F355760

General Info

Members Datasets Scaffolds Average Seq Length
243 175 486 79

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0072112|Ga0373936_0072112_60_347
Length 95
Sequence MGDSAVRRASFNPISRVDFELVGDLTDIETIAAGRGIRDLPRLRRLYGKGYWRKMKGSARIRLRNGRIRRAEIHWYETHGIGKKEFKRKRYLDET

Samples

Sample ID Description Type Environment
1 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
106 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
129 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
130 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
131 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
132 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
156 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
157 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
158 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
159 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
164 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
165 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 0
Rhizosphere 99.59
Stem 0
Stem Tuber 0
Unclassified 26.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373936_0072112 3300035113 Bacteria 1425
2 JGI25406J46586_10003940 3300003203 Bacteria 6940
3 JGI25406J46586_10010649 3300003203 Bacteria 4070
4 Ga0065704_10640501 3300005289 Unclassified 587
5 Ga0065715_10044520 3300005293 Unclassified 1080
6 Ga0065707_10407723 3300005295 Bacteria 819
7 Ga0070676_10563005 3300005328 Bacteria 817
8 Ga0070690_100190810 3300005330 Unclassified 1420
9 Ga0070690_100570332 3300005330 Bacteria 855
10 Ga0070690_101585395 3300005330 Bacteria 530
11 Ga0070670_100032761 3300005331 Bacteria 4477
12 Ga0068869_100075644 3300005334 Bacteria 2502
13 Ga0068869_100244997 3300005334 Unclassified 1429
14 Ga0070682_100058671 3300005337 Bacteria 2428
15 Ga0068868_100580749 3300005338 Bacteria 991
16 Ga0070689_100087387 3300005340 Bacteria 2453
17 Ga0070689_100289425 3300005340 Bacteria 1361
18 Ga0070691_10133980 3300005341 Viruses 1257
19 Ga0070687_100028412 3300005343 Bacteria 2712
20 Ga0070687_100118072 3300005343 Bacteria 1512
21 Ga0070687_100581388 3300005343 Bacteria 767
22 Ga0070692_10225825 3300005345 Bacteria 1109
23 Ga0070669_100058176 3300005353 Bacteria 2837
24 Ga0070675_100025092 3300005354 Bacteria 4777
25 Ga0070673_100031019 3300005364 Bacteria 4007
26 Ga0070673_100157962 3300005364 Bacteria 1926
27 Ga0070673_100616463 3300005364 Bacteria 991
28 Ga0070688_100094668 3300005365 Bacteria 1959
29 Ga0070688_101710946 3300005365 Bacteria 515
30 Ga0070667_100982670 3300005367 Unclassified 787
31 Ga0070705_100084340 3300005440 Bacteria 1960
32 Ga0070700_100588657 3300005441 Bacteria 870
33 Ga0070700_101328578 3300005441 Bacteria 605
34 Ga0070694_100065949 3300005444 Bacteria 2482
35 Ga0070708_100624250 3300005445 Bacteria 1016
36 Ga0070708_101682691 3300005445 Bacteria 590
37 Ga0070678_100939832 3300005456 Bacteria 792
38 Ga0070662_100325779 3300005457 Unclassified 1254
39 Ga0068867_100032958 3300005459 Bacteria 3748
40 Ga0068867_101080906 3300005459 Bacteria 731
41 Ga0070699_100026589 3300005518 Bacteria 4990
42 Ga0070699_100132001 3300005518 Bacteria 2202
43 Ga0070699_101141397 3300005518 Unclassified 715
44 Ga0070684_100305112 3300005535 Unclassified 1461
45 Ga0070697_100693851 3300005536 Bacteria 898
46 Ga0070697_101354510 3300005536 Unclassified 635
