F356725

General Info

Members Datasets Scaffolds Average Seq Length
244 134 489 391

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0068091|Ga0466969_0068091_380_1696
Length 438
Sequence MSRKEVAGSGIRRPTSDDDWSKHEYECKKGGQGFPPNLVNGMGDLAYFMDKLKREVLSQRVRQVKPSGIRKFFDIINTMPNVISLGVGEPDFVTPDHIRQAGIRSIREGRTRYTSNYGLLELREEIAKNLQERYGLKYNPLTQILVTVGVSEGVDLAMRTILDPGDEVISPDPGYVAYEADIIFSGGIPVPVPTYAQYNFGVRADDIAAVITPRTKMILIGNPNNPTGAVVPRAELEGIAKLAVEHDLIVAVDEVYSRLVYDTEHVCIATMPGMQDRTILLDGFSKAYAMTGWRVGYVAAPVGILEAMLKVHQYAIMCAGTAAQEAALEALRHGEADVQMMHDDYARRGRMFVEGLNRIGLPCCEPRGAFYAFPYVGNTGMSDEEFAEKLLFEEEVAVVPGSSFGAAGTGYLRAAYCTAYNQLEEALVRIERFLKKHA

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
82 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
83 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
84 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
123 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
124 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
125 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
127 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
128 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
129 2738543017 Bacillus sp. OV186 Isolate Unclassified
130 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
131 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
132 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
133 2857586860 Bacillus sp. R-71935 Isolate Unclassified
134 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.93
Metatranscriptomes 7.79
Isolates 3.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.28
Nodule 0
Rhizoplane 2.87
Rhizosphere 86.89
Stem 0
Stem Tuber 0
Unclassified 4.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0068091 3300044656 Bacteria 1716
2 JGI25151J46595_10041146 3300003187 Bacteria 1684
3 rootH2_10021261 3300003320 Bacteria 30417
4 rootH1_10000342 3300003316 Bacteria 12450
5 rootH1_10000342 3300003323 Bacteria 29593
6 Ga0055532_1000046 3300003758 Bacteria 182389
7 Ga0058863_11914296 3300004799 Bacteria 1309
8 Ga0058861_11491306 3300004800 Bacteria 1280
9 Ga0058860_11682301 3300004801 Bacteria 1289
10 Ga0065715_10092247 3300005293 Bacteria 5233
11 Ga0065707_10124064 3300005295 Bacteria 2052
12 Ga0070683_100002461 3300005329 Bacteria 14737
13 Ga0070680_100081341 3300005336 Bacteria 2672
14 Ga0070691_10000503 3300005341 Bacteria 14693
15 Ga0070691_10004560 3300005341 Bacteria 6291
16 Ga0070692_10001798 3300005345 Bacteria 8016
17 Ga0070703_10001481 3300005406 Bacteria 7059
18 Ga0070709_10187765 3300005434 Bacteria 1456
19 Ga0070714_100017136 3300005435 Bacteria 5866
20 Ga0070713_100000341 3300005436 Bacteria 30404
21 Ga0070713_100166432 3300005436 Unclassified 1972
22 Ga0070700_100076740 3300005441 Bacteria 2147
23 Ga0070694_100043998 3300005444 Bacteria 2987
24 Ga0070708_100008254 3300005445 Bacteria 8363
25 Ga0070708_100012653 3300005445 Bacteria 6890
26 Ga0070708_100016180 3300005445 Bacteria 6183
27 Ga0070708_100052605 3300005445 Bacteria 3611
