F355767

General Info

Members Datasets Scaffolds Average Seq Length
243 129 484 229

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0001391|Ga0316574_0001391_3147_3890
Length 247
Sequence MNDPSDGLPQRRGRAPAIKTQAFLAKLPMFSEMSPPELDRVAAGTQVHHLAKGDVVFRTGDPCVGFHVVVFGQVKLGFTSPQGVEKVVEIVRPGSSFGEALMFLDKPYIVTAQALADSMLLHVGKRTVLEELERDPGFARRMLSGLSRKLHGLVRDVEAYTLRSGAERVIGYLLRDVPDGLSEGAVEVSLTPGKSVIASRLNMTPEHFSRILHDLAASGLIEVEGRLVRIRDLARLRGSDAPEFPNR

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
60 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
61 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
62 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
63 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
69 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
70 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
71 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
76 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
77 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
78 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
79 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
80 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
81 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
82 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
85 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
86 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
87 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
111 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
124 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
127 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
128 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
129 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 2.06
Rhizosphere 94.24
Stem 0
Stem Tuber 0
Unclassified 6.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0001391 3300035398 Bacteria 11431
2 Ga0055525_1000047 3300003759 Bacteria 261507
3 Ga0065715_10115898 3300005293 Bacteria 2399
4 Ga0065707_10279626 3300005295 Bacteria 1051
5 Ga0070670_100063619 3300005331 Bacteria 3167
6 Ga0070660_100174773 3300005339 Bacteria 1736
7 Ga0070689_100042700 3300005340 Bacteria 3482
8 Ga0070687_100011582 3300005343 Bacteria 3863
9 Ga0070659_100076363 3300005366 Bacteria 2671
10 Ga0070700_100282027 3300005441 Bacteria 1205
11 Ga0070695_100020430 3300005545 Bacteria 4044
12 Ga0070696_100095290 3300005546 Bacteria 2125
13 Ga0070665_100090620 3300005548 Bacteria 3063
14 Ga0068857_100157852 3300005577 Bacteria 2057
15 Ga0068859_100165231 3300005617 Bacteria 2293
16 Ga0068859_100242056 3300005617 Bacteria 1893
17 Ga0068864_100100824 3300005618 Bacteria 2560
18 Ga0068861_100115808 3300005719 Bacteria 2154
19 Ga0068863_100078325 3300005841 Bacteria 3130
20 Ga0068858_100088228 3300005842 Bacteria 2885
21 Ga0068862_100026802 3300005844 Bacteria 4847
22 Ga0068862_100046754 3300005844 Bacteria 3692
23 Ga0075428_100155629 3300006844 Unclassified 2483
24 Ga0075428_100637743 3300006844 Unclassified 1136
25 Ga0075430_100292572 3300006846 Bacteria 1347
26 Ga0075430_100397522 3300006846 Unclassified 1137
