F355614

General Info

Members Datasets Scaffolds Average Seq Length
243 146 242 302

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10442552|Ga0157380_104425521
Length 337
Sequence LDTFGGDDATGARRYNALMPENRAKDRTRTYVLAGHPVEPPRLAAGLHLVATPIGNLRDITLRALETLAAADAIACEDSRVTRKLLDHYGIATPLTPYHEHNAVAARPKLLARLAAGEAIALVSDAGTPLISDPGFKLVRAVWEAGLPVSAVPGPSAALAALAVAGLPTDRFFFEGFLPPKDGARRTRIAELARIPATLILYESGPRVGRALHALAEGLGPRQAAVCRELTKLHEEVRRDDLAKLARAYDANAKDPVKDVAEIRGEFAIVIAPPAAEEGAPDADAVDALLRRALRHASVKDAVSDVAAATGRPRREIYQRALALSDSEHEGDDGAAE

Samples

Sample ID Description Type Environment
1 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
77 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
78 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
79 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
91 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
92 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
141 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
142 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
143 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.82
Nodule 0
Rhizoplane 19.75
Rhizosphere 70.37
Stem 0
Stem Tuber 0
Unclassified 2.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001258 3300003215 Bacteria 15228
2 Ga0070658_10037047 3300005327 Bacteria 3930
3 Ga0070690_100091073 3300005330 Bacteria 2009
4 Ga0070670_100306884 3300005331 Bacteria 1389
5 Ga0070682_100070624 3300005337 Bacteria 2233
6 Ga0070689_100002808 3300005340 Bacteria 11451
7 Ga0070687_100173740 3300005343 Bacteria 1285
8 Ga0070668_100023759 3300005347 Bacteria 4640
9 Ga0070669_100076125 3300005353 Bacteria 2490
10 Ga0070675_100129846 3300005354 Bacteria 2146
11 Ga0070674_100041860 3300005356 Bacteria 3108
12 Ga0070674_100043432 3300005356 Bacteria 3058
13 Ga0070673_100054608 3300005364 Bacteria 3143
14 Ga0070673_100111667 3300005364 Bacteria 2268
15 Ga0070667_100131416 3300005367 Bacteria 2185
16 Ga0070701_10021462 3300005438 Bacteria 3083
17 Ga0070681_10158524 3300005458 Bacteria 2187
18 Ga0070685_10111491 3300005466 Bacteria 1686
19 Ga0070699_100005520 3300005518 Bacteria 11079
20 Ga0070686_100075523 3300005544 Bacteria 2217
21 Ga0070693_100027173 3300005547 Bacteria 3098
22 Ga0070664_100449955 3300005564 Bacteria 1182
23 Ga0068856_100073360 3300005614 Bacteria 3389
24 Ga0070702_100072436 3300005615 Bacteria 2039
25 Ga0068859_100252856 3300005617 Bacteria 1853
26 Ga0068864_100063998 3300005618 Bacteria 3189
27 Ga0068864_100145230 3300005618 Bacteria 2144
28 Ga0068860_100209685 3300005843 Bacteria 1890
29 Ga0081455_10004914 3300005937 Bacteria 14812
30 Ga0081455_10016549 3300005937 Bacteria 7115
31 Ga0081455_10129614 3300005937 Bacteria 1974
32 Ga0081455_10136160 3300005937 Bacteria 1914
33 Ga0075365_10027955 3300006038 Bacteria 3592
34 Ga0075365_10033254 3300006038 Bacteria 3321
35 Ga0075363_100193259 3300006048 Bacteria 1161
36 Ga0075362_10046965 3300006177 Bacteria 1922