28 Ga0070708_100067159 3300005445 Unclassified 3219
29 Ga0070708_100198441 3300005445 Bacteria 1878
30 Ga0070706_100000460 3300005467 Bacteria 48360
31 Ga0070706_100000757 3300005467 Bacteria 36181
32 Ga0070706_100001140 3300005467 Bacteria 28635
33 Ga0070706_100001746 3300005467 Bacteria 22559
34 Ga0070706_100003691 3300005467 Bacteria 14983
35 Ga0070706_100005313 3300005467 Bacteria 12276
36 Ga0070706_100005934 3300005467 Bacteria 11551
37 Ga0070706_100015011 3300005467 Bacteria 7152
38 Ga0070706_100025179 3300005467 Bacteria 5477
39 Ga0070706_100091752 3300005467 Bacteria 2817
40 Ga0070706_100116959 3300005467 Bacteria 2483
41 Ga0070707_100003145 3300005468 Bacteria 15619
42 Ga0070707_100003675 3300005468 Bacteria 14464
43 Ga0070707_100006234 3300005468 Bacteria 11101
44 Ga0070707_100019285 3300005468 Bacteria 6423
45 Ga0070707_100057879 3300005468 Bacteria 3718
46 Ga0070707_100142166 3300005468 Bacteria 2335
47 Ga0070707_100151533 3300005468 Bacteria 2258
48 Ga0070707_100264625 3300005468 Bacteria 1672
49 Ga0070698_100000030 3300005471 Bacteria 95971
50 Ga0070698_100003775 3300005471 Bacteria 16644
51 Ga0070698_100005571 3300005471 Bacteria 13765
52 Ga0070698_100014377 3300005471 Bacteria 8362
53 Ga0070698_100056186 3300005471 Bacteria 3989
54 Ga0070698_100068636 3300005471 Bacteria 3562
55 Ga0070698_100120981 3300005471 Bacteria 2578
56 Ga0070698_100267719 3300005471 Unclassified 1640
57 Ga0070698_100354745 3300005471 Bacteria 1398
58 Ga0070699_100009996 3300005518 Bacteria 8212
59 Ga0070699_100010404 3300005518 Bacteria 8049
60 Ga0070699_100013183 3300005518 Bacteria 7127
61 Ga0070699_100021412 3300005518 Bacteria 5577
62 Ga0070699_100070026 3300005518 Bacteria 3048
63 Ga0070679_100020962 3300005530 Bacteria 6376
64 Ga0070679_100164806 3300005530 Bacteria 2190
65 Ga0070684_100000079 3300005535 Bacteria 63157
66 Ga0070697_100005138 3300005536 Bacteria 10046
67 Ga0070697_100006400 3300005536 Bacteria 9117
68 Ga0070697_100041471 3300005536 Unclassified 3725
69 Ga0070697_100082100 3300005536 Bacteria 2656
70 Ga0070697_100205367 3300005536 Bacteria 1675
71 Ga0070696_100007106 3300005546 Bacteria 7475
72 Ga0070696_100023787 3300005546 Bacteria 4164
73 Ga0070704_100019011 3300005549 Bacteria 4406
74 Ga0070704_100066106 3300005549 Bacteria 2606
75 Ga0068857_100000133 3300005577 Bacteria 45123
76 Ga0068857_100032542 3300005577 Bacteria 4612
77 Ga0068854_100279649 3300005578 Bacteria 1343
78 Ga0068856_100000266 3300005614 Bacteria 56829
79 Ga0081539_10006403 3300005985 Bacteria 11320
80 Ga0070717_10003446 3300006028 Bacteria 11319
81 Ga0070717_10004990 3300006028 Bacteria 9656
82 Ga0070717_10155283 3300006028 Bacteria 1982
83 Ga0070717_10189408 3300006028 Bacteria 1797
84 Ga0075428_100163038 3300006844 Bacteria 2419
85 Ga0075431_100003192 3300006847 Bacteria 15857
86 Ga0075433_10013854 3300006852 Bacteria 6573
87 Ga0075433_10068805 3300006852 Bacteria 3108
88 Ga0075434_100204485 3300006871 Bacteria 1995
89 Ga0075429_100047679 3300006880 Bacteria 3727
