F355989

General Info

Members Datasets Scaffolds Average Seq Length
243 157 243 122

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0250725|Ga0501047_0250725_277_672
Length 131
Sequence MRISRYKHIVLSSASNLEDVRPLTRAFRALGDETRVRIVALLSHGELCVCHLESALAISQPNCSRQLGILKAAGIVDSRRDGTWVYYRISDQEHDSVKSVLDVLAKTFGAERALRTDHARLKKSCGPDACK

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
87 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
88 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
91 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
96 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
115 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
116 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
117 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
127 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
128 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
129 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
130 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
131 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
132 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
133 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
134 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
135 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
136 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
137 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
138 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
139 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
140 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
141 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
142 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
143 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
144 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
145 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
146 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
147 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
148 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
149 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
150 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
151 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
152 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
153 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
154 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
155 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
156 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.93
Nodule 0
Rhizoplane 0.41
Rhizosphere 73.25
Stem 0
Stem Tuber 0
Unclassified 7.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100375476 3300005329 Bacteria 1355
2 Ga0070683_100460323 3300005329 Bacteria 1214
3 Ga0070690_100021911 3300005330 Bacteria 3905
4 Ga0070690_100416121 3300005330 Bacteria 990
5 Ga0068869_100277834 3300005334 Bacteria 1346
6 Ga0068869_101387599 3300005334 Unclassified 622
7 Ga0070666_10279058 3300005335 Bacteria 1187
8 Ga0070680_101515573 3300005336 Bacteria 581
9 Ga0070682_100193948 3300005337 Bacteria 1428
10 Ga0068868_101396248 3300005338 Bacteria 653
11 Ga0070689_100228183 3300005340 Bacteria 1530
12 Ga0070689_101742015 3300005340 Bacteria 567
13 Ga0070687_100381184 3300005343 Bacteria 919
14 Ga0070687_100835880 3300005343 Unclassified 655
15 Ga0070673_100191680 3300005364 Bacteria 1756
16 Ga0070688_100573843 3300005365 Bacteria 860
17 Ga0070688_101660778 3300005365 Unclassified 522
18 Ga0070667_100361264 3300005367 Bacteria 1316
19 Ga0070713_101175811 3300005436 Bacteria 742
20 Ga0070701_10110111 3300005438 Bacteria 1538
21 Ga0070701_10553271 3300005438 Bacteria 755
22 Ga0070700_100076259 3300005441 Bacteria 2153
23 Ga0070700_100568756 3300005441 Bacteria 883
24 Ga0070694_101801292 3300005444 Bacteria 522
25 Ga0070708_100111664 3300005445 Bacteria 2513
26 Ga0070685_10812954 3300005466 Bacteria 690
27 Ga0070685_11048040 3300005466 Bacteria 614
28 Ga0070699_101846013 3300005518 Bacteria 553
29 Ga0070679_100117426 3300005530 Bacteria 2645
30 Ga0070679_100304788 3300005530 Bacteria 1543
31 Ga0070679_100725873 3300005530 Bacteria 936
32 Ga0070679_100787285 3300005530 Bacteria 894
33 Ga0070684_102050756 3300005535 Bacteria 540
34 Ga0070686_100344302 3300005544 Bacteria 1118
35 Ga0070686_101575126 3300005544 Unclassified 555
36 Ga0070665_100099639 3300005548 Bacteria 2910
37 Ga0070665_102266968 3300005548 Unclassified 546
38 Ga0068855_102366660 3300005563 Bacteria 530
39 Ga0068856_100022472 3300005614 Bacteria 6132
40 Ga0070702_100270786 3300005615 Bacteria 1161
41 Ga0068859_100161097 3300005617 Bacteria 2323
42 Ga0068859_101541388 3300005617 Bacteria 734
43 Ga0068864_100858040 3300005618 Bacteria 895
44 Ga0068866_10163115 3300005718 Bacteria 1301