37 Ga0075362_10073214 3300006177 Bacteria 1568
38 Ga0075366_10002442 3300006195 Bacteria 9511
39 Ga0068871_100351900 3300006358 Bacteria 1303
40 Ga0075428_100104613 3300006844 Bacteria 3087
41 Ga0075430_100097203 3300006846 Bacteria 2460
42 Ga0068865_100089123 3300006881 Bacteria 2234
43 Ga0097620_100252842 3300006931 Bacteria 1853
44 Ga0111539_10264322 3300009094 Bacteria 2003
45 Ga0114129_10811071 3300009147 Bacteria 1193
46 Ga0105243_10389510 3300009148 Bacteria 1291
47 Ga0105248_10327040 3300009177 Bacteria 1727
48 Ga0157374_10730184 3300013296 Bacteria 1004
49 Ga0157372_10002746 3300013307 Bacteria 19022
50 Ga0163163_10024888 3300014325 Bacteria 5700
51 Ga0157380_10174041 3300014326 Bacteria 1884
52 Ga0157380_10275590 3300014326 Bacteria 1536
53 Ga0157380_10442552 3300014326 Bacteria 1246
54 Ga0213875_10063998 3300021388 Bacteria 1719
55 Ga0209758_1000179 3300025297 Bacteria 141948
56 Ga0207685_10045410 3300025905 Bacteria 1666
57 Ga0207707_10268102 3300025912 Bacteria 1480
58 Ga0207660_10190792 3300025917 Bacteria 1596
59 Ga0207657_10052351 3300025919 Bacteria 3543
60 Ga0207652_10021185 3300025921 Bacteria 5363
61 Ga0207652_10346043 3300025921 Bacteria 1342
62 Ga0207659_10139035 3300025926 Bacteria 1883
63 Ga0207659_10141045 3300025926 Bacteria 1871
64 Ga0207670_10003194 3300025936 Bacteria 8682
65 Ga0207670_10304778 3300025936 Bacteria 1248
66 Ga0207711_10005997 3300025941 Bacteria 10273
67 Ga0207711_10218104 3300025941 Bacteria 1744
68 Ga0207667_10144531 3300025949 Bacteria 2449
69 Ga0207651_10187268 3300025960 Bacteria 1648
70 Ga0207651_10243995 3300025960 Bacteria 1466
71 Ga0207712_10165914 3300025961 Bacteria 1721
72 Ga0207668_10020685 3300025972 Bacteria 4187
73 Ga0207658_10394865 3300025986 Bacteria 1214
74 Ga0207708_10090831 3300026075 Bacteria 2354
75 Ga0207676_10046072 3300026095 Bacteria 3372
76 Ga0207676_10129294 3300026095 Bacteria 2145
77 Ga0207675_100441756 3300026118 Bacteria 1288
78 Ga0207683_10012539 3300026121 Bacteria 7231
79 Ga0265336_10024950 3300028666 Bacteria 1885
80 Ga0265338_10037297 3300028800 Bacteria 4630
81 Ga0265332_10000201 3300031238 Bacteria 48394
82 Ga0265325_10020700 3300031241 Bacteria 3623
83 Ga0265340_10001728 3300031247 Bacteria 12527
84 Ga0265340_10045644 3300031247 Bacteria 2139
85 Ga0265339_10002990 3300031249 Bacteria 11935
86 Ga0265339_10032221 3300031249 Bacteria 2956
87 Ga0265316_10131943 3300031344 Bacteria 1881
88 Ga0307513_10090760 3300031456 Bacteria 3115
89 Ga0307513_10162222 3300031456 Bacteria 2126
90 Ga0265313_10051988 3300031595 Bacteria 1958
91 Ga0316579_10016323 3300031691 Bacteria 3242
92 Ga0265314_10087363 3300031711 Bacteria 2039
93 Ga0265342_10000444 3300031712 Bacteria 45263
94 Ga0265342_10010378 3300031712 Bacteria 6468
95 Ga0373941_0003475 3300035115 Bacteria 3570
96 Ga0373941_0116989 3300035115 Bacteria 946
97 Ga0373946_0077499 3300035171 Bacteria 1449
