F356140

General Info

Members Datasets Scaffolds Average Seq Length
244 178 488 145

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10008382|rootH2_1000838221
Length 169
Sequence LLPHTYPSGPRGMSRRSSCAFARIAPRQASMPARRADSAGFTLLELLVVIVIIGLLAGLVAPRYFDQVSKSNTKIAKAQIDSLEKALDEYRLDVGVYPTTEQGLEALNTRPQNVDKWAGPYLKKAVPLDPWGASYVYKSPGEHGEYDLLSYGKDGQPGGSGEASDVTSW

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
111 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
122 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
123 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
124 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
125 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
142 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
158 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
177 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
178 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.46
Nodule 0.41
Rhizoplane 0.41
Rhizosphere 94.26
Stem 0
Stem Tuber 0
Unclassified 10.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10008382 3300003320 Bacteria 34946
2 Ga0055540_1001581 3300003792 Bacteria 13285
3 Ga0055531_10001681 3300003794 Bacteria 15923
4 Ga0065715_11161605 3300005293 Bacteria 506
5 Ga0065707_10039423 3300005295 Bacteria 891
6 Ga0070676_10013135 3300005328 Bacteria 4537
7 Ga0070670_100042147 3300005331 Bacteria 3923
8 Ga0070670_100155404 3300005331 Unclassified 1981
9 Ga0070670_101265438 3300005331 Bacteria 675
10 Ga0070677_10011752 3300005333 Bacteria 3026
11 Ga0068869_100045307 3300005334 Bacteria 3166
12 Ga0070680_100096014 3300005336 Bacteria 2458
13 Ga0070682_100488533 3300005337 Unclassified 951
14 Ga0068868_100245265 3300005338 Bacteria 1506
15 Ga0070689_100095672 3300005340 Bacteria 2346
16 Ga0070689_100738151 3300005340 Bacteria 862
17 Ga0070687_100032618 3300005343 Unclassified 2564
18 Ga0070661_100359348 3300005344 Bacteria 1144
19 Ga0070669_100004475 3300005353 Bacteria 10071
20 Ga0070675_100027881 3300005354 Bacteria 4540
21 Ga0070673_100037014 3300005364 Bacteria 3715
22 Ga0070673_100186691 3300005364 Bacteria 1778
23 Ga0070688_100448761 3300005365 Bacteria 964
24 Ga0070667_100627386 3300005367 Bacteria 991
25 Ga0070701_10480453 3300005438 Bacteria 803
26 Ga0070700_100039088 3300005441 Unclassified 2896
27 Ga0070694_100186199 3300005444 Bacteria 1538
28 Ga0070678_100176333 3300005456 Bacteria 1746
29 Ga0070662_100597582 3300005457 Bacteria 928
30 Ga0070681_10000720 3300005458 Bacteria 27395
31 Ga0070681_10503815 3300005458 Unclassified 1124
32 Ga0070681_10645856 3300005458 Bacteria 973
33 Ga0068867_100007134 3300005459 Bacteria 7897
34 Ga0070679_100035797 3300005530 Bacteria 4925
35 Ga0068853_100396086 3300005539 Bacteria 1292
36 Ga0070672_100016215 3300005543 Bacteria 5329
37 Ga0070686_100296285 3300005544 Bacteria 1198
38 Ga0070686_100584647 3300005544 Bacteria 878
39 Ga0070686_101270985 3300005544 Bacteria 614
40 Ga0070686_101565300 3300005544 Bacteria 557
41 Ga0070695_100302896 3300005545 Bacteria 1182
42 Ga0070693_100261068 3300005547 Bacteria 1152