45 Ga0068866_10759676 3300005718 Bacteria 670
46 Ga0068863_100022373 3300005841 Bacteria 6036
47 Ga0068858_101253377 3300005842 Bacteria 729
48 Ga0081455_10128774 3300005937 Bacteria 1982
49 Ga0070717_10090726 3300006028 Bacteria 2579
50 Ga0097621_101644347 3300006237 Unclassified 611
51 Ga0075428_100811502 3300006844 Bacteria 994
52 Ga0075430_100121044 3300006846 Bacteria 2182
53 Ga0075430_101550534 3300006846 Unclassified 544
54 Ga0075430_101679557 3300006846 Bacteria 521
55 Ga0075434_101097494 3300006871 Bacteria 809
56 Ga0097620_100161102 3300006931 Bacteria 2323
57 Ga0097620_101541497 3300006931 Bacteria 734
58 Ga0075435_100151679 3300007076 Bacteria 1949
59 Ga0111539_10986455 3300009094 Unclassified 979
60 Ga0105245_10000089 3300009098 Bacteria 92068
61 Ga0105245_10224706 3300009098 Bacteria 1813
62 Ga0105243_10232819 3300009148 Bacteria 1635
63 Ga0105237_10466275 3300009545 Bacteria 1269
64 Ga0105249_10250324 3300009553 Bacteria 1756
65 Ga0105249_10737119 3300009553 Bacteria 1047
66 Ga0105239_10537677 3300010375 Bacteria 1330
67 Ga0157378_11016632 3300013297 Bacteria 864
68 Ga0157380_10250444 3300014326 Bacteria 1603
69 Ga0157379_10530674 3300014968 Bacteria 1093
70 Ga0157376_10007072 3300014969 Bacteria 7967
71 Ga0157376_10252591 3300014969 Bacteria 1648
72 Ga0157376_10306106 3300014969 Bacteria 1506
73 Ga0207642_10158172 3300025899 Bacteria 1214
74 Ga0207680_10335683 3300025903 Bacteria 1059
75 Ga0207671_10547953 3300025914 Bacteria 922
76 Ga0207662_10224485 3300025918 Bacteria 1224
77 Ga0207662_10421622 3300025918 Unclassified 908
78 Ga0207652_10226351 3300025921 Bacteria 1686
79 Ga0207652_10502410 3300025921 Bacteria 1092
80 Ga0207652_10557954 3300025921 Bacteria 1029
81 Ga0207652_11027223 3300025921 Bacteria 724
82 Ga0207687_10000029 3300025927 Bacteria 156754
83 Ga0207687_10097682 3300025927 Bacteria 2155
84 Ga0207709_10135834 3300025935 Bacteria 1683
85 Ga0207670_10004141 3300025936 Bacteria 7768
86 Ga0207670_10031855 3300025936 Bacteria 3385
87 Ga0207670_10287930 3300025936 Bacteria 1282
88 Ga0207670_11019330 3300025936 Bacteria 697
89 Ga0207665_11036330 3300025939 Bacteria 653
90 Ga0207711_10557282 3300025941 Bacteria 1069
91 Ga0207689_10027436 3300025942 Bacteria 4766
92 Ga0207689_10151164 3300025942 Bacteria 1914
93 Ga0207689_10397410 3300025942 Bacteria 1149
94 Ga0207661_10458953 3300025944 Bacteria 1161
95 Ga0207679_12198248 3300025945 Bacteria 500
96 Ga0207667_11990477 3300025949 Bacteria 541
97 Ga0207651_10211415 3300025960 Bacteria 1562
98 Ga0207712_10033473 3300025961 Bacteria 3475
99 Ga0207712_11361485 3300025961 Unclassified 635
100 Ga0207677_10377409 3300026023 Bacteria 1196
101 Ga0207703_11963629 3300026035 Bacteria 561
102 Ga0207703_12247790 3300026035 Bacteria 521
103 Ga0207708_10177987 3300026075 Bacteria 1687
104 Ga0207708_10258478 3300026075 Bacteria 1405
105 Ga0207708_11050127 3300026075 Unclassified 709
106 Ga0207702_10987499 3300026078 Bacteria 835
107 Ga0207641_10010183 3300026088 Bacteria 7733
108 Ga0207641_10108075 3300026088 Bacteria 2462
109 Ga0207641_11145286 3300026088 Bacteria 777
110 Ga0207648_11961618 3300026089 Unclassified 547
111 Ga0207676_10121622 3300026095 Bacteria 2203
112 Ga0207674_10282021 3300026116 Bacteria 1609
113 Ga0207674_11999278 3300026116 Bacteria 545
114 Ga0268266_10082257 3300028379 Bacteria 2808
115 Ga0268266_11477704 3300028379 Unclassified 655
116 Ga0268264_10156429 3300028381 Bacteria 2049
117 Ga0307517_10021522 3300028786 Bacteria 8140
118 Ga0307515_10059973 3300028794 Bacteria 5440
119 Ga0307515_10218455 3300028794 Bacteria 1731
120 Ga0265338_10012798 3300028800 Bacteria 9540
121 Ga0265332_10064490 3300031238 Bacteria 1564
122 Ga0265325_10417114 3300031241 Unclassified 587
123 Ga0307513_10006310 3300031456 Bacteria 15529
124 Ga0307509_10002287 3300031507 Bacteria 31311
125 Ga0307509_10025639 3300031507 Bacteria 6581
126 Ga0307509_10063698 3300031507 Bacteria 3881
127 Ga0307509_10075246 3300031507 Bacteria 3508
128 Ga0307509_10179706 3300031507 Bacteria 1983
129 Ga0307509_10253158 3300031507 Bacteria 1543
130 Ga0307509_10492952 3300031507 Bacteria 911
131 Ga0307508_10005995 3300031616 Bacteria 11466
132 Ga0307508_10398743 3300031616 Bacteria 967
133 Ga0307516_10005332 3300031730 Bacteria 15455
134 Ga0307516_10034976 3300031730 Bacteria 5044
135 Ga0307415_100117452 3300032126 Bacteria 1987
136 Ga0307507_10201203 3300033179 Bacteria 1377
137 Ga0373949_0000136 3300035090 Bacteria 27349
138 Ga0373936_0000011 3300035113 Bacteria 248623
139 Ga0373956_0135702 3300035119 Bacteria 1154
140 Ga0373961_0000120 3300035241 Bacteria 39901
141 Ga0316574_0462326 3300035398 Unclassified 794
142 Ga0395900_0054756 3300037418 Bacteria 4107
143 Ga0395900_0130116 3300037418 Bacteria 2580