27 Ga0075431_100041277 3300006847 Bacteria 4756
28 Ga0075429_100000139 3300006880 Bacteria 43971
29 Ga0075429_100290533 3300006880 Unclassified 1431
30 Ga0097620_100165233 3300006931 Bacteria 2293
31 Ga0097620_100242056 3300006931 Bacteria 1893
32 Ga0105244_10072614 3300009036 Bacteria 1714
33 Ga0111539_10023964 3300009094 Bacteria 7497
34 Ga0111539_10141055 3300009094 Bacteria 2821
35 Ga0111539_10170147 3300009094 Bacteria 2546
36 Ga0105245_10240698 3300009098 Bacteria 1754
37 Ga0114129_10000447 3300009147 Bacteria 49149
38 Ga0114129_10570095 3300009147 Bacteria 1470
39 Ga0105248_10313868 3300009177 Bacteria 1766
40 Ga0105249_10195496 3300009553 Bacteria 1977
41 Ga0157373_10623724 3300013100 Bacteria 786
42 Ga0157369_10605769 3300013105 Bacteria 1131
43 Ga0163163_10112764 3300014325 Bacteria 2749
44 Ga0209563_100003 3300025230 Bacteria 1932942
45 Ga0209677_105638 3300025253 Bacteria 3208
46 Ga0207643_10406339 3300025908 Bacteria 862
47 Ga0207657_10029067 3300025919 Bacteria 5037
48 Ga0207650_10504662 3300025925 Bacteria 1011
49 Ga0207687_10154508 3300025927 Bacteria 1754
50 Ga0207690_10012877 3300025932 Bacteria 5012
51 Ga0207670_10056539 3300025936 Bacteria 2657
52 Ga0207703_10070145 3300026035 Bacteria 2892
53 Ga0207674_10290474 3300026116 Unclassified 1583
54 Ga0207675_100296745 3300026118 Bacteria 1573
55 Ga0209969_1002059 3300027360 Bacteria 2773
56 Ga0209967_1001687 3300027364 Bacteria 2842
57 Ga0210000_1002546 3300027462 Bacteria 2600
58 Ga0209995_1032802 3300027471 Bacteria 872
59 Ga0209968_1003146 3300027526 Bacteria 2476
60 Ga0209999_1012878 3300027543 Bacteria 1517
61 Ga0209970_1020460 3300027614 Bacteria 1118
62 Ga0209971_1007392 3300027682 Bacteria 2606
63 Ga0209974_10124587 3300027876 Bacteria 915
64 Ga0207428_10000567 3300027907 Bacteria 43782
65 Ga0207428_10324469 3300027907 Bacteria 1137
66 Ga0268265_10044043 3300028380 Bacteria 3321
67 Ga0265338_10002155 3300028800 Bacteria 30256
68 Ga0307414_10116172 3300032004 Bacteria 2048
69 Ga0373939_0009015 3300035114 Bacteria 2462
70 Ga0373941_0026979 3300035115 Bacteria 1673
71 Ga0373941_0079164 3300035115 Bacteria 1107
72 Ga0373956_0087107 3300035119 Bacteria 1438
73 Ga0373931_0013575 3300035691 Bacteria 3969
74 Ga0373927_0011481 3300035695 Bacteria 5901
75 Ga0395899_0003736 3300037312 Bacteria 12023
76 Ga0395900_0000148 3300037418 Bacteria 117889
77 Ga0395900_0091200 3300037418 Bacteria 3131
78 Ga0395900_0132064 3300037418 Bacteria 2558
79 Ga0395898_0377932 3300037466 Bacteria 1351
80 Ga0395901_0026581 3300038443 Bacteria 5943
81 Ga0439461_0011211 3300041410 Bacteria 1660
82 Ga0439461_0020795 3300041410 Bacteria 1303
83 Ga0439446_0026437 3300042156 Unclassified 1663
84 Ga0439434_0003329 3300042435 Bacteria 4713
85 Ga0439434_0029172 3300042435 Bacteria 1672
86 Ga0439435_0000017 3300042436 Bacteria 18590
87 Ga0451577_0196639 3300042876 Unclassified 1820
88 Ga0451577_0227981 3300042876 Bacteria 1684
89 Ga0451577_0281263 3300042876 Bacteria 1507
90 Ga0453684_0028396 3300044712 Bacteria 7983
91 Ga0451576_0001868 3300045051 Bacteria 33951
92 Ga0451576_0098371 3300045051 Bacteria 3043
93 Ga0451576_0189145 3300045051 Bacteria 2150