90 Ga0075436_100015355 3300006914 Bacteria 5247
91 Ga0075436_100043546 3300006914 Bacteria 3095
92 Ga0075436_100054119 3300006914 Bacteria 2770
93 Ga0075435_100009988 3300007076 Bacteria 6919
94 Ga0075435_100013432 3300007076 Bacteria 6093
95 Ga0075435_100071271 3300007076 Bacteria 2838
96 Ga0075435_100161660 3300007076 Bacteria 1886
97 Ga0105244_10020227 3300009036 Bacteria 3700
98 Ga0105245_10135060 3300009098 Bacteria 2318
99 Ga0114129_10009153 3300009147 Bacteria 14117
100 Ga0114129_10016735 3300009147 Bacteria 10444
101 Ga0114129_10066759 3300009147 Bacteria 5016
102 Ga0114129_10116299 3300009147 Bacteria 3685
103 Ga0114129_10232068 3300009147 Bacteria 2485
104 Ga0114129_10304991 3300009147 Bacteria 2121
105 Ga0114129_10654834 3300009147 Unclassified 1355
106 Ga0105242_10198389 3300009176 Bacteria 1781
107 Ga0105239_10015580 3300010375 Bacteria 8420
108 Ga0105239_10235608 3300010375 Bacteria 2054
109 Ga0157369_10001217 3300013105 Bacteria 32068
110 Ga0163163_10179111 3300014325 Bacteria 2167
111 Ga0197907_11178628 3300020069 Bacteria 1327
112 Ga0206356_10350527 3300020070 Bacteria 4764
113 Ga0206356_10437963 3300020070 Bacteria 1333
114 Ga0206349_1854251 3300020075 Bacteria 2361
115 Ga0206351_10202021 3300020077 Bacteria 1330
116 Ga0206352_11095900 3300020078 Bacteria 2357
117 Ga0206350_10135735 3300020080 Bacteria 2019
118 Ga0206350_10368188 3300020080 Bacteria 1317
119 Ga0206350_10919053 3300020080 Bacteria 2305
120 Ga0206354_10940785 3300020081 Bacteria 1854
121 Ga0206354_11561163 3300020081 Bacteria 1322
122 Ga0206353_10622288 3300020082 Bacteria 1585
123 Ga0206353_11377664 3300020082 Bacteria 1322
124 Ga0154015_1664068 3300020610 Bacteria 2141
125 Ga0213873_10002241 3300021358 Bacteria 3323
126 Ga0213874_10004141 3300021377 Unclassified 3279
127 Ga0213874_10015760 3300021377 Bacteria 1999
128 Ga0224712_10003154 3300022467 Bacteria 4223
129 Ga0224712_10009774 3300022467 Bacteria 2906
130 Ga0209147_100014 3300025229 Bacteria 597841
131 Ga0209676_1000607 3300025292 Bacteria 52454
132 Ga0209025_1000041 3300025294 Bacteria 373694
133 Ga0209025_1001434 3300025294 Bacteria 31435
134 Ga0209025_1002123 3300025294 Bacteria 22319
135 Ga0207653_10000127 3300025885 Bacteria 54235
136 Ga0207653_10012595 3300025885 Bacteria 2642
137 Ga0207699_10040156 3300025906 Bacteria 2694
138 Ga0207684_10000137 3300025910 Bacteria 132561
139 Ga0207684_10001225 3300025910 Bacteria 28476
140 Ga0207684_10001337 3300025910 Bacteria 27056
141 Ga0207684_10001689 3300025910 Bacteria 23456
142 Ga0207684_10002776 3300025910 Bacteria 17445
143 Ga0207684_10006437 3300025910 Bacteria 10703
144 Ga0207684_10012119 3300025910 Bacteria 7505
145 Ga0207684_10024233 3300025910 Bacteria 5175
146 Ga0207684_10026532 3300025910 Bacteria 4939
147 Ga0207684_10027810 3300025910 Bacteria 4817
148 Ga0207684_10234130 3300025910 Bacteria 1585
149 Ga0207684_10313922 3300025910 Bacteria 1351
150 Ga0207707_10069848 3300025912 Bacteria 3061
151 Ga0207707_10263057 3300025912 Bacteria 1497