144 Ga0395905_0555855 3300037471 Bacteria 1049
145 Ga0395905_1218614 3300037471 Bacteria 656
146 Ga0395901_0036823 3300038443 Bacteria 5058
147 Ga0395901_1164875 3300038443 Bacteria 738
148 Ga0400486_02573 3300038742 Bacteria 1639
149 Ga0400486_31757 3300038742 Bacteria 1934
150 Ga0451807_1454606 3300041486 Bacteria 2130
151 Ga0451577_0705772 3300042876 Bacteria 913
152 Ga0466972_0053597 3300044658 Bacteria 1942
153 Ga0453684_0005808 3300044712 Bacteria 24045
154 Ga0453684_0252554 3300044712 Bacteria 2024
155 Ga0495583_0229181 3300046506 Bacteria 749
156 Ga0495630_1371166 3300046517 Bacteria 532
157 Ga0495632_0242422 3300046519 Bacteria 810
158 Ga0495622_0057360 3300046557 Bacteria 1805
159 Ga0495622_0388883 3300046557 Unclassified 602
160 Ga0495649_0171719 3300046694 Bacteria 1134
161 Ga0495649_0542428 3300046694 Bacteria 576
162 Ga0501033_0910302 3300049570 Bacteria 591
163 Ga0501034_0532806 3300049571 Bacteria 1085
164 Ga0501047_0006563 3300049581 Bacteria 10953
165 Ga0501047_0250725 3300049581 Bacteria 1619
166 Ga0501067_0097246 3300049583 Bacteria 1635
167 Ga0501067_0412888 3300049583 Bacteria 753
168 Ga0501069_0029365 3300049585 Bacteria 3017
169 Ga0501070_0021360 3300049586 Bacteria 5431
170 Ga0501070_0025085 3300049586 Bacteria 4999
171 Ga0501070_0072467 3300049586 Bacteria 2851
172 Ga0501070_0137441 3300049586 Bacteria 2018
173 Ga0501071_0255676 3300049587 Bacteria 1322
174 Ga0501071_0418287 3300049587 Bacteria 1024
175 Ga0501072_0774807 3300049588 Bacteria 752
176 Ga0501074_0494860 3300049590 Bacteria 866
177 Ga0501074_0502367 3300049590 Bacteria 859
178 Ga0501209_204660 3300049656 Bacteria 608
179 Ga0501227_008900 3300049665 Unclassified 2158
180 Ga0501230_005686 3300049667 Unclassified 1776
181 Ga0501233_025607 3300049668 Bacteria 1298
182 Ga0501079_1093732 3300049741 Unclassified 628
183 Ga0501080_0236390 3300049742 Bacteria 1669
184 Ga0501080_0332560 3300049742 Bacteria 1374
185 Ga0501083_0047187 3300049744 Bacteria 2911
186 Ga0501083_0087382 3300049744 Bacteria 2061
187 Ga0501083_0337399 3300049744 Bacteria 980
188 Ga0501044_0094021 3300049823 Bacteria 3023
189 nmdc:mga09592_13134_c1 3300050508 Bacteria 6758
190 nmdc:mga09592_380863_c1 3300050508 Bacteria 1220
191 nmdc:mga0qj67_1367068_c1 3300050509 Bacteria 547
192 nmdc:mga0qj67_1489581_c1 3300050509 Bacteria 521
193 nmdc:mga0qj67_169113_c1 3300050509 Bacteria 1775
194 nmdc:mga08y16_1678903_c1 3300050511 Bacteria 591
195 nmdc:mga0n895_586190_c1 3300050512 Bacteria 1118
196 nmdc:mga08x19_267168_c1 3300050514 Bacteria 1183
197 Ga0500635_0003979 3300053080 Bacteria 3767
198 Ga0500578_0256800 3300053086 Bacteria 1051
199 Ga0500578_0282356 3300053086 Bacteria 990
200 Ga0500578_0338124 3300053086 Bacteria 883
201 Ga0500646_0005942 3300053090 Bacteria 3096
202 Ga0500647_0162671 3300053091 Bacteria 1035
203 Ga0500583_0093845 3300053092 Unclassified 1463
204 Ga0500583_0400219 3300053092 Bacteria 659
205 Ga0500651_0193239 3300053093 Bacteria 1204
206 Ga0500566_0000824 3300053094 Bacteria 17698
207 Ga0500566_0002058 3300053094 Bacteria 11880
208 Ga0500566_0125372 3300053094 Bacteria 1380
209 Ga0500640_001419 3300053095 Bacteria 7253
210 Ga0500553_202312 3300053101 Unclassified 677
211 Ga0500554_003094 3300053102 Bacteria 3359
212 Ga0500554_005295 3300053102 Bacteria 2798
213 Ga0500554_024889 3300053102 Bacteria 1701
214 Ga0500562_029877 3300053108 Bacteria 1435
215 Ga0500572_038557 3300053111 Bacteria 1374
216 Ga0500594_0207001 3300053118 Bacteria 646
217 Ga0500595_002188 3300053119 Bacteria 9926
218 Ga0500597_014685 3300053120 Bacteria 2943
219 Ga0500597_062617 3300053120 Bacteria 1600
220 Ga0500614_000155 3300053123 Bacteria 17375
221 Ga0500614_009579 3300053123 Bacteria 2067
222 Ga0500614_011115 3300053123 Bacteria 1943
223 Ga0500614_082446 3300053123 Bacteria 902
224 Ga0500614_196720 3300053123 Unclassified 620
225 Ga0500617_294625 3300053124 Bacteria 513
226 Ga0500642_0022589 3300053130 Bacteria 2513
227 Ga0500658_0144774 3300053134 Bacteria 1068
228 Ga0500559_0003640 3300053136 Bacteria 7537
229 Ga0500568_0037110 3300053139 Bacteria 1979
230 Ga0500568_0064177 3300053139 Bacteria 1415
231 Ga0500579_103981 3300053143 Bacteria 1465
232 Ga0500585_109026 3300053144 Bacteria 994
233 Ga0500590_086859 3300053148 Bacteria 1525
234 Ga0500603_000737 3300053150 Bacteria 7972
235 Ga0500603_025898 3300053150 Bacteria 1479
236 Ga0500622_0007820 3300053156 Bacteria 6026
237 Ga0500636_0229515 3300053177 Bacteria 961
238 Ga0500636_0310228 3300053177 Bacteria 772
239 Ga0500637_0248577 3300053178 Bacteria 993
240 Ga0500637_0260913 3300053178 Bacteria 962
241 Ga0500601_004149 3300053737 Bacteria 1571
242 Ga0500661_071342 3300055283 Bacteria 636
243 Ga0501082_0012256 3300060353 Bacteria 7369