94 Ga0495580_0181763 3300046472 Bacteria 1452
95 Ga0495583_0018017 3300046506 Bacteria 3732
96 Ga0495642_0115317 3300046528 Bacteria 1151
97 Ga0495597_0209870 3300046542 Bacteria 777
98 Ga0495661_0000109 3300046665 Bacteria 97921
99 Ga0496100_0000756 3300048903 Bacteria 15379
100 Ga0496101_0000383 3300048904 Bacteria 29305
101 Ga0496102_0162571 3300048905 Bacteria 2100
102 Ga0496104_0673539 3300048907 Bacteria 943
103 Ga0496113_0035323 3300048916 Bacteria 3654
104 Ga0496122_0003746 3300048925 Bacteria 19616
105 Ga0496123_0018431 3300048926 Bacteria 5556
106 Ga0496124_0057392 3300048927 Bacteria 3280
107 Ga0501031_0003832 3300049568 Bacteria 9673
108 Ga0501031_0011314 3300049568 Bacteria 5815
109 Ga0501031_0059203 3300049568 Bacteria 2496
110 Ga0501031_0111022 3300049568 Bacteria 1790
111 Ga0501031_0139423 3300049568 Bacteria 1585
112 Ga0501032_0005305 3300049569 Bacteria 9587
113 Ga0501033_0004845 3300049570 Bacteria 10725
114 Ga0501033_0025910 3300049570 Bacteria 4415
115 Ga0501033_0041477 3300049570 Bacteria 3434
116 Ga0501033_0073888 3300049570 Bacteria 2503
117 Ga0501034_0026286 3300049571 Bacteria 5928
118 Ga0501034_0039524 3300049571 Bacteria 4778
119 Ga0501034_0097355 3300049571 Bacteria 2938
120 Ga0501036_0001955 3300049572 Bacteria 15995
121 Ga0501036_0005508 3300049572 Bacteria 10264
122 Ga0501036_0008443 3300049572 Bacteria 8439
123 Ga0501036_0231916 3300049572 Bacteria 1549
124 Ga0501036_0337399 3300049572 Bacteria 1259
125 Ga0501036_0507752 3300049572 Bacteria 1003
126 Ga0501037_0015077 3300049573 Bacteria 5685
127 Ga0501037_0018419 3300049573 Bacteria 5147
128 Ga0501037_0154321 3300049573 Bacteria 1640
129 Ga0501037_0179706 3300049573 Bacteria 1502
130 Ga0501038_0000995 3300049574 Bacteria 25500
131 Ga0501038_0003636 3300049574 Bacteria 14357
132 Ga0501038_0135560 3300049574 Bacteria 2018
133 Ga0501038_0472795 3300049574 Bacteria 961
134 Ga0501039_0003060 3300049575 Bacteria 12508
135 Ga0501039_0008001 3300049575 Bacteria 8056
136 Ga0501039_0039676 3300049575 Bacteria 3636
137 Ga0501040_0008873 3300049576 Bacteria 6535
138 Ga0501040_0012072 3300049576 Bacteria 5654
139 Ga0501040_0212287 3300049576 Bacteria 1376
140 Ga0501040_0212928 3300049576 Unclassified 1374
141 Ga0501040_0473476 3300049576 Unclassified 902
142 Ga0501041_0000561 3300049577 Bacteria 19281
143 Ga0501041_0009331 3300049577 Bacteria 5778
144 Ga0501041_0041562 3300049577 Bacteria 2793
145 Ga0501041_0248471 3300049577 Bacteria 1118
146 Ga0501042_0008568 3300049578 Bacteria 6763
147 Ga0501043_0001765 3300049579 Bacteria 18597
148 Ga0501043_0024927 3300049579 Bacteria 4693
149 Ga0501043_0473599 3300049579 Bacteria 938
150 Ga0501046_0002728 3300049580 Bacteria 16438
151 Ga0501046_0020897 3300049580 Bacteria 5406
152 Ga0501046_0054536 3300049580 Bacteria 3144
153 Ga0501046_0070439 3300049580 Bacteria 2719
154 Ga0501046_0234490 3300049580 Bacteria 1355
155 Ga0501046_0437579 3300049580 Bacteria 941
156 Ga0501047_0004646 3300049581 Bacteria 12919
157 Ga0501048_0001103 3300049582 Bacteria 20271
158 Ga0501048_0084272 3300049582 Bacteria 2241
159 Ga0501048_0176120 3300049582 Bacteria 1516
