616 Bacteria 1940
103 Ga0495625_0050131 3300046660 Bacteria 2997
104 Ga0495646_0182273 3300046680 Bacteria 1152
105 Ga0495624_0352218 3300046690 Bacteria 885
106 Ga0495649_0001039 3300046694 Bacteria 21748
107 Ga0495589_0016557 3300046794 Bacteria 3788
108 Ga0495674_0147414 3300047319 Bacteria 1975
109 Ga0495683_0133690 3300047323 Bacteria 1168
110 Ga0495686_0066651 3300047472 Bacteria 2224
111 Ga0496100_0232788 3300048903 Bacteria 1356
112 Ga0496101_0025774 3300048904 Bacteria 4082
113 Ga0496117_0000137 3300048920 Bacteria 159956
114 Ga0496118_0031260 3300048921 Bacteria 4418
115 Ga0496118_0125701 3300048921 Bacteria 1660
116 Ga0496121_0001112 3300048924 Bacteria 47429
117 Ga0496122_0015634 3300048925 Bacteria 7239
118 Ga0496122_0161084 3300048925 Bacteria 1368
119 Ga0496123_0053350 3300048926 Bacteria 2672
120 Ga0496125_0098287 3300048928 Bacteria 2166
121 Ga0496126_0420922 3300048929 Bacteria 1080
122 Ga0501031_0000235 3300049568 Bacteria 31571
123 Ga0501031_0041388 3300049568 Bacteria 3008
124 Ga0501032_0002689 3300049569 Bacteria 13857
125 Ga0501032_0010100 3300049569 Bacteria 6814
126 Ga0501032_0150334 3300049569 Bacteria 1531
127 Ga0501032_0169506 3300049569 Bacteria 1432
128 Ga0501032_0312711 3300049569 Bacteria 1014
129 Ga0501033_0000024 3300049570 Bacteria 175859
130 Ga0501033_0000072 3300049570 Bacteria 95370
131 Ga0501033_0001174 3300049570 Bacteria 23619
132 Ga0501033_0018622 3300049570 Bacteria 5247
133 Ga0501033_0069642 3300049570 Bacteria 2585
134 Ga0501033_0264525 3300049570 Bacteria 1217
135 Ga0501033_0421380 3300049570 Bacteria 929
136 Ga0501034_0021365 3300049571 Bacteria 6599
137 Ga0501034_0067658 3300049571 Bacteria 3583
138 Ga0501034_0090639 3300049571 Bacteria 3055
139 Ga0501034_0124792 3300049571 Bacteria 2560
140 Ga0501034_0356607 3300049571 Bacteria 1390
141 Ga0501034_0573014 3300049571 Bacteria 1036
142 Ga0501036_0012145 3300049572 Bacteria 7136
143 Ga0501036_0015463 3300049572 Bacteria 6374
144 Ga0501036_0136501 3300049572 Bacteria 2070
145 Ga0501037_0001255 3300049573 Bacteria 18688
146 Ga0501037_0019457 3300049573 Bacteria 5008
147 Ga0501037_0427836 3300049573 Bacteria 905
148 Ga0501037_0481949 3300049573 Bacteria 843
149 Ga0501038_0000915 3300049574 Bacteria 26176
150 Ga0501038_0009152 3300049574 Bacteria 9088
151 Ga0501038_0010552 3300049574 Bacteria 8448
152 Ga0501038_0015753 3300049574 Bacteria 6870
153 Ga0501038_0021771 3300049574 Bacteria 5753
154 Ga0501038_0141804 3300049574 Bacteria 1965
155 Ga0501038_0148721 3300049574 Bacteria 1910
156 Ga0501039_0001417 3300049575 Bacteria 17639
157 Ga0501039_0001859 3300049575 Bacteria 15599
158 Ga0501039_0008259 3300049575 Bacteria 7934
159 Ga0501039_0205236 3300049575 Bacteria 1549
160 Ga0501039_0217178 3300049575 Bacteria 1503
161 Ga0501042_0018620 3300049578 Bacteria 4810