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0005808 Ga0453684_0005808_16392_16772 95
2 3300053086 Ga0500578_0338124 Ga0500578_0338124_49_411 105
3 3300005445 Ga0070708_100111664 Ga0070708_1001116641 106
4 3300031507 Ga0307509_10025639 Ga0307509_100256397 106
5 3300035398 Ga0316574_0462326 Ga0316574_0462326_217_582 109
6 3300049587 Ga0501071_0418287 Ga0501071_0418287_22_351 109
7 3300025945 Ga0207679_12198248 Ga0207679_121982482 111
8 3300038742 Ga0400486_02573 Ga0400486_02573_1048_1443 111
9 3300038742 Ga0400486_31757 Ga0400486_31757_1033_1422 111
10 3300037471 Ga0395905_0555855 Ga0395905_0555855_366_710 114
11 3300006844 Ga0075428_100811502 Ga0075428_1008115022 115
12 3300050508 nmdc:mga09592_380863_c1 nmdc:mga09592_380863_c1_718_1071 115
13 3300005337 Ga0070682_100193948 Ga0070682_1001939483 118
14 3300026088 Ga0207641_11145286 Ga0207641_111452862 118
15 3300035113 Ga0373936_0000011 Ga0373936_0000011_235237_235593 118
16 3300005334 Ga0068869_101387599 Ga0068869_1013875992 119
17 3300005548 Ga0070665_100099639 Ga0070665_1000996394 119
18 3300005563 Ga0068855_102366660 Ga0068855_1023666602 119
19 3300006237 Ga0097621_101644347 Ga0097621_1016443472 119
20 3300009098 Ga0105245_10000089 Ga0105245_1000008931 119
21 3300014969 Ga0157376_10252591 Ga0157376_102525912 119
22 3300014969 Ga0157376_10306106 Ga0157376_103061062 119
23 3300025927 Ga0207687_10000029 Ga0207687_1000002963 119
24 3300025941 Ga0207711_10557282 Ga0207711_105572822 119
25 3300025942 Ga0207689_10027436 Ga0207689_100274362 119
26 3300025949 Ga0207667_11990477 Ga0207667_119904772 119
27 3300028379 Ga0268266_10082257 Ga0268266_100822574 119
28 3300005335 Ga0070666_10279058 Ga0070666_102790582 120
29 3300005365 Ga0070688_101660778 Ga0070688_1016607781 120
30 3300006846 Ga0075430_100121044 Ga0075430_1001210442 120
31 3300014326 Ga0157380_10250444 Ga0157380_102504442 120
32 3300014968 Ga0157379_10530674 Ga0157379_105306742 120
33 3300025903 Ga0207680_10335683 Ga0207680_103356831 120
34 3300025918 Ga0207662_10224485 Ga0207662_102244851 120
35 3300026088 Ga0207641_10108075 Ga0207641_101080752 120
36 3300031507 Ga0307509_10075246 Ga0307509_100752463 120
37 3300031507 Ga0307509_10492952 Ga0307509_104929522 120
38 3300037418 Ga0395900_0054756 Ga0395900_0054756_374_736 120
39 3300038443 Ga0395901_0036823 Ga0395901_0036823_4636_4998 120
40 3300046694 Ga0495649_0542428 Ga0495649_0542428_135_497 120
41 3300049583 Ga0501067_0412888 Ga0501067_0412888_345_713 120
42 3300049586 Ga0501070_0025085 Ga0501070_0025085_2442_2810 120
43 3300049586 Ga0501070_0072467 Ga0501070_0072467_1715_2083 120
44 3300049587 Ga0501071_0255676 Ga0501071_0255676_426_794 120
45 3300049588 Ga0501072_0774807 Ga0501072_0774807_277_645 120
46 3300049590 Ga0501074_0502367 Ga0501074_0502367_260_628 120
47 3300049741 Ga0501079_1093732 Ga0501079_1093732_68_436 120
48 3300049742 Ga0501080_0236390 Ga0501080_0236390_197_565 120
49 3300049742 Ga0501080_0332560 Ga0501080_0332560_474_842 120
50 3300049744 Ga0501083_0047187 Ga0501083_0047187_728_1096 120
51 3300049744 Ga0501083_0087382 Ga0501083_0087382_848_1216 120
52 3300050509 nmdc:mga0qj67_169113_c1 nmdc:mga0qj67_169113_c1_258_620 120
53 3300060353 Ga0501082_0012256 Ga0501082_0012256_2435_2803 120
54 3300005329 Ga0070683_100460323 Ga0070683_1004603232 121
55 3300005330 Ga0070690_100021911 Ga0070690_1000219116 121
56 3300005330 Ga0070690_100416121 Ga0070690_1004161211 121
57 3300005334 Ga0068869_100277834 Ga0068869_1002778342 121
58 3300005338 Ga0068868_101396248 Ga0068868_1013962481 121
59 3300005340 Ga0070689_100228183 Ga0070689_1002281832 121
60 3300005340 Ga0070689_101742015 Ga0070689_1017420152 121
61 3300005343 Ga0070687_100381184 Ga0070687_1003811842 121