160 Ga0501068_0059088 3300049584 Unclassified 2328
161 Ga0501068_0106652 3300049584 Bacteria 1739
162 Ga0501068_0128958 3300049584 Bacteria 1581
163 Ga0501071_0004717 3300049587 Bacteria 8668
164 Ga0501071_0010540 3300049587 Bacteria 6199
165 Ga0501071_0014561 3300049587 Bacteria 5380
166 Ga0501071_0077836 3300049587 Unclassified 2423
167 Ga0501071_0156572 3300049587 Bacteria 1701
168 Ga0501072_0001673 3300049588 Bacteria 16502
169 Ga0501072_0006388 3300049588 Bacteria 8978
170 Ga0501072_0007318 3300049588 Bacteria 8373
171 Ga0501072_0063870 3300049588 Bacteria 2904
172 Ga0501072_0148336 3300049588 Bacteria 1870
173 Ga0501073_0079519 3300049589 Bacteria 2282
174 Ga0501074_0003628 3300049590 Bacteria 10960
175 Ga0501074_0192180 3300049590 Bacteria 1455
176 Ga0501075_0000592 3300049591 Bacteria 22113
177 Ga0501075_0007040 3300049591 Bacteria 7772
178 Ga0501075_0007260 3300049591 Bacteria 7683
179 Ga0501075_0020999 3300049591 Bacteria 4758
180 Ga0501075_0021241 3300049591 Bacteria 4731
181 Ga0501075_0039711 3300049591 Bacteria 3522
182 Ga0501075_0197553 3300049591 Unclassified 1534
183 Ga0501075_0274012 3300049591 Bacteria 1286
184 Ga0501076_0001116 3300049592 Bacteria 17698
185 Ga0501076_0002334 3300049592 Bacteria 13001
186 Ga0501076_0005105 3300049592 Bacteria 9398
187 Ga0501076_0121257 3300049592 Bacteria 2117
188 Ga0501076_0195383 3300049592 Bacteria 1652
189 Ga0501077_0011933 3300049593 Bacteria 5435
190 Ga0501077_0049886 3300049593 Bacteria 2660
191 Ga0501077_0057131 3300049593 Bacteria 2478
192 Ga0501225_0034168 3300049705 Bacteria 1400
193 Ga0501079_0001780 3300049741 Bacteria 15385
194 Ga0501079_0008059 3300049741 Bacteria 7981
195 Ga0501079_0068818 3300049741 Bacteria 2733
196 Ga0501079_0073542 3300049741 Bacteria 2642
197 Ga0501080_0008213 3300049742 Bacteria 9452
198 Ga0501080_0012461 3300049742 Bacteria 7795
199 Ga0501080_0044177 3300049742 Bacteria 4148
200 Ga0501080_0165376 3300049742 Bacteria 2042
201 Ga0501081_0001151 3300049743 Bacteria 16008
202 Ga0501081_0007310 3300049743 Bacteria 7172
203 Ga0501081_0015894 3300049743 Bacteria 4970
204 Ga0501081_0072170 3300049743 Bacteria 2407
205 Ga0501081_0103628 3300049743 Bacteria 2013
206 Ga0501081_0286412 3300049743 Bacteria 1207
207 Ga0501083_0072544 3300049744 Bacteria 2289
208 Ga0501083_0310751 3300049744 Bacteria 1025
209 Ga0501035_0000704 3300049822 Bacteria 36379
210 Ga0501035_0005368 3300049822 Bacteria 12119
211 Ga0501044_0004450 3300049823 Bacteria 15678
212 Ga0501044_0070909 3300049823 Bacteria 3544
213 Ga0501044_0581983 3300049823 Unclassified 1014
214 Ga0501045_0001465 3300049824 Bacteria 15696
215 Ga0501045_0003867 3300049824 Bacteria 10302
216 Ga0501045_0020165 3300049824 Bacteria 4760
217 Ga0501045_0237343 3300049824 Unclassified 1357
218 nmdc:mga05p37_646_c1 3300050507 Bacteria 38534
219 nmdc:mga09592_152114_c1 3300050508 Bacteria 1997
220 nmdc:mga09592_931_c1 3300050508 Bacteria 22983
221 nmdc:mga06r32_113161_c1 3300050510 Bacteria 2671
222 nmdc:mga08y16_140668_c1 3300050511 Bacteria 2509
223 nmdc:mga08y16_50704_c1 3300050511 Bacteria 4343
224 nmdc:mga08y16_929_c1 3300050511 Bacteria 28430