162 Ga0501042_0202211 3300049578 Bacteria 1432
163 Ga0501042_0642367 3300049578 Bacteria 771
164 Ga0501043_0000170 3300049579 Bacteria 58695
165 Ga0501043_0003502 3300049579 Bacteria 12909
166 Ga0501043_0023307 3300049579 Bacteria 4854
167 Ga0501043_0025498 3300049579 Bacteria 4639
168 Ga0501046_0006744 3300049580 Bacteria 10139
169 Ga0501046_0190371 3300049580 Bacteria 1530
170 Ga0501047_0008154 3300049581 Bacteria 9889
171 Ga0501047_0011773 3300049581 Bacteria 8273
172 Ga0501047_0013031 3300049581 Bacteria 7875
173 Ga0501047_0031885 3300049581 Bacteria 5085
174 Ga0501047_0105672 3300049581 Bacteria 2696
175 Ga0501047_0136867 3300049581 Bacteria 2329
176 Ga0501047_0245489 3300049581 Bacteria 1640
177 Ga0501048_0033165 3300049582 Bacteria 3731
178 Ga0501067_0025235 3300049583 Bacteria 3295
179 Ga0501068_0012009 3300049584 Bacteria 4899
180 Ga0501069_0010662 3300049585 Bacteria 4871
181 Ga0501070_0020361 3300049586 Bacteria 5565
182 Ga0501070_0371390 3300049586 Bacteria 1159
183 Ga0501070_0479965 3300049586 Bacteria 1000
184 Ga0501071_0020760 3300049587 Bacteria 4567
185 Ga0501071_0153386 3300049587 Bacteria 1719
186 Ga0501073_0040758 3300049589 Bacteria 3284
187 Ga0501073_0129413 3300049589 Bacteria 1750
188 Ga0501073_0386136 3300049589 Bacteria 967
189 Ga0501074_0004589 3300049590 Bacteria 9891
190 Ga0501074_0005779 3300049590 Bacteria 8921
191 Ga0501076_0307947 3300049592 Bacteria 1299
192 Ga0501077_0138521 3300049593 Bacteria 1543
193 Ga0501080_0015100 3300049742 Bacteria 7117
194 Ga0501080_0419012 3300049742 Bacteria 1203
195 Ga0501081_0327477 3300049743 Bacteria 1127
196 Ga0501083_0013400 3300049744 Bacteria 5731
197 Ga0501083_0027084 3300049744 Bacteria 3957
198 Ga0501083_0029270 3300049744 Bacteria 3790
199 Ga0501035_0000002 3300049822 Bacteria 585447
200 Ga0501035_0001704 3300049822 Bacteria 22196
201 Ga0501035_0016399 3300049822 Bacteria 6834
202 Ga0501035_0022944 3300049822 Bacteria 5728
203 Ga0501035_0473510 3300049822 Bacteria 1034
204 Ga0501035_0508821 3300049822 Bacteria 990
205 Ga0501044_0000149 3300049823 Bacteria 86306
206 Ga0501044_0016949 3300049823 Bacteria 7816
207 Ga0501044_0076095 3300049823 Bacteria 3407
208 Ga0501044_0119042 3300049823 Bacteria 2643
209 Ga0501044_0193239 3300049823 Bacteria 1997
210 Ga0501044_0301165 3300049823 Bacteria 1532
211 Ga0501044_0429737 3300049823 Bacteria 1230
212 Ga0501045_0008462 3300049824 Bacteria 7171
213 Ga0501045_0206043 3300049824 Bacteria 1465
214 Ga0500556_0001167 3300053104 Bacteria 12584
215 Ga0500562_000122 3300053108 Bacteria 24931
216 Ga0500652_000407 3300053131 Bacteria 15412
217 Ga0500559_0162573 3300053136 Bacteria 1049
218 Ga0500604_0128259 3300053151 Bacteria 852
219 Ga0500616_0007584 3300053153 Bacteria 6862
220 Ga0501084_0391028 3300054114 Bacteria 1175
221 Ga0501082_0006572 3300060353 Bacteria 10067