47 Ga0068853_100480343 3300005539 Unclassified 1171
48 Ga0070672_100861411 3300005543 Bacteria 799
49 Ga0070672_101297780 3300005543 Bacteria 650
50 Ga0070686_100286480 3300005544 Bacteria 1217
51 Ga0070686_100403499 3300005544 Unclassified 1040
52 Ga0070695_100747017 3300005545 Unclassified 780
53 Ga0070696_100146414 3300005546 Bacteria 1730
54 Ga0070696_100512638 3300005546 Bacteria 956
55 Ga0070696_100876178 3300005546 Unclassified 743
56 Ga0070693_100079359 3300005547 Bacteria 1953
57 Ga0070704_100112865 3300005549 Bacteria 2071
58 Ga0068855_100098067 3300005563 Bacteria 3376
59 Ga0068855_100470369 3300005563 Bacteria 1369
60 Ga0068857_102334836 3300005577 Unclassified 525
61 Ga0068856_100406762 3300005614 Bacteria 1381
62 Ga0070702_100481927 3300005615 Bacteria 907
63 Ga0068859_100990901 3300005617 Bacteria 923
64 Ga0068861_100332403 3300005719 Unclassified 1327
65 Ga0068861_100434839 3300005719 Unclassified 1172
66 Ga0068861_101611000 3300005719 Bacteria 640
67 Ga0068861_101856564 3300005719 Unclassified 599
68 Ga0068858_100592759 3300005842 Bacteria 1075
69 Ga0068860_100029190 3300005843 Bacteria 5305
70 Ga0068860_100159918 3300005843 Bacteria 2171
71 Ga0068862_100056731 3300005844 Bacteria 3356
72 Ga0081539_10001149 3300005985 Bacteria 47950
73 Ga0081539_10006348 3300005985 Bacteria 11389
74 Ga0070716_101434739 3300006173 Bacteria 562
75 Ga0097621_100195313 3300006237 Bacteria 1754
76 Ga0068871_100317754 3300006358 Unclassified 1370
77 Ga0068871_101039361 3300006358 Unclassified 764
78 Ga0075428_101022743 3300006844 Unclassified 874
79 Ga0075428_101452650 3300006844 Bacteria 719
80 Ga0075428_101695478 3300006844 Bacteria 659
81 Ga0075428_101777158 3300006844 Unclassified 642
82 Ga0075431_100184960 3300006847 Bacteria 2137
83 Ga0075431_100803279 3300006847 Bacteria 914
84 Ga0075433_10508938 3300006852 Bacteria 1059
85 Ga0075433_11021823 3300006852 Unclassified 720
86 Ga0075434_100121836 3300006871 Bacteria 2624
87 Ga0075434_100192260 3300006871 Bacteria 2061
88 Ga0075434_100342598 3300006871 Unclassified 1516
89 Ga0075429_100759696 3300006880 Bacteria 849
90 Ga0068865_100099269 3300006881 Bacteria 2128
91 Ga0068865_100201912 3300006881 Unclassified 1544
92 Ga0075436_100051539 3300006914 Unclassified 2840
93 Ga0075436_100119976 3300006914 Bacteria 1839
94 Ga0097620_100991054 3300006931 Bacteria 923
95 Ga0075435_100067682 3300007076 Bacteria 2908
96 Ga0075435_100287759 3300007076 Bacteria 1404
97 Ga0075435_100442198 3300007076 Bacteria 1121
98 Ga0099795_10632647 3300007788 Bacteria 511
99 Ga0105240_10355015 3300009093 Bacteria 1662
100 Ga0105240_11827301 3300009093 Bacteria 633
101 Ga0105245_10307941 3300009098 Bacteria 1556
102 Ga0105245_11629742 3300009098 Unclassified 697
103 Ga0114129_10172401 3300009147 Bacteria 2948
104 Ga0114129_10324368 3300009147 Bacteria 2046
105 Ga0114129_10989198 3300009147 Bacteria 1060
106 Ga0114129_11608298 3300009147 Unclassified 795
107 Ga0105243_10002035 3300009148 Bacteria 17148
108 Ga0105241_10232329 3300009174 Bacteria 1555
109 Ga0105242_10705639 3300009176 Bacteria 988
110 Ga0105248_10224479 3300009177 Bacteria 2115
111 Ga0157371_10074392 3300013102 Bacteria 2406
112 Ga0157370_10071911 3300013104 Bacteria 3263
113 Ga0157378_10812907 3300013297 Bacteria 961
114 Ga0163162_11056885 3300013306 Unclassified 919
115 Ga0157372_10876224 3300013307 Bacteria 1042