225 Ga0501084_0002391 3300054114 Bacteria 15096
226 Ga0501084_0008964 3300054114 Bacteria 8275
227 Ga0501084_0019714 3300054114 Bacteria 5620
228 Ga0501084_0064420 3300054114 Bacteria 3068
229 Ga0501084_0612977 3300054114 Unclassified 919
230 Ga0590077_032110 3300059426 Unclassified 1149
231 Ga0501082_0003505 3300060353 Bacteria 13694
232 Ga0501082_0010749 3300060353 Bacteria 7879
233 Ga0501082_0216365 3300060353 Bacteria 1667
234 Ga0501082_0244998 3300060353 Bacteria 1560
235 Ga0501082_0343397 3300060353 Bacteria 1301
236 Ga0530510_0000172 3300061734 Bacteria 39473
237 Ga0530510_0000715 3300061734 Bacteria 21548
238 Ga0530510_0004843 3300061734 Bacteria 9313
239 Ga0530510_0178606 3300061734 Bacteria 1574
240 2516023319 2515154189 Bacteria 9629850
241 2526210961 2526164512 Bacteria 4025691
242 2883091117 2883087390 Bacteria 9532701
243 Ga0316574_0001391
244 Ga0055525_1000047
245 Ga0065715_10115898
246 Ga0065707_10279626
247 Ga0070670_100063619
248 Ga0070660_100174773
249 Ga0070689_100042700
250 Ga0070687_100011582
251 Ga0070659_100076363
252 Ga0070700_100282027
253 Ga0070695_100020430
254 Ga0070696_100095290
255 Ga0070665_100090620
256 Ga0068857_100157852
257 Ga0068859_100165231
258 Ga0068859_100242056
259 Ga0068864_100100824
260 Ga0068861_100115808
261 Ga0068863_100078325
262 Ga0068858_100088228
263 Ga0068862_100026802
264 Ga0068862_100046754
265 Ga0075428_100155629
266 Ga0075428_100637743
267 Ga0075430_100292572
268 Ga0075430_100397522
269 Ga0075431_100041277
270 Ga0075429_100000139
271 Ga0075429_100290533
272 Ga0097620_100165233
273 Ga0097620_100242056
274 Ga0105244_10072614
275 Ga0111539_10023964
276 Ga0111539_10141055
277 Ga0111539_10170147
278 Ga0105245_10240698
279 Ga0114129_10000447
280 Ga0114129_10570095
281 Ga0105248_10313868
282 Ga0105249_10195496
283 Ga0157373_10623724
284 Ga0157369_10605769
285 Ga0163163_10112764
286 Ga0209563_100003
287 Ga0209677_105638
288 Ga0207643_10406339
289 Ga0207657_10029067
290 Ga0207650_10504662
291 Ga0207687_10154508
292 Ga0207690_10012877
293 Ga0207670_10056539
294 Ga0207703_10070145
295 Ga0207674_10290474
296 Ga0207675_100296745
297 Ga0209969_1002059
298 Ga0209967_1001687
299 Ga0210000_1002546
300 Ga0209995_1032802
301 Ga0209968_1003146
302 Ga0209999_1012878
303 Ga0209970_1020460
304 Ga0209971_1007392
305 Ga0209974_10124587
306 Ga0207428_10000567
307 Ga0207428_10324469
308 Ga0268265_10044043
309 Ga0265338_10002155
310 Ga0307414_10116172
311 Ga0373939_0009015
312 Ga0373941_0026979
313 Ga0373941_0079164
314 Ga0373956_0087107
315 Ga0373931_0013575
316 Ga0373927_0011481
317 Ga0395899_0003736
318 Ga0395900_0000148
319 Ga0395900_0091200
320 Ga0395900_0132064
321 Ga0395898_0377932
322 Ga0395901_0026581
323 Ga0439461_0011211
324 Ga0439461_0020795
325 Ga0439446_0026437
326 Ga0439434_0003329
327 Ga0439434_0029172
328 Ga0439435_0000017
329 Ga0451577_0196639
330 Ga0451577_0227981
331 Ga0451577_0281263
332 Ga0453684_0028396
333 Ga0451576_0001868
334 Ga0451576_0098371
335 Ga0451576_0189145
336 Ga0495580_0181763
337 Ga0495583_0018017
338 Ga0495642_0115317
339 Ga0495597_0209870
340 Ga0495661_0000109
341 Ga0496100_0000756
342 Ga0496101_0000383
343 Ga0496102_0162571