62 3300005343 Ga0070687_100835880 Ga0070687_1008358801 121
63 3300005364 Ga0070673_100191680 Ga0070673_1001916802 121
64 3300005365 Ga0070688_100573843 Ga0070688_1005738432 121
65 3300005367 Ga0070667_100361264 Ga0070667_1003612642 121
66 3300005436 Ga0070713_101175811 Ga0070713_1011758112 121
67 3300005438 Ga0070701_10110111 Ga0070701_101101112 121
68 3300005438 Ga0070701_10553271 Ga0070701_105532712 121
69 3300005441 Ga0070700_100076259 Ga0070700_1000762593 121
70 3300005441 Ga0070700_100568756 Ga0070700_1005687562 121
71 3300005444 Ga0070694_101801292 Ga0070694_1018012921 121
72 3300005466 Ga0070685_10812954 Ga0070685_108129542 121
73 3300005466 Ga0070685_11048040 Ga0070685_110480401 121
74 3300005518 Ga0070699_101846013 Ga0070699_1018460131 121
75 3300005530 Ga0070679_100725873 Ga0070679_1007258732 121
76 3300005530 Ga0070679_100787285 Ga0070679_1007872852 121
77 3300005544 Ga0070686_100344302 Ga0070686_1003443022 121
78 3300005544 Ga0070686_101575126 Ga0070686_1015751262 121
79 3300005548 Ga0070665_102266968 Ga0070665_1022669682 121
80 3300005615 Ga0070702_100270786 Ga0070702_1002707862 121
81 3300005617 Ga0068859_100161097 Ga0068859_1001610972 121
82 3300005617 Ga0068859_101541388 Ga0068859_1015413882 121
83 3300005618 Ga0068864_100858040 Ga0068864_1008580402 121
84 3300005718 Ga0068866_10163115 Ga0068866_101631152 121
85 3300005718 Ga0068866_10759676 Ga0068866_107596762 121
86 3300005841 Ga0068863_100022373 Ga0068863_1000223739 121
87 3300005842 Ga0068858_101253377 Ga0068858_1012533772 121
88 3300005937 Ga0081455_10128774 Ga0081455_101287743 121
89 3300006028 Ga0070717_10090726 Ga0070717_100907262 121
90 3300006846 Ga0075430_101550534 Ga0075430_1015505341 121
91 3300006846 Ga0075430_101679557 Ga0075430_1016795571 121
92 3300006871 Ga0075434_101097494 Ga0075434_1010974942 121
93 3300006931 Ga0097620_100161102 Ga0097620_1001611022 121
94 3300006931 Ga0097620_101541497 Ga0097620_1015414972 121
95 3300007076 Ga0075435_100151679 Ga0075435_1001516792 121
96 3300009094 Ga0111539_10986455 Ga0111539_109864552 121
97 3300009098 Ga0105245_10224706 Ga0105245_102247062 121
98 3300009148 Ga0105243_10232819 Ga0105243_102328193 121
99 3300009553 Ga0105249_10250324 Ga0105249_102503243 121
100 3300009553 Ga0105249_10737119 Ga0105249_107371192 121
101 3300013297 Ga0157378_11016632 Ga0157378_110166321 121
102 3300014969 Ga0157376_10007072 Ga0157376_100070724 121
103 3300025899 Ga0207642_10158172 Ga0207642_101581722 121
104 3300025918 Ga0207662_10421622 Ga0207662_104216222 121
105 3300025921 Ga0207652_10557954 Ga0207652_105579542 121
106 3300025921 Ga0207652_11027223 Ga0207652_110272232 121
107 3300025927 Ga0207687_10097682 Ga0207687_100976822 121
108 3300025935 Ga0207709_10135834 Ga0207709_101358342 121
109 3300025936 Ga0207670_10004141 Ga0207670_100041412 121
110 3300025936 Ga0207670_10031855 Ga0207670_100318554 121
111 3300025936 Ga0207670_10287930 Ga0207670_102879303 121
112 3300025936 Ga0207670_11019330 Ga0207670_110193302 121
113 3300025939 Ga0207665_11036330 Ga0207665_110363302 121
114 3300025942 Ga0207689_10151164 Ga0207689_101511642 121
115 3300025942 Ga0207689_10397410 Ga0207689_103974102 121
116 3300025944 Ga0207661_10458953 Ga0207661_104589532 121
117 3300025960 Ga0207651_10211415 Ga0207651_102114152 121
118 3300025961 Ga0207712_10033473 Ga0207712_100334736 121
119 3300025961 Ga0207712_11361485 Ga0207712_113614851 121
120 3300026023 Ga0207677_10377409 Ga0207677_103774092 121
121 3300026035 Ga0207703_11963629 Ga0207703_119636291 121
122 3300026035 Ga0207703_12247790 Ga0207703_122477902 121
123 3300026075 Ga0207708_10177987 Ga0207708_101779872 121
124 3300026075 Ga0207708_10258478 Ga0207708_102584782 121
125 3300026075 Ga0207708_11050127 Ga0207708_110501272 121