43 Ga0070704_100031629 3300005549 Bacteria 3563
44 Ga0070704_101099721 3300005549 Bacteria 722
45 Ga0070664_100173439 3300005564 Bacteria 1914
46 Ga0068857_100366374 3300005577 Unclassified 1336
47 Ga0068857_101681571 3300005577 Unclassified 620
48 Ga0068856_100224480 3300005614 Bacteria 1894
49 Ga0068856_100364346 3300005614 Bacteria 1464
50 Ga0070702_100691007 3300005615 Unclassified 776
51 Ga0068859_100505871 3300005617 Bacteria 1303
52 Ga0068859_100590419 3300005617 Bacteria 1204
53 Ga0068859_101226353 3300005617 Bacteria 826
54 Ga0068859_101745505 3300005617 Bacteria 687
55 Ga0068864_100050049 3300005618 Bacteria 3595
56 Ga0068864_100104958 3300005618 Bacteria 2511
57 Ga0068864_100151871 3300005618 Bacteria 2098
58 Ga0068864_100554792 3300005618 Bacteria 1111
59 Ga0068861_100489298 3300005719 Bacteria 1110
60 Ga0068861_100970650 3300005719 Bacteria 809
61 Ga0068861_101508420 3300005719 Bacteria 660
62 Ga0068870_10927348 3300005840 Bacteria 617
63 Ga0068858_100019413 3300005842 Bacteria 6357
64 Ga0068860_100115965 3300005843 Unclassified 2562
65 Ga0068860_100215955 3300005843 Bacteria 1861
66 Ga0068860_100259697 3300005843 Bacteria 1693
67 Ga0068862_100243463 3300005844 Bacteria 1636
68 Ga0097621_101557232 3300006237 Bacteria 628
69 Ga0068871_100971512 3300006358 Bacteria 790
70 Ga0075433_10017639 3300006852 Bacteria 5919
71 Ga0075433_10151435 3300006852 Bacteria 2063
72 Ga0075434_100007799 3300006871 Bacteria 9913
73 Ga0075434_100010115 3300006871 Bacteria 8835
74 Ga0068865_100716555 3300006881 Bacteria 856
75 Ga0068865_101314077 3300006881 Unclassified 643
76 Ga0075436_100000106 3300006914 Bacteria 49322
77 Ga0075436_100000873 3300006914 Bacteria 20025
78 Ga0075436_100036484 3300006914 Bacteria 3393
79 Ga0097620_100505879 3300006931 Bacteria 1303
80 Ga0097620_100590446 3300006931 Bacteria 1204
81 Ga0097620_101226253 3300006931 Bacteria 826
82 Ga0097620_101746064 3300006931 Bacteria 687
83 Ga0075435_100000741 3300007076 Bacteria 20224
84 Ga0099795_10299551 3300007788 Bacteria 707
85 Ga0111539_10006537 3300009094 Bacteria 15020
86 Ga0111539_10009506 3300009094 Bacteria 12271
87 Ga0111539_10124720 3300009094 Bacteria 3018
88 Ga0111539_10342882 3300009094 Bacteria 1739
89 Ga0114129_12582464 3300009147 Bacteria 606
90 Ga0105241_10147350 3300009174 Unclassified 1922
91 Ga0105248_10149429 3300009177 Bacteria 2636
92 Ga0105249_10922891 3300009553 Bacteria 940
93 Ga0157374_10118026 3300013296 Bacteria 2558
94 Ga0163162_10013940 3300013306 Bacteria 7853
95 Ga0157375_10014028 3300013308 Bacteria 7146
96 Ga0157375_11998981 3300013308 Bacteria 689
97 Ga0163163_10438521 3300014325 Unclassified 1366
98 Ga0157380_10386528 3300014326 Bacteria 1323
99 Ga0157376_10688781 3300014969 Bacteria 1026
100 Ga0163161_10083397 3300017792 Bacteria 2356
101 Ga0209759_1019546 3300025256 Bacteria 1603
102 Ga0209758_1032139 3300025297 Bacteria 2137
103 Ga0209051_1000301 3300025303 Bacteria 77933
104 Ga0209257_1000022 3300025304 Bacteria 765258
105 Ga0207697_10021289 3300025315 Bacteria 2655
106 Ga0207682_10020201 3300025893 Bacteria 2613