344 Ga0496104_0673539
345 Ga0496113_0035323
346 Ga0496122_0003746
347 Ga0496123_0018431
348 Ga0496124_0057392
349 Ga0501031_0003832
350 Ga0501031_0011314
351 Ga0501031_0059203
352 Ga0501031_0111022
353 Ga0501031_0139423
354 Ga0501032_0005305
355 Ga0501033_0004845
356 Ga0501033_0025910
357 Ga0501033_0041477
358 Ga0501033_0073888
359 Ga0501034_0026286
360 Ga0501034_0039524
361 Ga0501034_0097355
362 Ga0501036_0001955
363 Ga0501036_0005508
364 Ga0501036_0008443
365 Ga0501036_0231916
366 Ga0501036_0337399
367 Ga0501036_0507752
368 Ga0501037_0015077
369 Ga0501037_0018419
370 Ga0501037_0154321
371 Ga0501037_0179706
372 Ga0501038_0000995
373 Ga0501038_0003636
374 Ga0501038_0135560
375 Ga0501038_0472795
376 Ga0501039_0003060
377 Ga0501039_0008001
378 Ga0501039_0039676
379 Ga0501040_0008873
380 Ga0501040_0012072
381 Ga0501040_0212287
382 Ga0501040_0212928
383 Ga0501040_0473476
384 Ga0501041_0000561
385 Ga0501041_0009331
386 Ga0501041_0041562
387 Ga0501041_0248471
388 Ga0501042_0008568
389 Ga0501043_0001765
390 Ga0501043_0024927
391 Ga0501043_0473599
392 Ga0501046_0002728
393 Ga0501046_0020897
394 Ga0501046_0054536
395 Ga0501046_0070439
396 Ga0501046_0234490
397 Ga0501046_0437579
398 Ga0501047_0004646
399 Ga0501048_0001103
400 Ga0501048_0084272
401 Ga0501048_0176120
402 Ga0501068_0059088
403 Ga0501068_0106652
404 Ga0501068_0128958
405 Ga0501071_0004717
406 Ga0501071_0010540
407 Ga0501071_0014561
408 Ga0501071_0077836
409 Ga0501071_0156572
410 Ga0501072_0001673
411 Ga0501072_0006388
412 Ga0501072_0007318
413 Ga0501072_0063870
414 Ga0501072_0148336
415 Ga0501073_0079519
416 Ga0501074_0003628
417 Ga0501074_0192180
418 Ga0501075_0000592
419 Ga0501075_0007040
420 Ga0501075_0007260
421 Ga0501075_0020999
422 Ga0501075_0021241
423 Ga0501075_0039711
424 Ga0501075_0197553
425 Ga0501075_0274012
426 Ga0501076_0001116
427 Ga0501076_0002334
428 Ga0501076_0005105
429 Ga0501076_0121257
430 Ga0501076_0195383
431 Ga0501077_0011933
432 Ga0501077_0049886
433 Ga0501077_0057131
434 Ga0501225_0034168
435 Ga0501079_0001780
436 Ga0501079_0008059
437 Ga0501079_0068818
438 Ga0501079_0073542
439 Ga0501080_0008213
440 Ga0501080_0012461
441 Ga0501080_0044177
442 Ga0501080_0165376
443 Ga0501081_0001151
444 Ga0501081_0007310
445 Ga0501081_0015894
446 Ga0501081_0072170
447 Ga0501081_0103628
448 Ga0501081_0286412
449 Ga0501083_0072544
450 Ga0501083_0310751
451 Ga0501035_0000704
452 Ga0501035_0005368
453 Ga0501044_0004450
454 Ga0501044_0070909
455 Ga0501044_0581983
456 Ga0501045_0001465
457 Ga0501045_0003867
458 Ga0501045_0020165
459 Ga0501045_0237343
460 nmdc:mga05p37_646_c1
461 nmdc:mga09592_152114_c1
462 nmdc:mga09592_931_c1
463 nmdc:mga06r32_113161_c1
464 nmdc:mga08y16_140668_c1
465 nmdc:mga08y16_50704_c1
466 nmdc:mga08y16_929_c1
467 Ga0501084_0002391
468 Ga0501084_0008964
469 Ga0501084_0019714
470 Ga0501084_0064420
471 Ga0501084_0612977
472 Ga0590077_032110
473 Ga0501082_0003505
474 Ga0501082_0010749
475 Ga0501082_0216365
476 Ga0501082_0244998
477 Ga0501082_0343397
478 Ga0530510_0000172
479 Ga0530510_0000715
480 Ga0530510_0004843
481 Ga0530510_0178606
482 2516023319
483 2526210961
484 2883091117