222 Ga0501082_0088553 3300060353 Bacteria 2671
223 Ga0466962_0000040 3300061719 Bacteria 58700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2671180115 2671586425 207
2 3300005544 Ga0070686_100440485 Ga0070686_1004404852 211
3 3300028666 Ga0265336_10037639 Ga0265336_100376392 211
4 3300028800 Ga0265338_10015085 Ga0265338_100150854 211
5 3300028800 Ga0265338_10098321 Ga0265338_100983212 211
6 3300030732 Ga0316176_1002853 Ga0316176_100285330 211
7 iso_pu_bacteria 8054357960 8054359049 212
8 3300009148 Ga0105243_10091637 Ga0105243_100916372 213
9 3300035170 Ga0373943_0343473 Ga0373943_0343473_10_651 213
10 3300048921 Ga0496118_0031260 Ga0496118_0031260_2253_2894 213
11 iso_pu_bacteria 2895511927 2895513243 213
12 3300026078 Ga0207702_10502820 Ga0207702_105028201 214
13 3300006946 Ga0079104_1000249 Ga0079104_10002498 215
14 3300027111 Ga0209281_1000048 Ga0209281_1000048117 215
15 3300031250 Ga0265331_10000627 Ga0265331_1000062727 215
16 3300053108 Ga0500562_000122 Ga0500562_000122_14647_15306 215
17 3300053131 Ga0500652_000407 Ga0500652_000407_2572_3225 215
18 3300005336 Ga0070680_100154074 Ga0070680_1001540741 216
19 3300013296 Ga0157374_10151174 Ga0157374_101511743 216
20 3300053153 Ga0500616_0007584 Ga0500616_0007584_5874_6524 216
21 iso_pu_bacteria 3000865235 3000865595 216
22 3300028556 Ga0265337_1001039 Ga0265337_100103913 217
23 3300028563 Ga0265319_1000533 Ga0265319_100053310 217
24 3300028563 Ga0265319_1004724 Ga0265319_10047246 217
25 3300031240 Ga0265320_10002755 Ga0265320_100027555 217
26 3300031595 Ga0265313_10000413 Ga0265313_1000041337 217
27 3300039447 Ga0436361_0169273 Ga0436361_0169273_41155_41814 217
28 3300049573 Ga0501037_0481949 Ga0501037_0481949_148_801 217
29 3300049574 Ga0501038_0148721 Ga0501038_0148721_79_732 217
30 3300049581 Ga0501047_0008154 Ga0501047_0008154_4974_5627 217
31 3300049822 Ga0501035_0016399 Ga0501035_0016399_3152_3805 217
32 3300049823 Ga0501044_0016949 Ga0501044_0016949_6576_7229 217
33 3300005329 Ga0070683_100593607 Ga0070683_1005936071 218
34 3300026116 Ga0207674_10966807 Ga0207674_109668072 218
35 3300039453 Ga0436362_0126827 Ga0436362_0126827_187_858 218
36 iso_pu_bacteria 2599185292 2599906973 218
37 iso_pu_bacteria 2643221569 2643863866 218
38 iso_pu_bacteria 2643221594 2643978144 218
39 iso_pu_bacteria 2643221621 2644121070 218
40 iso_pu_bacteria 2786546517 2787438795 218
41 iso_pu_bacteria 2808606395 2809031540 218
42 iso_pu_bacteria 2857537821 2857539648 218
43 iso_pu_bacteria 2858950400 2858954648 218
44 iso_pu_bacteria 2941479691 2941484975 218
45 3300017792 Ga0163161_10011224 Ga0163161_100112245 219
46 3300021384 Ga0213876_10113261 Ga0213876_101132611 219
47 3300038443 Ga0395901_0187275 Ga0395901_0187275_897_1571 219
48 3300044765 Ga0466970_0389845 Ga0466970_0389845_50_712 219
49 3300047472 Ga0495686_0066651 Ga0495686_0066651_1076_1735 219