152 Ga0207693_10152024 3300025915 Bacteria 1821
153 Ga0207662_10021664 3300025918 Bacteria 3677
154 Ga0207652_10020387 3300025921 Bacteria 5458
155 Ga0207652_10112550 3300025921 Bacteria 2415
156 Ga0207646_10000023 3300025922 Bacteria 255171
157 Ga0207646_10001865 3300025922 Bacteria 25411
158 Ga0207646_10004548 3300025922 Bacteria 15011
159 Ga0207646_10010729 3300025922 Bacteria 8914
160 Ga0207646_10029800 3300025922 Bacteria 4954
161 Ga0207646_10114620 3300025922 Bacteria 2420
162 Ga0207646_10327410 3300025922 Bacteria 1384
163 Ga0207687_10174029 3300025927 Bacteria 1662
164 Ga0207700_10000603 3300025928 Bacteria 21033
165 Ga0207665_10002220 3300025939 Bacteria 13097
166 Ga0207661_10000097 3300025944 Bacteria 55845
167 Ga0207708_10230901 3300026075 Bacteria 1485
168 Ga0207702_10001137 3300026078 Bacteria 27193
169 Ga0207702_10046723 3300026078 Bacteria 3645
170 Ga0207674_10000011 3300026116 Bacteria 193487
171 Ga0265338_10028700 3300028800 Bacteria 5542
172 Ga0316579_10036351 3300031691 Bacteria 2272
173 Ga0316576_10021340 3300031727 Bacteria 4477
174 Ga0316580_10004690 3300032139 Bacteria 3973
175 Ga0373956_0000267 3300035119 Bacteria 20951
176 Ga0373943_0006603 3300035170 Bacteria 5201
177 Ga0373927_0000007 3300035695 Bacteria 188392
178 Ga0373933_0144610 3300035724 Bacteria 1503
179 Ga0373937_0345344 3300036401 Bacteria 1409
180 Ga0436364_0196378 3300037853 Bacteria 7074
181 Ga0436364_1244007 3300037853 Bacteria 1976
182 Ga0436364_1411610 3300037853 Bacteria 5846
183 Ga0400489_80330 3300039093 Bacteria 7329
184 Ga0400489_84255 3300039093 Archaea 2710
185 Ga0436365_1462982 3300039437 Bacteria 1621
186 Ga0436361_0477928 3300039447 Unclassified 2056
187 Ga0436361_1024815 3300039447 Bacteria 2386
188 Ga0436363_1188771 3300039450 Bacteria 6859
189 Ga0436362_0014099 3300039453 Bacteria 3350
190 Ga0436362_1195868 3300039453 Bacteria 5968
191 Ga0451577_0403912 3300042876 Bacteria 1240
192 Ga0466969_0000756 3300044656 Bacteria 17555
193 Ga0466972_0012057 3300044658 Bacteria 4343
194 Ga0466972_0045946 3300044658 Bacteria 2115
195 Ga0466966_0001926 3300044684 Bacteria 13433
196 Ga0466966_0009226 3300044684 Bacteria 6533
197 Ga0466961_0019374 3300044693 Unclassified 4376
198 Ga0466964_0000384 3300044706 Bacteria 13383
199 Ga0453684_0000046 3300044712 Bacteria 575242
200 Ga0453684_0170953 3300044712 Bacteria 2561
201 Ga0466968_0020366 3300044735 Bacteria 2677
202 Ga0466970_0000010 3300044765 Bacteria 93488
203 Ga0466970_0071967 3300044765 Bacteria 1860
204 Ga0466957_0040701 3300044842 Unclassified 2808
205 Ga0466959_0020043 3300045049 Bacteria 4922
206 Ga0466959_0068925 3300045049 Bacteria 2563
207 Ga0466958_0011194 3300045836 Bacteria 5046
208 Ga0466967_0250837 3300045976 Bacteria 1691
209 Ga0495674_0051206 3300047319 Bacteria 3641
210 Ga0496103_0106969 3300048906 Bacteria 1774
211 Ga0496110_0062110 3300048913 Bacteria 3299
212 Ga0496112_0014156 3300048915 Bacteria 7390
213 Ga0496112_0027625 3300048915 Bacteria 5472