107 Ga0207680_10274369 3300025903 Bacteria 1170
108 Ga0207645_10018790 3300025907 Bacteria 4540
109 Ga0207643_10088377 3300025908 Bacteria 1804
110 Ga0207654_10415508 3300025911 Unclassified 938
111 Ga0207707_10071690 3300025912 Bacteria 3019
112 Ga0207707_10102639 3300025912 Bacteria 2500
113 Ga0207707_10166268 3300025912 Bacteria 1928
114 Ga0207671_10820126 3300025914 Unclassified 737
115 Ga0207660_10030123 3300025917 Bacteria 3728
116 Ga0207660_10099409 3300025917 Bacteria 2171
117 Ga0207649_10259625 3300025920 Bacteria 1255
118 Ga0207652_10572783 3300025921 Unclassified 1014
119 Ga0207681_10038343 3300025923 Bacteria 3174
120 Ga0207650_10020029 3300025925 Bacteria 4711
121 Ga0207650_10901483 3300025925 Bacteria 751
122 Ga0207659_10021456 3300025926 Unclassified 4287
123 Ga0207706_10147682 3300025933 Bacteria 2068
124 Ga0207670_11256646 3300025936 Bacteria 627
125 Ga0207704_10038568 3300025938 Bacteria 2772
126 Ga0207691_10017307 3300025940 Bacteria 6836
127 Ga0207711_10880423 3300025941 Bacteria 833
128 Ga0207689_10052016 3300025942 Bacteria 3376
129 Ga0207689_10206475 3300025942 Bacteria 1622
130 Ga0207679_10984059 3300025945 Bacteria 773
131 Ga0207667_11048827 3300025949 Unclassified 800
132 Ga0207651_10040980 3300025960 Bacteria 3070
133 Ga0207651_10049559 3300025960 Bacteria 2846
134 Ga0207712_11630368 3300025961 Unclassified 578
135 Ga0207668_10031802 3300025972 Bacteria 3481
136 Ga0207668_10444233 3300025972 Unclassified 1105
137 Ga0207658_11125463 3300025986 Bacteria 717
138 Ga0207677_10251923 3300026023 Bacteria 1434
139 Ga0207703_10496251 3300026035 Bacteria 1145
140 Ga0207639_10350980 3300026041 Unclassified 1317
141 Ga0207708_10134143 3300026075 Bacteria 1938
142 Ga0207708_11612171 3300026075 Bacteria 570
143 Ga0207702_10144730 3300026078 Bacteria 2155
144 Ga0207641_10289466 3300026088 Bacteria 1544
145 Ga0207648_10043564 3300026089 Bacteria 3939
146 Ga0207676_10072753 3300026095 Bacteria 2764
147 Ga0207676_10090076 3300026095 Unclassified 2516
148 Ga0207674_10066353 3300026116 Bacteria 3635
149 Ga0207675_100546602 3300026118 Bacteria 1157
150 Ga0207698_10946619 3300026142 Bacteria 870
151 Ga0268265_10024272 3300028380 Bacteria 4288
152 Ga0268264_10149078 3300028381 Bacteria 2095
153 Ga0268264_10270566 3300028381 Bacteria 1587
154 Ga0265334_10069893 3300028573 Bacteria 1310
155 Ga0265336_10000003 3300028666 Bacteria 423158
156 Ga0265336_10000662 3300028666 Bacteria 18737
157 Ga0265324_10000034 3300029957 Bacteria 124255
158 Ga0265324_10000430 3300029957 Bacteria 29951
159 Ga0265324_10225573 3300029957 Bacteria 636
160 Ga0307511_10000109 3300030521 Bacteria 74186
161 Ga0265328_10001181 3300031239 Bacteria 12081
162 Ga0265325_10004259 3300031241 Bacteria 9075
163 Ga0265331_10001340 3300031250 Bacteria 18186
164 Ga0265331_10004349 3300031250 Bacteria 8872
165 Ga0265327_10000020 3300031251 Bacteria 424552
166 Ga0265327_10001856 3300031251 Bacteria 24502
167 Ga0265313_10254828 3300031595 Bacteria 715
168 Ga0265314_10036990 3300031711 Bacteria 3541
169 Ga0307411_10504021 3300032005 Unclassified 1024
170 Ga0373930_0023091 3300034816 Bacteria 1235