50 3300049570 Ga0501033_0069642 Ga0501033_0069642_153_812 219
51 3300049578 Ga0501042_0642367 Ga0501042_0642367_42_704 219
52 3300049823 Ga0501044_0193239 Ga0501044_0193239_797_1456 219
53 iso_pu_bacteria 2939589442 2939593168 219
54 iso_pu_bacteria 2974307012 2974310520 219
55 iso_pu_bacteria 2977247770 2977251253 219
56 iso_pu_bacteria 2984514374 2984518106 219
57 3300003215 JGI25153J46596_10000975 JGI25153J46596_100009759 220
58 3300005339 Ga0070660_100396339 Ga0070660_1003963391 220
59 3300015261 Ga0182006_1011942 Ga0182006_10119422 220
60 3300025297 Ga0209758_1000036 Ga0209758_1000036158 220
61 3300028800 Ga0265338_10214859 Ga0265338_102148593 220
62 3300031251 Ga0265327_10001601 Ga0265327_100016013 220
63 3300031711 Ga0265314_10030261 Ga0265314_100302613 220
64 3300036401 Ga0373937_0391927 Ga0373937_0391927_149_814 220
65 3300039450 Ga0436363_1430310 Ga0436363_1430310_304_966 220
66 3300048921 Ga0496118_0125701 Ga0496118_0125701_137_802 220
67 3300048924 Ga0496121_0001112 Ga0496121_0001112_38119_38781 220
68 3300049589 Ga0501073_0129413 Ga0501073_0129413_615_1283 220
69 3300053136 Ga0500559_0162573 Ga0500559_0162573_44_706 220
70 3300053151 Ga0500604_0128259 Ga0500604_0128259_53_715 220
71 iso_pu_bacteria 2855730933 2855734360 220
72 iso_pu_bacteria 2855767633 2855769950 220
73 iso_pu_bacteria 2881412998 2881414205 220
74 3300025735 Ga0207713_1004533 Ga0207713_10045338 221
75 3300025929 Ga0207664_10391753 Ga0207664_103917531 221
76 3300028800 Ga0265338_10010044 Ga0265338_100100442 221
77 3300031235 Ga0265330_10019970 Ga0265330_100199702 221
78 3300031238 Ga0265332_10023637 Ga0265332_100236374 221
79 3300031250 Ga0265331_10007109 Ga0265331_100071092 221
80 3300031344 Ga0265316_10722074 Ga0265316_107220741 221
81 3300031712 Ga0265342_10007727 Ga0265342_100077279 221
82 3300037418 Ga0395900_0340366 Ga0395900_0340366_205_873 221
83 3300038443 Ga0395901_0125375 Ga0395901_0125375_1396_2064 221
84 3300039447 Ga0436361_0955183 Ga0436361_0955183_25_690 221
85 3300049569 Ga0501032_0312711 Ga0501032_0312711_198_908 221
86 3300049570 Ga0501033_0001174 Ga0501033_0001174_16013_16723 221
87 3300049570 Ga0501033_0421380 Ga0501033_0421380_88_756 221
88 3300049571 Ga0501034_0124792 Ga0501034_0124792_68_778 221
89 3300049571 Ga0501034_0356607 Ga0501034_0356607_132_797 221
90 3300049571 Ga0501034_0573014 Ga0501034_0573014_298_966 221
91 3300049572 Ga0501036_0012145 Ga0501036_0012145_3559_4269 221
92 3300049572 Ga0501036_0136501 Ga0501036_0136501_1273_1941 221
93 3300049573 Ga0501037_0001255 Ga0501037_0001255_12042_12752 221
94 3300049573 Ga0501037_0427836 Ga0501037_0427836_102_770 221
95 3300049574 Ga0501038_0009152 Ga0501038_0009152_6919_7587 221
96 3300049574 Ga0501038_0010552 Ga0501038_0010552_5870_6580 221
97 3300049574 Ga0501038_0141804 Ga0501038_0141804_436_1104 221