214 Ga0496112_0036481 3300048915 Bacteria 4796
215 Ga0496113_0232923 3300048916 Bacteria 1469
216 Ga0501034_0039733 3300049571 Archaea 4766
217 Ga0501037_0003496 3300049573 Bacteria 11399
218 Ga0501039_0016301 3300049575 Bacteria 5693
219 Ga0501043_0194369 3300049579 Unclassified 1577
220 Ga0501047_0195351 3300049581 Unclassified 1886
221 Ga0501073_0115249 3300049589 Bacteria 1863
222 Ga0501044_0001903 3300049823 Bacteria 24149
223 Ga0501044_0074524 3300049823 Bacteria 3448
224 Ga0501044_0191659 3300049823 Bacteria 2007
225 nmdc:mga05p37_11928_c1 3300050507 Bacteria 10363
226 nmdc:mga05p37_165214_c1 3300050507 Bacteria 2702
227 nmdc:mga05p37_250673_c1 3300050507 Bacteria 2124
228 nmdc:mga05p37_25582_c1 3300050507 Bacteria 7180
229 nmdc:mga08y16_377095_c1 3300050511 Bacteria 1454
230 nmdc:mga0n895_175405_c1 3300050512 Bacteria 2174
231 nmdc:mga08x19_44906_c1 3300050514 Bacteria 2822
232 nmdc:mga0a205_102529_c1 3300050515 Bacteria 2760
233 nmdc:mga0a205_209737_c1 3300050515 Bacteria 1837
234 nmdc:mga0a205_38955_c1 3300050515 Bacteria 4573
235 Ga0495619_0256070 3300053085 Bacteria 1213
236 Ga0500595_028247 3300053119 Bacteria 1914
237 Ga0466962_0013586 3300061719 Bacteria 3921
238 2595091624 2593339131 Bacteria 5116855
239 2712196724 2711768088 Bacteria 3195027
240 2739270345 2738543017 Bacteria 4271950
241 2757568007 2757320391 Bacteria 4746095
242 2777760989 2775507177 Bacteria 4384303
243 2777838789 2775507192 Bacteria 4622234
244 2857590541 2857586860 Bacteria 4354574
245 2936341286 2936340661 Bacteria 5139038
246 Ga0466969_0068091
247 JGI25151J46595_10041146
248 rootH2_10021261
249 rootH1_10000342
250 Ga0055532_1000046
251 Ga0058863_11914296
252 Ga0058861_11491306
253 Ga0058860_11682301
254 Ga0065715_10092247
255 Ga0065707_10124064
256 Ga0070683_100002461
257 Ga0070680_100081341
258 Ga0070691_10000503
259 Ga0070691_10004560
260 Ga0070692_10001798
261 Ga0070703_10001481
262 Ga0070709_10187765
263 Ga0070714_100017136
264 Ga0070713_100000341
265 Ga0070713_100166432
266 Ga0070700_100076740
267 Ga0070694_100043998
268 Ga0070708_100008254
269 Ga0070708_100012653
270 Ga0070708_100016180
271 Ga0070708_100052605
272 Ga0070708_100067159
273 Ga0070708_100198441
274 Ga0070706_100000460
275 Ga0070706_100000757
276 Ga0070706_100001140
277 Ga0070706_100001746
278 Ga0070706_100003691
279 Ga0070706_100005313
280 Ga0070706_100005934
281 Ga0070706_100015011
282 Ga0070706_100025179
283 Ga0070706_100091752
284 Ga0070706_100116959
285 Ga0070707_100003145
286 Ga0070707_100003675
287 Ga0070707_100006234
288 Ga0070707_100019285
289 Ga0070707_100057879
290 Ga0070707_100142166
291 Ga0070707_100151533
292 Ga0070707_100264625
293 Ga0070698_100000030
294 Ga0070698_100003775
295 Ga0070698_100005571
296 Ga0070698_100014377
297 Ga0070698_100056186
298 Ga0070698_100068636
299 Ga0070698_100120981
300 Ga0070698_100267719
301 Ga0070698_100354745
302 Ga0070699_100009996
303 Ga0070699_100010404
304 Ga0070699_100013183
305 Ga0070699_100021412
306 Ga0070699_100070026