116 Ga0157375_12372350 3300013308 Bacteria 633
117 Ga0157380_11069786 3300014326 Unclassified 844
118 Ga0157377_10464201 3300014745 Unclassified 877
119 Ga0157379_12303078 3300014968 Bacteria 536
120 Ga0157376_10065417 3300014969 Unclassified 3070
121 Ga0163161_10037389 3300017792 Bacteria 3480
122 Ga0207680_10746684 3300025903 Bacteria 701
123 Ga0207643_10064663 3300025908 Unclassified 2093
124 Ga0207660_10193632 3300025917 Bacteria 1585
125 Ga0207662_10030016 3300025918 Bacteria 3152
126 Ga0207662_10061564 3300025918 Bacteria 2254
127 Ga0207681_10056320 3300025923 Bacteria 2681
128 Ga0207681_10192218 3300025923 Bacteria 1562
129 Ga0207650_10160819 3300025925 Bacteria 1779
130 Ga0207659_10356755 3300025926 Unclassified 1214
131 Ga0207687_10798782 3300025927 Unclassified 805
132 Ga0207706_10495168 3300025933 Bacteria 1055
133 Ga0207686_10061076 3300025934 Bacteria 2388
134 Ga0207709_10836973 3300025935 Unclassified 745
135 Ga0207670_10084376 3300025936 Bacteria 2230
136 Ga0207670_10861593 3300025936 Bacteria 757
137 Ga0207704_10996736 3300025938 Unclassified 708
138 Ga0207689_10266960 3300025942 Bacteria 1416
139 Ga0207667_10755619 3300025949 Viruses 971
140 Ga0207651_10065103 3300025960 Bacteria 2555
141 Ga0207651_10396217 3300025960 Unclassified 1173
142 Ga0207651_11350807 3300025960 Bacteria 641
143 Ga0207712_10647411 3300025961 Bacteria 918
144 Ga0207658_11354895 3300025986 Unclassified 651
145 Ga0207677_10511536 3300026023 Bacteria 1040
146 Ga0207708_10171675 3300026075 Bacteria 1718
147 Ga0207708_10841055 3300026075 Bacteria 792
148 Ga0207648_10070269 3300026089 Bacteria 3052
149 Ga0207648_11844453 3300026089 Bacteria 566
150 Ga0207675_100057693 3300026118 Bacteria 3623
151 Ga0207675_101805330 3300026118 Unclassified 631
152 Ga0207675_102381883 3300026118 Unclassified 542
153 Ga0207683_10111420 3300026121 Bacteria 2451
154 Ga0268265_10754778 3300028380 Bacteria 944
155 Ga0268264_10024606 3300028381 Bacteria 4916
156 Ga0268264_10716219 3300028381 Unclassified 995
157 Ga0265318_10116082 3300028577 Unclassified 984
158 Ga0265323_10209918 3300028653 Unclassified 611
159 Ga0265322_10006862 3300028654 Bacteria 3337
160 Ga0265338_10352555 3300028800 Bacteria 1058
161 Ga0265324_10197913 3300029957 Unclassified 682
162 Ga0265325_10240237 3300031241 Bacteria 823
163 Ga0265327_10018152 3300031251 Bacteria 4373
164 Ga0265316_10043966 3300031344 Bacteria 3555
165 Ga0265316_10211857 3300031344 Unclassified 1432
166 Ga0265316_10629156 3300031344 Unclassified 760
167 Ga0265316_10898301 3300031344 Unclassified 619
168 Ga0307408_100025759 3300031548 Bacteria 4031
169 Ga0265313_10380727 3300031595 Unclassified 556
170 Ga0307405_10052178 3300031731 Bacteria 2541
171 Ga0307412_10056049 3300031911 Bacteria 2625
172 Ga0307416_100100740 3300032002 Bacteria 2513
173 Ga0307414_11093859 3300032004 Unclassified 736
174 Ga0307411_10077693 3300032005 Bacteria 2273
175 Ga0307415_100181464 3300032126 Bacteria 1652
176 Ga0373931_0150806 3300035691 Bacteria 1355
177 Ga0373947_0378225 3300035725 Unclassified 953
178 Ga0316582_0683983 3300036647 Bacteria 705
179 Ga0395898_1501924 3300037466 Bacteria 600
180 Ga0436361_0427513 3300039447 Bacteria 760
181 Ga0451577_0383967 3300042876 Bacteria 1275
182 Ga0453684_0100141 3300044712 Bacteria 3548
183 Ga0495580_0810906 3300046472 Bacteria 606
184 Ga0495659_0018509 3300046664 Unclassified 2322