98 3300049575 Ga0501039_0001417 Ga0501039_0001417_5431_6141 221
99 3300049575 Ga0501039_0205236 Ga0501039_0205236_232_900 221
100 3300049575 Ga0501039_0217178 Ga0501039_0217178_796_1464 221
101 3300049578 Ga0501042_0018620 Ga0501042_0018620_3137_3847 221
102 3300049579 Ga0501043_0003502 Ga0501043_0003502_6514_7224 221
103 3300049580 Ga0501046_0190371 Ga0501046_0190371_597_1307 221
104 3300049581 Ga0501047_0031885 Ga0501047_0031885_1140_1808 221
105 3300049589 Ga0501073_0386136 Ga0501073_0386136_110_820 221
106 3300049590 Ga0501074_0005779 Ga0501074_0005779_6591_7259 221
107 3300049593 Ga0501077_0138521 Ga0501077_0138521_654_1322 221
108 3300049742 Ga0501080_0419012 Ga0501080_0419012_230_895 221
109 3300049743 Ga0501081_0327477 Ga0501081_0327477_115_825 221
110 3300049744 Ga0501083_0029270 Ga0501083_0029270_217_882 221
111 3300049822 Ga0501035_0001704 Ga0501035_0001704_19083_19793 221
112 3300049822 Ga0501035_0508821 Ga0501035_0508821_229_897 221
113 3300049823 Ga0501044_0119042 Ga0501044_0119042_936_1646 221
114 3300049824 Ga0501045_0206043 Ga0501045_0206043_106_774 221
115 3300054114 Ga0501084_0391028 Ga0501084_0391028_192_857 221
116 3300060353 Ga0501082_0006572 Ga0501082_0006572_7351_8016 221
117 3300060353 Ga0501082_0088553 Ga0501082_0088553_125_793 221
118 3300005616 Ga0068852_100051615 Ga0068852_1000516152 222
119 3300006051 Ga0075364_10000886 Ga0075364_100008862 222
120 3300006051 Ga0075364_10024750 Ga0075364_100247502 222
121 3300025256 Ga0209759_1002107 Ga0209759_10021074 222
122 3300025298 Ga0209050_1005390 Ga0209050_10053903 222
123 3300025303 Ga0209051_1042327 Ga0209051_10423272 222
124 3300030521 Ga0307511_10089662 Ga0307511_100896622 222
125 3300037418 Ga0395900_0000017 Ga0395900_0000017_118465_119220 222
126 3300037466 Ga0395898_0000030 Ga0395898_0000030_118440_119195 222
127 3300037471 Ga0395905_0000056 Ga0395905_0000056_90011_90766 222
128 3300038443 Ga0395901_0000015 Ga0395901_0000015_250383_251138 222
129 3300046477 Ga0495664_0101883 Ga0495664_0101883_889_1560 222
130 3300046506 Ga0495583_0000737 Ga0495583_0000737_40361_41089 222
131 3300046616 Ga0495668_0069289 Ga0495668_0069289_708_1376 222
132 3300046660 Ga0495625_0050131 Ga0495625_0050131_620_1288 222
133 3300046680 Ga0495646_0182273 Ga0495646_0182273_303_974 222
134 3300046690 Ga0495624_0352218 Ga0495624_0352218_26_697 222
135 3300046694 Ga0495649_0001039 Ga0495649_0001039_686_1354 222
136 3300046794 Ga0495589_0016557 Ga0495589_0016557_1079_1747 222
137 3300047319 Ga0495674_0147414 Ga0495674_0147414_41_712 222
138 3300047323 Ga0495683_0133690 Ga0495683_0133690_457_1125 222
139 3300048903 Ga0496100_0232788 Ga0496100_0232788_531_1208 222
140 3300048904 Ga0496101_0025774 Ga0496101_0025774_3050_3727 222
141 3300048920 Ga0496117_0000137 Ga0496117_0000137_152907_153575 222