171 Ga0373948_0107550 3300034817 Bacteria 663
172 Ga0373952_0056038 3300035092 Bacteria 952
173 Ga0373960_0197733 3300035121 Bacteria 709
174 Ga0373942_0042351 3300035207 Bacteria 1248
175 Ga0373931_0039306 3300035691 Bacteria 2479
176 Ga0373937_0082948 3300036401 Bacteria 2966
177 Ga0395898_0004356 3300037466 Bacteria 15495
178 Ga0395901_0003053 3300038443 Bacteria 16870
179 Ga0436361_0264382 3300039447 Bacteria 1881
180 Ga0436361_0925393 3300039447 Bacteria 1431
181 Ga0436363_0807193 3300039450 Bacteria 874
182 Ga0451577_0198135 3300042876 Bacteria 1813
183 Ga0451577_2021775 3300042876 Bacteria 503
184 Ga0466961_0001030 3300044693 Bacteria 17202
185 Ga0466963_0799854 3300044694 Bacteria 665
186 Ga0466964_0033397 3300044706 Bacteria 2050
187 Ga0453684_0002918 3300044712 Bacteria 40083
188 Ga0453684_0028007 3300044712 Bacteria 8057
189 Ga0453684_0112041 3300044712 Bacteria 3313
190 Ga0453684_0233310 3300044712 Bacteria 2123
191 Ga0466957_0363321 3300044842 Bacteria 984
192 Ga0466957_0563035 3300044842 Bacteria 795
193 Ga0451576_0043220 3300045051 Bacteria 4755
194 Ga0451576_0051820 3300045051 Bacteria 4302
195 Ga0451576_1158750 3300045051 Unclassified 808
196 Ga0451576_2545304 3300045051 Bacteria 522
197 Ga0466967_0051547 3300045976 Bacteria 3607
198 Ga0466967_0150983 3300045976 Bacteria 2171
199 Ga0495638_0080419 3300046460 Bacteria 1980
200 Ga0495605_0286327 3300046474 Bacteria 699
201 Ga0495607_0001341 3300046501 Bacteria 21944
202 Ga0495583_0004584 3300046506 Bacteria 9802
203 Ga0495616_0002850 3300046513 Bacteria 11270
204 Ga0495621_0049761 3300046539 Bacteria 1496
205 Ga0495656_0435818 3300046615 Unclassified 689
206 Ga0495625_0002237 3300046660 Bacteria 21363
207 Ga0495669_0153158 3300046684 Bacteria 1092
208 Ga0495671_0003834 3300046692 Bacteria 9136
209 Ga0495636_0560855 3300047318 Bacteria 556
210 Ga0495672_0001142 3300047320 Bacteria 26815
211 Ga0495672_0079565 3300047320 Bacteria 1830
212 Ga0495683_0000682 3300047323 Bacteria 25029
213 Ga0495687_001406 3300047443 Bacteria 22172
214 Ga0495677_0037808 3300047445 Bacteria 1763
215 Ga0495673_0003232 3300047469 Bacteria 10864
216 Ga0496104_1051931 3300048907 Unclassified 718
217 Ga0495678_110163 3300049459 Bacteria 940
218 Ga0495682_0001404 3300049460 Bacteria 13119
219 Ga0501031_0138411 3300049568 Bacteria 1591
220 Ga0501036_0080131 3300049572 Bacteria 2761
221 Ga0501042_0043313 3300049578 Bacteria 3205
222 Ga0501046_0473281 3300049580 Bacteria 899
223 Ga0501067_0114183 3300049583 Unclassified 1502
224 Ga0501071_0179241 3300049587 Bacteria 1587
225 Ga0501072_0187809 3300049588 Bacteria 1648
226 Ga0501075_0161395 3300049591 Bacteria 1710
227 Ga0501081_0314253 3300049743 Bacteria 1151
228 Ga0501045_0266571 3300049824 Bacteria 1275
229 nmdc:mga08y16_265360_c1 3300050511 Bacteria 1773
230 nmdc:mga08y16_8293_c1 3300050511 Bacteria 10872
231 nmdc:mga0n895_10865_c1 3300050512 Bacteria 8082
232 nmdc:mga0n895_48519_c1 3300050512 Bacteria 4157
233 nmdc:mga0rr50_1108_c1 3300050513 Bacteria 14619
234 nmdc:mga0rr50_8436_c1 3300050513 Bacteria 6415