126 3300026088 Ga0207641_10010183 Ga0207641_100101834 121
127 3300026089 Ga0207648_11961618 Ga0207648_119616181 121
128 3300026095 Ga0207676_10121622 Ga0207676_101216223 121
129 3300026116 Ga0207674_11999278 Ga0207674_119992782 121
130 3300028379 Ga0268266_11477704 Ga0268266_114777042 121
131 3300028381 Ga0268264_10156429 Ga0268264_101564293 121
132 3300028786 Ga0307517_10021522 Ga0307517_100215222 121
133 3300028794 Ga0307515_10059973 Ga0307515_100599733 121
134 3300028794 Ga0307515_10218455 Ga0307515_102184553 121
135 3300031238 Ga0265332_10064490 Ga0265332_100644902 121
136 3300031456 Ga0307513_10006310 Ga0307513_1000631010 121
137 3300031507 Ga0307509_10002287 Ga0307509_1000228714 121
138 3300031507 Ga0307509_10179706 Ga0307509_101797063 121
139 3300031507 Ga0307509_10253158 Ga0307509_102531581 121
140 3300031616 Ga0307508_10005995 Ga0307508_100059957 121
141 3300031616 Ga0307508_10398743 Ga0307508_103987432 121
142 3300031730 Ga0307516_10005332 Ga0307516_1000533213 121
143 3300031730 Ga0307516_10034976 Ga0307516_100349762 121
144 3300032126 Ga0307415_100117452 Ga0307415_1001174525 121
145 3300033179 Ga0307507_10201203 Ga0307507_102012033 121
146 3300035090 Ga0373949_0000136 Ga0373949_0000136_20450_20818 121
147 3300035119 Ga0373956_0135702 Ga0373956_0135702_408_776 121
148 3300035241 Ga0373961_0000120 Ga0373961_0000120_12591_12959 121
149 3300037418 Ga0395900_0130116 Ga0395900_0130116_467_841 121
150 3300037471 Ga0395905_1218614 Ga0395905_1218614_184_549 121
151 3300038443 Ga0395901_1164875 Ga0395901_1164875_79_453 121
152 3300044658 Ga0466972_0053597 Ga0466972_0053597_843_1235 121
153 3300046506 Ga0495583_0229181 Ga0495583_0229181_236_604 121
154 3300046517 Ga0495630_1371166 Ga0495630_1371166_153_521 121
155 3300046519 Ga0495632_0242422 Ga0495632_0242422_40_408 121
156 3300046557 Ga0495622_0057360 Ga0495622_0057360_850_1218 121
157 3300046557 Ga0495622_0388883 Ga0495622_0388883_212_580 121
158 3300046694 Ga0495649_0171719 Ga0495649_0171719_395_763 121
159 3300049571 Ga0501034_0532806 Ga0501034_0532806_348_719 121
160 3300049581 Ga0501047_0006563 Ga0501047_0006563_824_1195 121
161 3300049586 Ga0501070_0137441 Ga0501070_0137441_412_783 121
162 3300049590 Ga0501074_0494860 Ga0501074_0494860_40_411 121
163 3300049656 Ga0501209_204660 Ga0501209_204660_197_571 121
164 3300049665 Ga0501227_008900 Ga0501227_008900_964_1338 121
165 3300049667 Ga0501230_005686 Ga0501230_005686_857_1231 121
166 3300049668 Ga0501233_025607 Ga0501233_025607_757_1131 121
167 3300049823 Ga0501044_0094021 Ga0501044_0094021_1805_2176 121
168 3300050509 nmdc:mga0qj67_1367068_c1 nmdc:mga0qj67_1367068_c1_145_510 121
169 3300050509 nmdc:mga0qj67_1489581_c1 nmdc:mga0qj67_1489581_c1_58_423 121
170 3300050511 nmdc:mga08y16_1678903_c1 nmdc:mga08y16_1678903_c1_179_547 121
171 3300050512 nmdc:mga0n895_586190_c1 nmdc:mga0n895_586190_c1_482_859 121
172 3300050514 nmdc:mga08x19_267168_c1 nmdc:mga08x19_267168_c1_80_457 121
173 3300053080 Ga0500635_0003979 Ga0500635_0003979_955_1323 121
174 3300053086 Ga0500578_0256800 Ga0500578_0256800_537_905 121
175 3300053086 Ga0500578_0282356 Ga0500578_0282356_403_771 121
176 3300053090 Ga0500646_0005942 Ga0500646_0005942_1314_1682 121
177 3300053091 Ga0500647_0162671 Ga0500647_0162671_475_849 121
178 3300053092 Ga0500583_0093845 Ga0500583_0093845_566_931 121
179 3300053092 Ga0500583_0400219 Ga0500583_0400219_244_612 121
180 3300053093 Ga0500651_0193239 Ga0500651_0193239_260_628 121
181 3300053094 Ga0500566_0000824 Ga0500566_0000824_13367_13735 121
182 3300053094 Ga0500566_0002058 Ga0500566_0002058_10883_11257 121
183 3300053094 Ga0500566_0125372 Ga0500566_0125372_759_1127 121
184 3300053095 Ga0500640_001419 Ga0500640_001419_4281_4655 121