185 Ga0501292_000946 3300049515 Bacteria 3541
186 Ga0501295_049693 3300049518 Unclassified 894
187 Ga0501299_000812 3300049522 Bacteria 3797
188 Ga0501300_061859 3300049523 Unclassified 593
189 Ga0501032_0163977 3300049569 Bacteria 1459
190 Ga0501034_0370501 3300049571 Bacteria 1358
191 Ga0501036_1659119 3300049572 Unclassified 516
192 Ga0501037_0787782 3300049573 Bacteria 628
193 Ga0501038_0187422 3300049574 Bacteria 1666
194 Ga0501038_0416370 3300049574 Bacteria 1037
195 Ga0501039_0037017 3300049575 Bacteria 3766
196 Ga0501040_0218417 3300049576 Unclassified 1356
197 Ga0501041_0034566 3300049577 Bacteria 3061
198 Ga0501042_0526234 3300049578 Unclassified 859
199 Ga0501043_0151973 3300049579 Bacteria 1812
200 Ga0501046_0109383 3300049580 Bacteria 2113
201 Ga0501047_0145512 3300049581 Bacteria 2247
202 Ga0501048_0149725 3300049582 Unclassified 1650
203 Ga0501067_0103520 3300049583 Bacteria 1582
204 Ga0501067_0396158 3300049583 Bacteria 770
205 Ga0501069_0461629 3300049585 Bacteria 755
206 Ga0501071_0114952 3300049587 Bacteria 1991
207 Ga0501072_0119226 3300049588 Bacteria 2102
208 Ga0501073_0126664 3300049589 Bacteria 1770
209 Ga0501074_0142392 3300049590 Bacteria 1715
210 Ga0501074_0644840 3300049590 Bacteria 748
211 Ga0501075_0037199 3300049591 Bacteria 3635
212 Ga0501076_0024825 3300049592 Bacteria 4635
213 Ga0501077_0035639 3300049593 Bacteria 3168
214 Ga0501077_0201699 3300049593 Bacteria 1264
215 Ga0501202_010254 3300049652 Bacteria 1735
216 Ga0501216_011674 3300049660 Bacteria 1431
217 Ga0501217_010250 3300049661 Bacteria 2049
218 Ga0501253_043156 3300049683 Bacteria 917
219 Ga0501221_118101 3300049704 Unclassified 675
220 Ga0501079_0076261 3300049741 Bacteria 2593
221 Ga0501081_0306392 3300049743 Bacteria 1165
222 Ga0501083_0471589 3300049744 Bacteria 817
223 Ga0501263_026581 3300049760 Unclassified 801
224 Ga0501272_032965 3300049769 Unclassified 665
225 Ga0501279_074121 3300049775 Unclassified 577
226 Ga0501045_0013609 3300049824 Bacteria 5749
227 nmdc:mga05p37_1374730_c1 3300050507 Unclassified 713
228 nmdc:mga05p37_18480_c1 3300050507 Bacteria 8421
229 nmdc:mga05p37_267076_c1 3300050507 Bacteria 2046
230 nmdc:mga06r32_199367_c1 3300050510 Bacteria 1989
231 nmdc:mga06r32_578599_c1 3300050510 Bacteria 1095
232 nmdc:mga0n895_1581557_c1 3300050512 Bacteria 620
233 nmdc:mga0n895_826246_c1 3300050512 Unclassified 916
234 nmdc:mga0n895_933969_c1 3300050512 Bacteria 852
235 nmdc:mga0rr50_35285_c1 3300050513 Bacteria 3590
236 nmdc:mga0rr50_641709_c1 3300050513 Bacteria 906
237 nmdc:mga0rr50_981023_c1 3300050513 Unclassified 720
238 nmdc:mga08x19_100700_c1 3300050514 Bacteria 1917
239 nmdc:mga08x19_33977_c1 3300050514 Unclassified 3221
240 Ga0500559_0001615 3300053136 Bacteria 12547
241 Ga0501084_0055962 3300054114 Bacteria 3300
242 Ga0501082_0137544 3300060353 Bacteria 2119
243 Ga0530510_0009658 3300061734 Bacteria 6768
244 Ga0373936_0072112
245 JGI25406J46586_10003940
246 JGI25406J46586_10010649
247 Ga0065704_10640501
248 Ga0065715_10044520
249 Ga0065707_10407723
250 Ga0070676_10563005
251 Ga0070690_100190810
252 Ga0070690_100570332
253 Ga0070690_101585395
254 Ga0070670_100032761
255 Ga0068869_100075644
256 Ga0068869_100244997
257 Ga0070682_100058671
258 Ga0068868_100580749
259 Ga0070689_100087387
260 Ga0070689_100289425
261 Ga0070691_10133980
262 Ga0070687_100028412
263 Ga0070687_100118072