235 nmdc:mga08x19_28741_c1 3300050514 Bacteria 3484
236 nmdc:mga08x19_29452_c1 3300050514 Bacteria 3443
237 nmdc:mga08x19_31574_c1 3300050514 Bacteria 3333
238 nmdc:mga0a205_1388_c1 3300050515 Bacteria 20474
239 nmdc:mga0a205_35520_c1 3300050515 Bacteria 4786
240 Ga0500641_0218645 3300053096 Bacteria 809
241 Ga0501082_1368871 3300060353 Bacteria 618
242 2515687530 2515154123 Bacteria 6387382
243 2574429528 2574179768 Bacteria 4907129
244 639787248 639633007 Bacteria 4376040
245 rootH2_10008382
246 Ga0055540_1001581
247 Ga0055531_10001681
248 Ga0065715_11161605
249 Ga0065707_10039423
250 Ga0070676_10013135
251 Ga0070670_100042147
252 Ga0070670_100155404
253 Ga0070670_101265438
254 Ga0070677_10011752
255 Ga0068869_100045307
256 Ga0070680_100096014
257 Ga0070682_100488533
258 Ga0068868_100245265
259 Ga0070689_100095672
260 Ga0070689_100738151
261 Ga0070687_100032618
262 Ga0070661_100359348
263 Ga0070669_100004475
264 Ga0070675_100027881
265 Ga0070673_100037014
266 Ga0070673_100186691
267 Ga0070688_100448761
268 Ga0070667_100627386
269 Ga0070701_10480453
270 Ga0070700_100039088
271 Ga0070694_100186199
272 Ga0070678_100176333
273 Ga0070662_100597582
274 Ga0070681_10000720
275 Ga0070681_10503815
276 Ga0070681_10645856
277 Ga0068867_100007134
278 Ga0070679_100035797
279 Ga0068853_100396086
280 Ga0070672_100016215
281 Ga0070686_100296285
282 Ga0070686_100584647
283 Ga0070686_101270985
284 Ga0070686_101565300
285 Ga0070695_100302896
286 Ga0070693_100261068
287 Ga0070704_100031629
288 Ga0070704_101099721
289 Ga0070664_100173439
290 Ga0068857_100366374
291 Ga0068857_101681571
292 Ga0068856_100224480
293 Ga0068856_100364346
294 Ga0070702_100691007
295 Ga0068859_100505871
296 Ga0068859_100590419
297 Ga0068859_101226353
298 Ga0068859_101745505
299 Ga0068864_100050049
300 Ga0068864_100104958
301 Ga0068864_100151871
302 Ga0068864_100554792
303 Ga0068861_100489298
304 Ga0068861_100970650
305 Ga0068861_101508420
306 Ga0068870_10927348
307 Ga0068858_100019413
308 Ga0068860_100115965
309 Ga0068860_100215955
310 Ga0068860_100259697
311 Ga0068862_100243463
312 Ga0097621_101557232
313 Ga0068871_100971512
314 Ga0075433_10017639
315 Ga0075433_10151435
316 Ga0075434_100007799
317 Ga0075434_100010115
318 Ga0068865_100716555
319 Ga0068865_101314077
320 Ga0075436_100000106
321 Ga0075436_100000873
322 Ga0075436_100036484
323 Ga0097620_100505879
324 Ga0097620_100590446
325 Ga0097620_101226253
326 Ga0097620_101746064
327 Ga0075435_100000741
328 Ga0099795_10299551
329 Ga0111539_10006537
330 Ga0111539_10009506
331 Ga0111539_10124720
332 Ga0111539_10342882
333 Ga0114129_12582464
334 Ga0105241_10147350
335 Ga0105248_10149429
336 Ga0105249_10922891
337 Ga0157374_10118026
338 Ga0163162_10013940
339 Ga0157375_10014028
340 Ga0157375_11998981
341 Ga0163163_10438521
342 Ga0157380_10386528
343 Ga0157376_10688781
344 Ga0163161_10083397
345 Ga0209759_1019546
346 Ga0209758_1032139
347 Ga0209051_1000301
348 Ga0209257_1000022
349 Ga0207697_10021289
350 Ga0207682_10020201
351 Ga0207680_10274369
352 Ga0207645_10018790
353 Ga0207643_10088377
354 Ga0207654_10415508
355 Ga0207707_10071690