98 Ga0373962_0008678 3300035242 Bacteria 2506
99 Ga0373931_0000543 3300035691 Bacteria 15478
100 Ga0373931_0003448 3300035691 Bacteria 7103
101 Ga0373927_0079463 3300035695 Bacteria 2125
102 Ga0373937_0006933 3300036401 Bacteria 9783
103 Ga0373937_0615520 3300036401 Bacteria 1031
104 Ga0373925_0133449 3300037068 Bacteria 1938
105 Ga0436364_1503894 3300037853 Bacteria 3696
106 Ga0436365_0376759 3300039437 Bacteria 10813
107 Ga0466966_0139602 3300044684 Bacteria 1481
108 Ga0466961_0034356 3300044693 Bacteria 3255
109 Ga0466963_0071456 3300044694 Bacteria 2336
110 Ga0466958_0042937 3300045836 Bacteria 2722
111 Ga0495630_0263316 3300046517 Bacteria 1317
112 Ga0495674_0232833 3300047319 Bacteria 1520
113 Ga0496100_0004174 3300048903 Bacteria 7617
114 Ga0496100_0022751 3300048903 Bacteria 3797
115 Ga0496100_0130839 3300048903 Bacteria 1767
116 Ga0496100_0155873 3300048903 Bacteria 1633
117 Ga0496100_0199573 3300048903 Bacteria 1457
118 Ga0496101_0015722 3300048904 Bacteria 5107
119 Ga0496101_0036131 3300048904 Bacteria 3498
120 Ga0496102_0011421 3300048905 Bacteria 7656
121 Ga0496102_0107589 3300048905 Bacteria 2596
122 Ga0496103_0056587 3300048906 Bacteria 2435
123 Ga0496104_0000645 3300048907 Bacteria 29881
124 Ga0496104_0001830 3300048907 Bacteria 18389
125 Ga0496104_0002612 3300048907 Bacteria 15515
126 Ga0496104_0015366 3300048907 Bacteria 6932
127 Ga0496104_0041713 3300048907 Bacteria 4304
128 Ga0496105_0011193 3300048908 Bacteria 7078
129 Ga0496105_0033130 3300048908 Bacteria 4242
130 Ga0496105_0173622 3300048908 Bacteria 1766
131 Ga0496106_0000741 3300048909 Bacteria 23536
132 Ga0496106_0045642 3300048909 Bacteria 3292
133 Ga0496106_0185123 3300048909 Bacteria 1654
134 Ga0496107_0016568 3300048910 Bacteria 5177
135 Ga0496107_0157551 3300048910 Bacteria 1682
136 Ga0496108_0147250 3300048911 Bacteria 2030
137 Ga0496108_0161120 3300048911 Bacteria 1939
138 Ga0496109_0005806 3300048912 Bacteria 10337
139 Ga0496109_0013908 3300048912 Bacteria 6997
140 Ga0496109_0088482 3300048912 Bacteria 2862
141 Ga0496109_0234123 3300048912 Bacteria 1728
142 Ga0496110_0003581 3300048913 Bacteria 11934
143 Ga0496110_0017259 3300048913 Bacteria 6037
144 Ga0496110_0023375 3300048913 Bacteria 5255
145 Ga0496110_0394083 3300048913 Bacteria 1262
146 Ga0496110_0439313 3300048913 Bacteria 1189
147 Ga0496111_0008574 3300048914 Bacteria 6772
148 Ga0496111_0095952 3300048914 Bacteria 2176
149 Ga0496111_0114062 3300048914 Bacteria 1992
150 Ga0496111_0124506 3300048914 Bacteria 1905
151 Ga0496111_0126103 3300048914 Bacteria 1892
152 Ga0496112_0038951 3300048915 Bacteria 4643
153 Ga0496112_0193595 3300048915 Bacteria 1994
154 Ga0496112_0214597 3300048915 Bacteria 1881
155 Ga0496112_0284406 3300048915 Bacteria 1600
156 Ga0496112_0489828 3300048915 Bacteria 1165
157 Ga0496113_0160943 3300048916 Bacteria 1774
158 Ga0496115_0023638 3300048918 Bacteria 4770
159 Ga0496115_0074019 3300048918 Bacteria 2765