307 Ga0070679_100020962
308 Ga0070679_100164806
309 Ga0070684_100000079
310 Ga0070697_100005138
311 Ga0070697_100006400
312 Ga0070697_100041471
313 Ga0070697_100082100
314 Ga0070697_100205367
315 Ga0070696_100007106
316 Ga0070696_100023787
317 Ga0070704_100019011
318 Ga0070704_100066106
319 Ga0068857_100000133
320 Ga0068857_100032542
321 Ga0068854_100279649
322 Ga0068856_100000266
323 Ga0081539_10006403
324 Ga0070717_10003446
325 Ga0070717_10004990
326 Ga0070717_10155283
327 Ga0070717_10189408
328 Ga0075428_100163038
329 Ga0075431_100003192
330 Ga0075433_10013854
331 Ga0075433_10068805
332 Ga0075434_100204485
333 Ga0075429_100047679
334 Ga0075436_100015355
335 Ga0075436_100043546
336 Ga0075436_100054119
337 Ga0075435_100009988
338 Ga0075435_100013432
339 Ga0075435_100071271
340 Ga0075435_100161660
341 Ga0105244_10020227
342 Ga0105245_10135060
343 Ga0114129_10009153
344 Ga0114129_10016735
345 Ga0114129_10066759
346 Ga0114129_10116299
347 Ga0114129_10232068
348 Ga0114129_10304991
349 Ga0114129_10654834
350 Ga0105242_10198389
351 Ga0105239_10015580
352 Ga0105239_10235608
353 Ga0157369_10001217
354 Ga0163163_10179111
355 Ga0197907_11178628
356 Ga0206356_10350527
357 Ga0206356_10437963
358 Ga0206349_1854251
359 Ga0206351_10202021
360 Ga0206352_11095900
361 Ga0206350_10135735
362 Ga0206350_10368188
363 Ga0206350_10919053
364 Ga0206354_10940785
365 Ga0206354_11561163
366 Ga0206353_10622288
367 Ga0206353_11377664
368 Ga0154015_1664068
369 Ga0213873_10002241
370 Ga0213874_10004141
371 Ga0213874_10015760
372 Ga0224712_10003154
373 Ga0224712_10009774
374 Ga0209147_100014
375 Ga0209676_1000607
376 Ga0209025_1000041
377 Ga0209025_1001434
378 Ga0209025_1002123
379 Ga0207653_10000127
380 Ga0207653_10012595
381 Ga0207699_10040156
382 Ga0207684_10000137
383 Ga0207684_10001225
384 Ga0207684_10001337
385 Ga0207684_10001689
386 Ga0207684_10002776
387 Ga0207684_10006437
388 Ga0207684_10012119
389 Ga0207684_10024233
390 Ga0207684_10026532
391 Ga0207684_10027810
392 Ga0207684_10234130
393 Ga0207684_10313922
394 Ga0207707_10069848
395 Ga0207707_10263057
396 Ga0207693_10152024
397 Ga0207662_10021664
398 Ga0207652_10020387
399 Ga0207652_10112550
400 Ga0207646_10000023
401 Ga0207646_10001865
402 Ga0207646_10004548
403 Ga0207646_10010729
404 Ga0207646_10029800
405 Ga0207646_10114620
406 Ga0207646_10327410
407 Ga0207687_10174029
408 Ga0207700_10000603
409 Ga0207665_10002220
410 Ga0207661_10000097
411 Ga0207708_10230901
412 Ga0207702_10001137
413 Ga0207702_10046723
414 Ga0207674_10000011
415 Ga0265338_10028700
416 Ga0316579_10036351
417 Ga0316576_10021340
418 Ga0316580_10004690
419 Ga0373956_0000267
420 Ga0373943_0006603
421 Ga0373927_0000007
422 Ga0373933_0144610
423 Ga0373937_0345344
424 Ga0436364_0196378
425 Ga0436364_1244007
426 Ga0436364_1411610
427 Ga0400489_80330
428 Ga0400489_84255
429 Ga0436365_1462982
430 Ga0436361_0477928
431 Ga0436361_1024815
432 Ga0436363_1188771
433 Ga0436362_0014099
434 Ga0436362_1195868
435 Ga0451577_0403912
436 Ga0466969_0000756