356 Ga0207707_10102639
357 Ga0207707_10166268
358 Ga0207671_10820126
359 Ga0207660_10030123
360 Ga0207660_10099409
361 Ga0207649_10259625
362 Ga0207652_10572783
363 Ga0207681_10038343
364 Ga0207650_10020029
365 Ga0207650_10901483
366 Ga0207659_10021456
367 Ga0207706_10147682
368 Ga0207670_11256646
369 Ga0207704_10038568
370 Ga0207691_10017307
371 Ga0207711_10880423
372 Ga0207689_10052016
373 Ga0207689_10206475
374 Ga0207679_10984059
375 Ga0207667_11048827
376 Ga0207651_10040980
377 Ga0207651_10049559
378 Ga0207712_11630368
379 Ga0207668_10031802
380 Ga0207668_10444233
381 Ga0207658_11125463
382 Ga0207677_10251923
383 Ga0207703_10496251
384 Ga0207639_10350980
385 Ga0207708_10134143
386 Ga0207708_11612171
387 Ga0207702_10144730
388 Ga0207641_10289466
389 Ga0207648_10043564
390 Ga0207676_10072753
391 Ga0207676_10090076
392 Ga0207674_10066353
393 Ga0207675_100546602
394 Ga0207698_10946619
395 Ga0268265_10024272
396 Ga0268264_10149078
397 Ga0268264_10270566
398 Ga0265334_10069893
399 Ga0265336_10000003
400 Ga0265336_10000662
401 Ga0265324_10000034
402 Ga0265324_10000430
403 Ga0265324_10225573
404 Ga0307511_10000109
405 Ga0265328_10001181
406 Ga0265325_10004259
407 Ga0265331_10001340
408 Ga0265331_10004349
409 Ga0265327_10000020
410 Ga0265327_10001856
411 Ga0265313_10254828
412 Ga0265314_10036990
413 Ga0307411_10504021
414 Ga0373930_0023091
415 Ga0373948_0107550
416 Ga0373952_0056038
417 Ga0373960_0197733
418 Ga0373942_0042351
419 Ga0373931_0039306
420 Ga0373937_0082948
421 Ga0395898_0004356
422 Ga0395901_0003053
423 Ga0436361_0264382
424 Ga0436361_0925393
425 Ga0436363_0807193
426 Ga0451577_0198135
427 Ga0451577_2021775
428 Ga0466961_0001030
429 Ga0466963_0799854
430 Ga0466964_0033397
431 Ga0453684_0002918
432 Ga0453684_0028007
433 Ga0453684_0112041
434 Ga0453684_0233310
435 Ga0466957_0363321
436 Ga0466957_0563035
437 Ga0451576_0043220
438 Ga0451576_0051820
439 Ga0451576_1158750
440 Ga0451576_2545304
441 Ga0466967_0051547
442 Ga0466967_0150983
443 Ga0495638_0080419
444 Ga0495605_0286327
445 Ga0495607_0001341
446 Ga0495583_0004584
447 Ga0495616_0002850
448 Ga0495621_0049761
449 Ga0495656_0435818
450 Ga0495625_0002237
451 Ga0495669_0153158
452 Ga0495671_0003834
453 Ga0495636_0560855
454 Ga0495672_0001142
455 Ga0495672_0079565
456 Ga0495683_0000682
457 Ga0495687_001406
458 Ga0495677_0037808
459 Ga0495673_0003232
460 Ga0496104_1051931
461 Ga0495678_110163
462 Ga0495682_0001404
463 Ga0501031_0138411
464 Ga0501036_0080131
465 Ga0501042_0043313
466 Ga0501046_0473281
467 Ga0501067_0114183
468 Ga0501071_0179241
469 Ga0501072_0187809
470 Ga0501075_0161395
471 Ga0501081_0314253
472 Ga0501045_0266571
473 nmdc:mga08y16_265360_c1
474 nmdc:mga08y16_8293_c1
475 nmdc:mga0n895_10865_c1
476 nmdc:mga0n895_48519_c1
477 nmdc:mga0rr50_1108_c1
478 nmdc:mga0rr50_8436_c1
479 nmdc:mga08x19_28741_c1
480 nmdc:mga08x19_29452_c1
481 nmdc:mga08x19_31574_c1
482 nmdc:mga0a205_1388_c1
483 nmdc:mga0a205_35520_c1
484 Ga0500641_0218645
485 Ga0501082_1368871
486 2515687530
487 2574429528
488 639787248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08334