185 3300053101 Ga0500553_202312 Ga0500553_202312_117_494 121
186 3300053102 Ga0500554_003094 Ga0500554_003094_204_578 121
187 3300053102 Ga0500554_005295 Ga0500554_005295_567_935 121
188 3300053102 Ga0500554_024889 Ga0500554_024889_536_904 121
189 3300053108 Ga0500562_029877 Ga0500562_029877_644_1012 121
190 3300053111 Ga0500572_038557 Ga0500572_038557_823_1197 121
191 3300053118 Ga0500594_0207001 Ga0500594_0207001_212_580 121
192 3300053119 Ga0500595_002188 Ga0500595_002188_2449_2823 121
193 3300053120 Ga0500597_014685 Ga0500597_014685_2273_2641 121
194 3300053120 Ga0500597_062617 Ga0500597_062617_1058_1432 121
195 3300053123 Ga0500614_000155 Ga0500614_000155_6791_7165 121
196 3300053123 Ga0500614_009579 Ga0500614_009579_1515_1883 121
197 3300053123 Ga0500614_011115 Ga0500614_011115_490_858 121
198 3300053123 Ga0500614_082446 Ga0500614_082446_137_505 121
199 3300053123 Ga0500614_196720 Ga0500614_196720_210_578 121
200 3300053124 Ga0500617_294625 Ga0500617_294625_128_496 121
201 3300053130 Ga0500642_0022589 Ga0500642_0022589_887_1255 121
202 3300053134 Ga0500658_0144774 Ga0500658_0144774_215_583 121
203 3300053136 Ga0500559_0003640 Ga0500559_0003640_2871_3245 121
204 3300053139 Ga0500568_0037110 Ga0500568_0037110_460_825 121
205 3300053139 Ga0500568_0064177 Ga0500568_0064177_95_466 121
206 3300053143 Ga0500579_103981 Ga0500579_103981_655_1023 121
207 3300053144 Ga0500585_109026 Ga0500585_109026_477_845 121
208 3300053148 Ga0500590_086859 Ga0500590_086859_114_482 121
209 3300053150 Ga0500603_000737 Ga0500603_000737_3899_4267 121
210 3300053150 Ga0500603_025898 Ga0500603_025898_147_515 121
211 3300053156 Ga0500622_0007820 Ga0500622_0007820_584_952 121
212 3300053177 Ga0500636_0229515 Ga0500636_0229515_119_496 121
213 3300053177 Ga0500636_0310228 Ga0500636_0310228_290_658 121
214 3300053178 Ga0500637_0248577 Ga0500637_0248577_359_727 121
215 3300053178 Ga0500637_0260913 Ga0500637_0260913_501_869 121
216 3300053737 Ga0500601_004149 Ga0500601_004149_1010_1384 121
217 3300055283 Ga0500661_071342 Ga0500661_071342_27_395 121
218 3300005329 Ga0070683_100375476 Ga0070683_1003754762 122
219 3300005336 Ga0070680_101515573 Ga0070680_1015155731 122
220 3300005530 Ga0070679_100117426 Ga0070679_1001174266 122
221 3300005530 Ga0070679_100304788 Ga0070679_1003047882 122
222 3300005535 Ga0070684_102050756 Ga0070684_1020507561 122
223 3300005614 Ga0068856_100022472 Ga0068856_1000224725 122
224 3300009545 Ga0105237_10466275 Ga0105237_104662752 122
225 3300010375 Ga0105239_10537677 Ga0105239_105376772 122
226 3300025914 Ga0207671_10547953 Ga0207671_105479532 122
227 3300025921 Ga0207652_10226351 Ga0207652_102263512 122
228 3300025921 Ga0207652_10502410 Ga0207652_105024102 122
229 3300026078 Ga0207702_10987499 Ga0207702_109874992 122
230 3300026116 Ga0207674_10282021 Ga0207674_102820212 122
231 3300028800 Ga0265338_10012798 Ga0265338_100127983 122
232 3300031241 Ga0265325_10417114 Ga0265325_104171141 122
233 3300031507 Ga0307509_10063698 Ga0307509_100636982 122
234 3300041486 Ga0451807_1454606 Ga0451807_1454606_1352_1720 122
235 3300042876 Ga0451577_0705772 Ga0451577_0705772_427_795 122
236 3300044712 Ga0453684_0252554 Ga0453684_0252554_342_710 122
237 3300049570 Ga0501033_0910302 Ga0501033_0910302_186_554 122
238 3300049581 Ga0501047_0250725 Ga0501047_0250725_277_672 122
239 3300049583 Ga0501067_0097246 Ga0501067_0097246_560_928 122
240 3300049585 Ga0501069_0029365 Ga0501069_0029365_979_1347 122
241 3300049586 Ga0501070_0021360 Ga0501070_0021360_4322_4690 122
242 3300049744 Ga0501083_0337399 Ga0501083_0337399_13_381 122
243 3300050508 nmdc:mga09592_13134_c1 nmdc:mga09592_13134_c1_3166_3540 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