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

47

135

0.96

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

167

239

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wsw-assembly1.cif.gz_C cryo-em structure of the potassium channel akt1 from arabidopsis thaliana 0.9101 7 121
5j48-assembly2.cif.gz_B pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp 0.9067 6 113
5j48-assembly1.cif.gz_A pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp 0.9015 6 113
4ku8-assembly3.cif.gz_C structures of pkgi reveal a cgmp-selective activation mechanism 0.9002 6 119
4qxk-assembly1.cif.gz_A joint x-ray/neutron structure of pkgibeta in complex with cgmp 0.8924 6 116
ID Description Score Start End Superfamily
5j3uA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.941 5 116 2.60.120.10
af_P9WQK5_226_324_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9345 32 114 2.60.120.10
af_Q4DT45_1_202_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9247 173 202 1.25.40.10
af_A0A1D6MG59_318_428_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9246 8 110 2.60.120.10
5kbfB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9217 5 116 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1Q7EDL1-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9568 31 110 GO:0005829
AF-A0A263BR28-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9395 8 120 GO:0016020
AF-A0A1A8HMT1-F1-model_v4 cGMP-dependent protein kinase 0.9374 5 113 GO:0004692
GO:0005524
AF-A0CXP6-F1-model_v4 Chromosome undetermined scaffold_30, whole genome shotgun sequence 0.9359 6 114 GO:0004862
GO:0005829
GO:0005952
GO:0007189
GO:0030552
GO:0034236
AF-A0A2G2XQ75-F1-model_v4 Potassium channel 0.9324 7 131 GO:0005249
GO:0034702

Map