T2SSG

Type II secretion system (T2SS), protein G

63

169

0.98

PF07963

N_methyl

Prokaryotic N-terminal methylation motif

35

61

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gn9-assembly3.cif.gz_C crystal structure of the major pseudopilin from the type 2 secretion system of vibrio vulnificus 0.9544 69 169
3fu1-assembly1.cif.gz_B crystal structure of the major pseudopilin from the type 2 secretion system of vibrio cholerae 0.9264 69 169
4lw9-assembly1.cif.gz_A crystal structure of vibrio cholera major pseudopilin epsg 0.9258 69 169
4lw9-assembly6.cif.gz_F crystal structure of vibrio cholera major pseudopilin epsg 0.923 72 167
3gn9-assembly3.cif.gz_C crystal structure of the major pseudopilin from the type 2 secretion system of vibrio vulnificus 0.8628 69 169
ID Description Score Start End Superfamily
3fu1A01 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.9291 69 169 3.30.700.10
1t92B01 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.8834 67 155 3.30.700.10
3fu1A01 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.8549 69 169 3.30.700.10
1t92B01 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.7912 67 155 3.30.700.10
2kepA01 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.7668 69 169 3.30.700.10
ID Description Score Start End GO Terms
AF-A0A536TRT8-F1-model_v4 Type II secretion system protein GspG 0.996 69 169 GO:0005886
GO:0015627
GO:0015628
AF-A0A645IHG3-F1-model_v4 Type II secretion system protein G 0.9933 62 169 GO:0005886
GO:0015627
GO:0015628
AF-A0A7R8GE83-F1-model_v4 deleted 0.9876 69 168
AF-A0A2P9H4L1-F1-model_v4 Type II secretion system protein G 0.9858 74 169 GO:0005886
GO:0015627
GO:0015628
AF-A0A257WCH2-F1-model_v4 deleted 0.9847 69 169

Map