264 Ga0070687_100581388
265 Ga0070692_10225825
266 Ga0070669_100058176
267 Ga0070675_100025092
268 Ga0070673_100031019
269 Ga0070673_100157962
270 Ga0070673_100616463
271 Ga0070688_100094668
272 Ga0070688_101710946
273 Ga0070667_100982670
274 Ga0070705_100084340
275 Ga0070700_100588657
276 Ga0070700_101328578
277 Ga0070694_100065949
278 Ga0070708_100624250
279 Ga0070708_101682691
280 Ga0070678_100939832
281 Ga0070662_100325779
282 Ga0068867_100032958
283 Ga0068867_101080906
284 Ga0070699_100026589
285 Ga0070699_100132001
286 Ga0070699_101141397
287 Ga0070684_100305112
288 Ga0070697_100693851
289 Ga0070697_101354510
290 Ga0068853_100480343
291 Ga0070672_100861411
292 Ga0070672_101297780
293 Ga0070686_100286480
294 Ga0070686_100403499
295 Ga0070695_100747017
296 Ga0070696_100146414
297 Ga0070696_100512638
298 Ga0070696_100876178
299 Ga0070693_100079359
300 Ga0070704_100112865
301 Ga0068855_100098067
302 Ga0068855_100470369
303 Ga0068857_102334836
304 Ga0068856_100406762
305 Ga0070702_100481927
306 Ga0068859_100990901
307 Ga0068861_100332403
308 Ga0068861_100434839
309 Ga0068861_101611000
310 Ga0068861_101856564
311 Ga0068858_100592759
312 Ga0068860_100029190
313 Ga0068860_100159918
314 Ga0068862_100056731
315 Ga0081539_10001149
316 Ga0081539_10006348
317 Ga0070716_101434739
318 Ga0097621_100195313
319 Ga0068871_100317754
320 Ga0068871_101039361
321 Ga0075428_101022743
322 Ga0075428_101452650
323 Ga0075428_101695478
324 Ga0075428_101777158
325 Ga0075431_100184960
326 Ga0075431_100803279
327 Ga0075433_10508938
328 Ga0075433_11021823
329 Ga0075434_100121836
330 Ga0075434_100192260
331 Ga0075434_100342598
332 Ga0075429_100759696
333 Ga0068865_100099269
334 Ga0068865_100201912
335 Ga0075436_100051539
336 Ga0075436_100119976
337 Ga0097620_100991054
338 Ga0075435_100067682
339 Ga0075435_100287759
340 Ga0075435_100442198
341 Ga0099795_10632647
342 Ga0105240_10355015
343 Ga0105240_11827301
344 Ga0105245_10307941
345 Ga0105245_11629742
346 Ga0114129_10172401
347 Ga0114129_10324368
348 Ga0114129_10989198
349 Ga0114129_11608298
350 Ga0105243_10002035
351 Ga0105241_10232329
352 Ga0105242_10705639
353 Ga0105248_10224479
354 Ga0157371_10074392
355 Ga0157370_10071911
356 Ga0157378_10812907
357 Ga0163162_11056885
358 Ga0157372_10876224
359 Ga0157375_12372350
360 Ga0157380_11069786
361 Ga0157377_10464201
362 Ga0157379_12303078
363 Ga0157376_10065417
364 Ga0163161_10037389
365 Ga0207680_10746684
366 Ga0207643_10064663
367 Ga0207660_10193632
368 Ga0207662_10030016
369 Ga0207662_10061564
370 Ga0207681_10056320
371 Ga0207681_10192218
372 Ga0207650_10160819
373 Ga0207659_10356755
374 Ga0207687_10798782
375 Ga0207706_10495168
376 Ga0207686_10061076
377 Ga0207709_10836973
378 Ga0207670_10084376
379 Ga0207670_10861593
380 Ga0207704_10996736
381 Ga0207689_10266960
382 Ga0207667_10755619
383 Ga0207651_10065103
384 Ga0207651_10396217
385 Ga0207651_11350807
386 Ga0207712_10647411
387 Ga0207658_11354895
388 Ga0207677_10511536
389 Ga0207708_10171675
390 Ga0207708_10841055
391 Ga0207648_10070269
392 Ga0207648_11844453
393 Ga0207675_100057693
394 Ga0207675_101805330
395 Ga0207675_102381883
396 Ga0207683_10111420
397 Ga0268265_10754778
398 Ga0268264_10024606
399 Ga0268264_10716219
400 Ga0265318_10116082
401 Ga0265323_10209918
402 Ga0265322_10006862
403 Ga0265338_10352555
404 Ga0265324_10197913
405 Ga0265325_10240237
406 Ga0265327_10018152