142 3300048925 Ga0496122_0161084 Ga0496122_0161084_608_1276 222
143 3300049569 Ga0501032_0169506 Ga0501032_0169506_232_903 222
144 3300049571 Ga0501034_0090639 Ga0501034_0090639_1172_1855 222
145 3300049581 Ga0501047_0105672 Ga0501047_0105672_1262_1933 222
146 3300049823 Ga0501044_0301165 Ga0501044_0301165_249_920 222
147 3300005327 Ga0070658_10057903 Ga0070658_100579033 223
148 3300005336 Ga0070680_100040999 Ga0070680_1000409993 223
149 3300005344 Ga0070661_100337016 Ga0070661_1003370162 223
150 3300005458 Ga0070681_10050222 Ga0070681_100502224 223
151 3300005530 Ga0070679_100024508 Ga0070679_1000245082 223
152 3300006051 Ga0075364_10059920 Ga0075364_100599202 223
153 3300009011 Ga0105251_10003725 Ga0105251_100037258 223
154 3300025909 Ga0207705_10130883 Ga0207705_101308832 223
155 3300025912 Ga0207707_10203877 Ga0207707_102038772 223
156 3300048925 Ga0496122_0015634 Ga0496122_0015634_4027_4713 223
157 3300048926 Ga0496123_0053350 Ga0496123_0053350_1000_1686 223
158 3300049568 Ga0501031_0041388 Ga0501031_0041388_828_1514 223
159 3300049569 Ga0501032_0010100 Ga0501032_0010100_3371_4057 223
160 3300049570 Ga0501033_0018622 Ga0501033_0018622_1532_2218 223
161 3300049571 Ga0501034_0021365 Ga0501034_0021365_5537_6223 223
162 3300049571 Ga0501034_0067658 Ga0501034_0067658_985_1671 223
163 3300049572 Ga0501036_0015463 Ga0501036_0015463_2785_3471 223
164 3300049573 Ga0501037_0019457 Ga0501037_0019457_835_1521 223
165 3300049574 Ga0501038_0015753 Ga0501038_0015753_3019_3705 223
166 3300049575 Ga0501039_0008259 Ga0501039_0008259_5209_5895 223
167 3300049578 Ga0501042_0202211 Ga0501042_0202211_27_713 223
168 3300049579 Ga0501043_0023307 Ga0501043_0023307_835_1521 223
169 3300049580 Ga0501046_0006744 Ga0501046_0006744_2705_3391 223
170 3300049581 Ga0501047_0136867 Ga0501047_0136867_809_1495 223
171 3300049581 Ga0501047_0245489 Ga0501047_0245489_571_1257 223
172 3300049582 Ga0501048_0033165 Ga0501048_0033165_2040_2726 223
173 3300049584 Ga0501068_0012009 Ga0501068_0012009_716_1402 223
174 3300049585 Ga0501069_0010662 Ga0501069_0010662_2783_3469 223
175 3300049586 Ga0501070_0020361 Ga0501070_0020361_2786_3472 223
176 3300049587 Ga0501071_0020760 Ga0501071_0020760_3569_4255 223
177 3300049589 Ga0501073_0040758 Ga0501073_0040758_1659_2345 223
178 3300049590 Ga0501074_0004589 Ga0501074_0004589_8237_8923 223
179 3300049592 Ga0501076_0307947 Ga0501076_0307947_384_1070 223
180 3300049742 Ga0501080_0015100 Ga0501080_0015100_5463_6149 223
181 3300049744 Ga0501083_0013400 Ga0501083_0013400_4773_5459 223
182 3300049744 Ga0501083_0027084 Ga0501083_0027084_85_771 223
183 3300049822 Ga0501035_0022944 Ga0501035_0022944_3130_3816 223
184 3300049823 Ga0501044_0000149 Ga0501044_0000149_85020_85706 223
185 3300049823 Ga0501044_0076095 Ga0501044_0076095_1913_2599 223