437 Ga0466972_0012057
438 Ga0466972_0045946
439 Ga0466966_0001926
440 Ga0466966_0009226
441 Ga0466961_0019374
442 Ga0466964_0000384
443 Ga0453684_0000046
444 Ga0453684_0170953
445 Ga0466968_0020366
446 Ga0466970_0000010
447 Ga0466970_0071967
448 Ga0466957_0040701
449 Ga0466959_0020043
450 Ga0466959_0068925
451 Ga0466958_0011194
452 Ga0466967_0250837
453 Ga0495674_0051206
454 Ga0496103_0106969
455 Ga0496110_0062110
456 Ga0496112_0014156
457 Ga0496112_0027625
458 Ga0496112_0036481
459 Ga0496113_0232923
460 Ga0501034_0039733
461 Ga0501037_0003496
462 Ga0501039_0016301
463 Ga0501043_0194369
464 Ga0501047_0195351
465 Ga0501073_0115249
466 Ga0501044_0001903
467 Ga0501044_0074524
468 Ga0501044_0191659
469 nmdc:mga05p37_11928_c1
470 nmdc:mga05p37_165214_c1
471 nmdc:mga05p37_250673_c1
472 nmdc:mga05p37_25582_c1
473 nmdc:mga08y16_377095_c1
474 nmdc:mga0n895_175405_c1
475 nmdc:mga08x19_44906_c1
476 nmdc:mga0a205_102529_c1
477 nmdc:mga0a205_209737_c1
478 nmdc:mga0a205_38955_c1
479 Ga0495619_0256070
480 Ga0500595_028247
481 Ga0466962_0013586
482 2595091624
483 2712196724
484 2739270345
485 2757568007
486 2777760989
487 2777838789
488 2857590541
489 2936341286

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

80

430

0.95

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

128

256

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gd9-assembly1.cif.gz_B crystall structure of pyrococcus protein-a1 0.9765 5 383
1j32-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9687 4 385
5wmi-assembly1.cif.gz_A-2 arabidopsis thaliana prephenate aminotransferase mutant- t84v 0.9641 4 385
1o4s-assembly1.cif.gz_A crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution 0.963 6 384
5wmk-assembly1.cif.gz_A-2 arabidopsis thaliana prephenate aminotransferase double mutant- t84v k169v 0.9616 5 387
ID Description Score Start End Superfamily
af_A0A0R0HS10_77_301_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9812 60 280 3.40.640.10
1gd9A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9809 61 282 3.40.640.10
af_A0A0R0F159_20_155_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9754 150 280 3.40.640.10
1j32B02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9736 61 282 3.40.640.10
1gd9A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9723 61 282 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A1V6E7S1-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9896 68 385 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A292SKD9-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9894 3 304 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A355S489-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9873 6 385 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A1C6J0V3-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9837 5 385 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A382Y5G9-F1-model_v4 Aminotransferase class I/classII large domain-containing protein 0.982 38 303 GO:0006520
GO:0008483
GO:0009058
GO:0030170

Map