160 Ga0496115_0095986 3300048918 Bacteria 2427
161 Ga0501031_0078613 3300049568 Bacteria 2149
162 Ga0501032_0011431 3300049569 Bacteria 6379
163 Ga0501032_0033307 3300049569 Bacteria 3530
164 Ga0501032_0076068 3300049569 Bacteria 2236
165 Ga0501032_0102055 3300049569 Bacteria 1901
166 Ga0501032_0144918 3300049569 Bacteria 1563
167 Ga0501033_0009597 3300049570 Bacteria 7447
168 Ga0501033_0062197 3300049570 Bacteria 2749
169 Ga0501034_0004042 3300049571 Bacteria 16459
170 Ga0501034_0290260 3300049571 Bacteria 1574
171 Ga0501036_0000118 3300049572 Bacteria 49383
172 Ga0501036_0035306 3300049572 Bacteria 4230
173 Ga0501036_0050769 3300049572 Bacteria 3512
174 Ga0501036_0055180 3300049572 Bacteria 3366
175 Ga0501036_0255978 3300049572 Bacteria 1466
176 Ga0501037_0090463 3300049573 Bacteria 2213
177 Ga0501038_0103715 3300049574 Bacteria 2364
178 Ga0501038_0139376 3300049574 Bacteria 1985
179 Ga0501038_0203343 3300049574 Bacteria 1588
180 Ga0501039_0089989 3300049575 Bacteria 2392
181 Ga0501039_0239511 3300049575 Bacteria 1426
182 Ga0501040_0183483 3300049576 Bacteria 1483
183 Ga0501043_0063313 3300049579 Bacteria 2904
184 Ga0501043_0072250 3300049579 Bacteria 2710
185 Ga0501046_0004123 3300049580 Bacteria 13244
186 Ga0501047_0000097 3300049581 Bacteria 107310
187 Ga0501047_0009528 3300049581 Bacteria 9180
188 Ga0501047_0051104 3300049581 Bacteria 3992
189 Ga0501047_0128481 3300049581 Bacteria 2414
190 Ga0501048_0000471 3300049582 Bacteria 28313
191 Ga0501048_0025192 3300049582 Bacteria 4335
192 Ga0501048_0048779 3300049582 Bacteria 3019
193 Ga0501067_0022701 3300049583 Bacteria 3472
194 Ga0501067_0023874 3300049583 Bacteria 3390
195 Ga0501067_0048775 3300049583 Bacteria 2348
196 Ga0501068_0016405 3300049584 Bacteria 4269
197 Ga0501069_0064066 3300049585 Bacteria 2054
198 Ga0501069_0108512 3300049585 Bacteria 1579
199 Ga0501070_0217212 3300049586 Bacteria 1568
200 Ga0501070_0356654 3300049586 Bacteria 1186
201 Ga0501072_0006758 3300049588 Bacteria 8714
202 Ga0501072_0015559 3300049588 Bacteria 5830
203 Ga0501072_0080823 3300049588 Bacteria 2575
204 Ga0501073_0105388 3300049589 Bacteria 1956
205 Ga0501074_0126118 3300049590 Bacteria 1831
206 Ga0501074_0128372 3300049590 Bacteria 1814
207 Ga0501074_0171903 3300049590 Bacteria 1546
208 Ga0501074_0417410 3300049590 Bacteria 952
209 Ga0501075_0199099 3300049591 Bacteria 1528
210 Ga0501080_0000047 3300049742 Bacteria 76956
211 Ga0501080_0070084 3300049742 Bacteria 3260
212 Ga0501080_0150231 3300049742 Bacteria 2153
213 Ga0501083_0014587 3300049744 Bacteria 5494
214 Ga0501083_0080861 3300049744 Bacteria 2154
215 Ga0501035_0001181 3300049822 Bacteria 27196
216 Ga0501035_0072995 3300049822 Bacteria 3036
217 Ga0501035_0227941 3300049822 Bacteria 1589
218 Ga0501044_0006644 3300049823 Bacteria 12751
219 Ga0501044_0088133 3300049823 Bacteria 3133
220 Ga0501044_0122851 3300049823 Bacteria 2595
221 nmdc:mga03683_26849_c1 3300050489 Bacteria 1900