186 3300049824 Ga0501045_0008462 Ga0501045_0008462_5369_6055 223
187 3300053104 Ga0500556_0001167 Ga0500556_0001167_6770_7456 223
188 3300044842 Ga0466957_0014131 Ga0466957_0014131_778_1464 224
189 3300046616 Ga0495668_0000002 Ga0495668_0000002_65256_65930 224
190 3300049570 Ga0501033_0264525 Ga0501033_0264525_195_899 224
191 iso_pu_bacteria 2881927736 2881930874 224
192 3300003756 Ga0055533_1000505 Ga0055533_10005057 225
193 3300003762 Ga0055542_1001253 Ga0055542_10012537 225
194 3300025225 Ga0209566_100846 Ga0209566_1008469 225
195 3300025226 Ga0209674_100577 Ga0209674_1005777 225
196 3300025246 Ga0209646_1000063 Ga0209646_10000631 225
197 3300025250 Ga0209026_1002961 Ga0209026_10029617 225
198 3300025254 Ga0209148_1000019 Ga0209148_1000019651 225
199 3300049586 Ga0501070_0371390 Ga0501070_0371390_149_826 225
200 3300032004 Ga0307414_10073696 Ga0307414_100736962 226
201 3300002155 JGI24033J26618_1000045 JGI24033J26618_100004513 227
202 3300003320 rootH2_10001336 rootH2_1000133611 227
203 3300005344 Ga0070661_100000325 Ga0070661_1000003254 227
204 3300005366 Ga0070659_100002257 Ga0070659_10000225710 227
205 3300005456 Ga0070678_100020253 Ga0070678_1000202534 227
206 3300025932 Ga0207690_10010296 Ga0207690_100102961 227
207 3300026121 Ga0207683_10041401 Ga0207683_100414015 227
208 3300046507 Ga0495606_0317160 Ga0495606_0317160_49_744 227
209 3300049570 Ga0501033_0000024 Ga0501033_0000024_10052_10735 227
210 3300049574 Ga0501038_0000915 Ga0501038_0000915_252_935 227
211 3300049574 Ga0501038_0021771 Ga0501038_0021771_2388_3071 227
212 3300049583 Ga0501067_0025235 Ga0501067_0025235_426_1109 227
213 3300049586 Ga0501070_0479965 Ga0501070_0479965_40_723 227
214 3300049822 Ga0501035_0473510 Ga0501035_0473510_128_811 227
215 3300001991 JGI24743J22301_10022759 JGI24743J22301_100227592 228
216 3300003323 rootH1_10038148 rootH1_1003814817 228
217 3300005355 Ga0070671_100284753 Ga0070671_1002847532 228
218 3300005614 Ga0068856_100003160 Ga0068856_10000316014 228
219 3300013297 Ga0157378_10023623 Ga0157378_100236234 228
220 3300013297 Ga0157378_10107750 Ga0157378_101077504 228
221 3300013308 Ga0157375_10296381 Ga0157375_102963812 228
222 3300025926 Ga0207659_10143538 Ga0207659_101435381 228
223 3300026078 Ga0207702_10002639 Ga0207702_100026393 228
224 3300037312 Ga0395899_0000075 Ga0395899_0000075_157914_158612 228
225 3300037466 Ga0395898_0000026 Ga0395898_0000026_219960_220658 228
226 3300044706 Ga0466964_0058244 Ga0466964_0058244_553_1311 228
227 3300044719 Ga0466971_0000018 Ga0466971_0000018_26496_27182 228
228 3300044842 Ga0466957_0063749 Ga0466957_0063749_866_1561 228
229 3300044842 Ga0466957_0126640 Ga0466957_0126640_232_918 228
230 3300048928 Ga0496125_0098287 Ga0496125_0098287_949_1707 228
231 3300048929 Ga0496126_0420922 Ga0496126_0420922_129_839 228
232 3300049568 Ga0501031_0000235 Ga0501031_0000235_3821_4606 228