407 Ga0265316_10043966
408 Ga0265316_10211857
409 Ga0265316_10629156
410 Ga0265316_10898301
411 Ga0307408_100025759
412 Ga0265313_10380727
413 Ga0307405_10052178
414 Ga0307412_10056049
415 Ga0307416_100100740
416 Ga0307414_11093859
417 Ga0307411_10077693
418 Ga0307415_100181464
419 Ga0373931_0150806
420 Ga0373947_0378225
421 Ga0316582_0683983
422 Ga0395898_1501924
423 Ga0436361_0427513
424 Ga0451577_0383967
425 Ga0453684_0100141
426 Ga0495580_0810906
427 Ga0495659_0018509
428 Ga0501292_000946
429 Ga0501295_049693
430 Ga0501299_000812
431 Ga0501300_061859
432 Ga0501032_0163977
433 Ga0501034_0370501
434 Ga0501036_1659119
435 Ga0501037_0787782
436 Ga0501038_0187422
437 Ga0501038_0416370
438 Ga0501039_0037017
439 Ga0501040_0218417
440 Ga0501041_0034566
441 Ga0501042_0526234
442 Ga0501043_0151973
443 Ga0501046_0109383
444 Ga0501047_0145512
445 Ga0501048_0149725
446 Ga0501067_0103520
447 Ga0501067_0396158
448 Ga0501069_0461629
449 Ga0501071_0114952
450 Ga0501072_0119226
451 Ga0501073_0126664
452 Ga0501074_0142392
453 Ga0501074_0644840
454 Ga0501075_0037199
455 Ga0501076_0024825
456 Ga0501077_0035639
457 Ga0501077_0201699
458 Ga0501202_010254
459 Ga0501216_011674
460 Ga0501217_010250
461 Ga0501253_043156
462 Ga0501221_118101
463 Ga0501079_0076261
464 Ga0501081_0306392
465 Ga0501083_0471589
466 Ga0501263_026581
467 Ga0501272_032965
468 Ga0501279_074121
469 Ga0501045_0013609
470 nmdc:mga05p37_1374730_c1
471 nmdc:mga05p37_18480_c1
472 nmdc:mga05p37_267076_c1
473 nmdc:mga06r32_199367_c1
474 nmdc:mga06r32_578599_c1
475 nmdc:mga0n895_1581557_c1
476 nmdc:mga0n895_826246_c1
477 nmdc:mga0n895_933969_c1
478 nmdc:mga0rr50_35285_c1
479 nmdc:mga0rr50_641709_c1
480 nmdc:mga0rr50_981023_c1
481 nmdc:mga08x19_100700_c1
482 nmdc:mga08x19_33977_c1
483 Ga0500559_0001615
484 Ga0501084_0055962
485 Ga0501082_0137544
486 Ga0530510_0009658

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eni-assembly1.cif.gz_C crystal structure of cas and anti-cas protein complex 0.6038 3 63
2w9p-assembly9.cif.gz_I crystal structure of potato multicystatin 0.5867 2 74
7yny-assembly1.cif.gz_H crystal structure of baculovirus lef-3 from helicoverpa armigera nucleopolyhedrovirus 0.576 32 64
7yny-assembly1.cif.gz_B crystal structure of baculovirus lef-3 from helicoverpa armigera nucleopolyhedrovirus 0.5613 32 64
3nv0-assembly1.cif.gz_B crystal structure and mutational analysis of the nxf2/nxt1 heterodimeric complex from caenorhabditis elegans at 1.84 a resolution 0.5583 2 78
ID Description Score Start End Superfamily
af_A0A1D6GR15_38_126_3.10.450.10 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6601 2 76 3.10.450.10
af_A0A1D6QNS0_727_814_3.10.450.10 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6537 4 77 3.10.450.10
af_Q4DMN6_24_172_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.6099 5 73 2.40.10.500
af_Q4E5G9_35_352_2.120.10.10 Mainly Beta;6 Propeller;Neuraminidase; 0.6078 39 77 2.120.10.10
af_O01765_1_230_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.5773 10 66 3.30.505.10
ID Description Score Start End GO Terms
AF-A0A451A5A1-F1-model_v4 Uncharacterized protein 0.9921 4 49
AF-A0A354GU95-F1-model_v4 Uncharacterized protein 0.9897 4 60
AF-A0A533Y519-F1-model_v4 Uncharacterized protein 0.9832 4 77
AF-A0A7V5BPJ7-F1-model_v4 Uncharacterized protein 0.9802 4 78
AF-A0A450TL82-F1-model_v4 Uncharacterized protein 0.9802 4 76

Map