222 nmdc:mga00v17_32090_c1 3300050491 Bacteria 3103
223 nmdc:mga0yw44_142274_c1 3300050492 Bacteria 1559
224 nmdc:mga0yw44_65842_c1 3300050492 Bacteria 2234
225 nmdc:mga0k408_24769_c1 3300050493 Bacteria 3395
226 nmdc:mga07m45_38000_c1 3300050496 Bacteria 2686
227 nmdc:mga07m45_73044_c1 3300050496 Bacteria 1953
228 nmdc:mga05p37_599085_c1 3300050507 Bacteria 1244
229 nmdc:mga09592_305318_c1 3300050508 Bacteria 1379
230 Ga0495601_0182814 3300053077 Bacteria 1370
231 Ga0495619_0030276 3300053085 Bacteria 3503
232 Ga0500562_022293 3300053108 Bacteria 1651
233 Ga0500595_036016 3300053119 Bacteria 1625
234 Ga0500568_0055208 3300053139 Bacteria 1551
235 Ga0500616_0146350 3300053153 Bacteria 1098
236 Ga0501084_0062834 3300054114 Bacteria 3108
237 Ga0501084_0296885 3300054114 Bacteria 1364
238 Ga0501084_0323942 3300054114 Bacteria 1301
239 Ga0501082_0031581 3300060353 Bacteria 4568
240 Ga0501082_0191319 3300060353 Bacteria 1780
241 Ga0501082_0222787 3300060353 Bacteria 1641
242 Ga0466962_0138549 3300061719 Bacteria 1178

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050489 nmdc:mga03683_26849_c1 nmdc:mga03683_26849_c1_926_1720 245
2 3300050491 nmdc:mga00v17_32090_c1 nmdc:mga00v17_32090_c1_1218_2012 245
3 3300053077 Ga0495601_0182814 Ga0495601_0182814_437_1321 261
4 3300013296 Ga0157374_10730184 Ga0157374_107301842 262
5 3300048910 Ga0496107_0157551 Ga0496107_0157551_818_1669 262
6 3300049581 Ga0501047_0009528 Ga0501047_0009528_5004_5882 269
7 3300049583 Ga0501067_0023874 Ga0501067_0023874_117_995 269
8 3300049588 Ga0501072_0006758 Ga0501072_0006758_2833_3711 269
9 3300031691 Ga0316579_10016323 Ga0316579_100163233 271
10 3300049569 Ga0501032_0102055 Ga0501032_0102055_223_1158 274
11 3300049822 Ga0501035_0072995 Ga0501035_0072995_1865_2800 274
12 3300006038 Ga0075365_10027955 Ga0075365_100279554 275
13 3300006844 Ga0075428_100104613 Ga0075428_1001046134 275
14 3300009094 Ga0111539_10264322 Ga0111539_102643221 275
15 3300049569 Ga0501032_0011431 Ga0501032_0011431_5338_6255 275
16 3300049569 Ga0501032_0076068 Ga0501032_0076068_637_1572 275
17 3300049571 Ga0501034_0004042 Ga0501034_0004042_7871_8788 275
18 3300049572 Ga0501036_0000118 Ga0501036_0000118_43368_44285 275
19 3300049572 Ga0501036_0055180 Ga0501036_0055180_1601_2536 275
20 3300049574 Ga0501038_0203343 Ga0501038_0203343_130_1047 275
21 3300049575 Ga0501039_0089989 Ga0501039_0089989_76_1017 275
22 3300049579 Ga0501043_0072250 Ga0501043_0072250_889_1824 275
23 3300049581 Ga0501047_0000097 Ga0501047_0000097_74784_75701 275
24 3300049581 Ga0501047_0051104 Ga0501047_0051104_2867_3802 275
25 3300049582 Ga0501048_0000471 Ga0501048_0000471_13591_14508 275
26 3300049586 Ga0501070_0217212 Ga0501070_0217212_55_972 275
27 3300049591 Ga0501075_0199099 Ga0501075_0199099_377_1318 275
28 3300049742 Ga0501080_0000047 Ga0501080_0000047_4459_5376 275
29 3300049822 Ga0501035_0227941 Ga0501035_0227941_100_1035 275