233 3300049569 Ga0501032_0002689 Ga0501032_0002689_12101_12790 228
234 3300049569 Ga0501032_0150334 Ga0501032_0150334_256_942 228
235 3300049570 Ga0501033_0000072 Ga0501033_0000072_72078_72767 228
236 3300049575 Ga0501039_0001859 Ga0501039_0001859_1528_2313 228
237 3300049579 Ga0501043_0000170 Ga0501043_0000170_57398_58183 228
238 3300049579 Ga0501043_0025498 Ga0501043_0025498_525_1310 228
239 3300049581 Ga0501047_0011773 Ga0501047_0011773_3660_4445 228
240 3300049581 Ga0501047_0013031 Ga0501047_0013031_3290_4075 228
241 3300049587 Ga0501071_0153386 Ga0501071_0153386_652_1437 228
242 3300049822 Ga0501035_0000002 Ga0501035_0000002_3849_4634 228
243 3300049823 Ga0501044_0429737 Ga0501044_0429737_22_735 228
244 3300061719 Ga0466962_0000040 Ga0466962_0000040_44874_45560 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02677

QueH

Epoxyqueuosine reductase QueH

42

217

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lc5-assembly1.cif.gz_A crystal structure of epoxyqueuosine reductase queh from thermotoga maritima 0.9183 18 194
7lc7-assembly1.cif.gz_A crystal structure of epoxyqueuosine reductase queh in complex with gmp from thermotoga maritima 0.917 17 194
7lc5-assembly1.cif.gz_A crystal structure of epoxyqueuosine reductase queh from thermotoga maritima 0.8989 18 194
7lc7-assembly1.cif.gz_A crystal structure of epoxyqueuosine reductase queh in complex with gmp from thermotoga maritima 0.8976 17 194
2hma-assembly1.cif.gz_A-2 the crystal structure of trna (5-methylaminomethyl-2-thiouridylate)-methyltransferase trmu from streptococcus pneumoniae 0.7923 17 128
ID Description Score Start End Superfamily
af_Q2FV28_38_219_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8905 19 190 3.40.50.620
af_Q2FV28_38_219_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8403 19 190 3.40.50.620
af_Q503J2_4_234_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.815 16 128 3.40.50.620
af_I1LJW0_63_289_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7916 11 128 3.40.50.620
3fiuC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7481 15 126 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A653NMG7-F1-model_v4 deleted 0.9814 6 149
AF-A0A800JGN2-F1-model_v4 Epoxyqueuosine reductase QueH (EC 1.17.99.6) (Queuosine biosynthesis protein QueH) 0.9801 5 156 GO:0008033
GO:0008616
GO:0016491
GO:0051539
AF-A0A0A2WK99-F1-model_v4 N-acetyltransferase domain-containing protein 0.9774 5 202 GO:0008033
GO:0016491
GO:0016747
GO:0051539
AF-A0A777E205-F1-model_v4 deleted 0.9756 19 122
AF-A0A2A4I3H6-F1-model_v4 Epoxyqueuosine reductase QueH (EC 1.17.99.6) (Queuosine biosynthesis protein QueH) 0.9754 5 214 GO:0006400
GO:0008616
GO:0046872
GO:0051539
GO:0052693

Feature Viewer

pLDDT pTM Quality
85.39 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map