32

78

0.98

PF12840

HTH_20

Helix-turn-helix domain

30

79

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9341 35 80
2acj-assembly1.cif.gz_D crystal structure of the b/z junction containing dna bound to z-dna binding proteins 0.9131 23 82
1wq2-assembly1.cif.gz_B neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.9111 23 81
3irq-assembly1.cif.gz_D crystal structure of a z-z junction 0.908 22 82
2jt1-assembly1.cif.gz_A solution nmr structure of pefi (plasmid-encoded fimbriae regulatory) protein from salmonella typhimurium. northeast structural genomics target str82 0.9019 38 82
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9635 23 79 1.10.10.10
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9489 38 70 1.10.10.10
3r61B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9441 40 68 1.10.10.10
af_I6Y8F7_1_97_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9403 37 82 1.10.10.10
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9386 23 81 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3B9LEH8-F1-model_v4 HTH arsR-type domain-containing protein 0.954 15 100 GO:0003700
AF-A0A6L4ZP78-F1-model_v4 Putative transcriptional regulator 0.9465 14 95 GO:0003700
AF-A0A7Y4IWT9-F1-model_v4 deleted 0.9444 2 122
AF-A0A838U402-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9378 9 104 GO:0003700
AF-A0A7Y4IWT9-F1-model_v4 deleted 0.9368 2 122

Feature Viewer

pLDDT pTM Quality
86.19 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map