30 3300049823 Ga0501044_0006644 Ga0501044_0006644_5076_5993 275
31 3300049823 Ga0501044_0122851 Ga0501044_0122851_704_1639 275
32 3300060353 Ga0501082_0031581 Ga0501082_0031581_1040_1957 275
33 3300025905 Ga0207685_10045410 Ga0207685_100454102 276
34 3300035115 Ga0373941_0003475 Ga0373941_0003475_576_1514 276
35 3300025949 Ga0207667_10144531 Ga0207667_101445312 277
36 3300028666 Ga0265336_10024950 Ga0265336_100249502 277
37 3300028800 Ga0265338_10037297 Ga0265338_100372974 277
38 3300031241 Ga0265325_10020700 Ga0265325_100207002 277
39 3300031249 Ga0265339_10032221 Ga0265339_100322212 277
40 3300031595 Ga0265313_10051988 Ga0265313_100519883 277
41 3300031712 Ga0265342_10010378 Ga0265342_100103783 277
42 3300053085 Ga0495619_0030276 Ga0495619_0030276_2507_3487 278
43 3300060353 Ga0501082_0222787 Ga0501082_0222787_83_1012 278
44 3300005937 Ga0081455_10016549 Ga0081455_100165495 279
45 3300049570 Ga0501033_0009597 Ga0501033_0009597_148_1083 279
46 3300005618 Ga0068864_100145230 Ga0068864_1001452302 280
47 3300026095 Ga0207676_10129294 Ga0207676_101292943 280
48 3300031238 Ga0265332_10000201 Ga0265332_1000020146 280
49 3300031247 Ga0265340_10001728 Ga0265340_100017282 280
50 3300031249 Ga0265339_10002990 Ga0265339_1000299013 280
51 3300031344 Ga0265316_10131943 Ga0265316_101319431 280
52 3300031711 Ga0265314_10087363 Ga0265314_100873632 280
53 3300031712 Ga0265342_10000444 Ga0265342_100004445 280
54 3300054114 Ga0501084_0296885 Ga0501084_0296885_342_1283 280
55 3300054114 Ga0501084_0323942 Ga0501084_0323942_32_973 280
56 3300060353 Ga0501082_0191319 Ga0501082_0191319_652_1593 280
57 3300013307 Ga0157372_10002746 Ga0157372_1000274610 281
58 3300035115 Ga0373941_0116989 Ga0373941_0116989_29_913 282
59 3300035695 Ga0373927_0079463 Ga0373927_0079463_573_1541 282
60 3300006048 Ga0075363_100193259 Ga0075363_1001932592 283
61 3300014326 Ga0157380_10275590 Ga0157380_102755902 283
62 3300050492 nmdc:mga0yw44_142274_c1 nmdc:mga0yw44_142274_c1_122_1030 283
63 3300048903 Ga0496100_0155873 Ga0496100_0155873_454_1392 284
64 3300048907 Ga0496104_0001830 Ga0496104_0001830_2345_3283 284
65 3300048908 Ga0496105_0173622 Ga0496105_0173622_485_1423 284
66 3300048911 Ga0496108_0161120 Ga0496108_0161120_736_1674 284
67 3300048913 Ga0496110_0394083 Ga0496110_0394083_262_1200 284
68 3300048914 Ga0496111_0124506 Ga0496111_0124506_905_1843 284
69 3300048918 Ga0496115_0074019 Ga0496115_0074019_403_1341 284
70 3300005518 Ga0070699_100005520 Ga0070699_10000552011 285
71 3300044684 Ga0466966_0139602 Ga0466966_0139602_38_937 285
72 3300044693 Ga0466961_0034356 Ga0466961_0034356_1149_2048 285
73 3300044694 Ga0466963_0071456 Ga0466963_0071456_484_1383 285
74 3300045836 Ga0466958_0042937 Ga0466958_0042937_1468_2367 285
75 3300061719 Ga0466962_0138549 Ga0466962_0138549_22_921 285
76 3300009147 Ga0114129_10811071 Ga0114129_108110711 286
77 3300025921 Ga0207652_10346043 Ga0207652_103460432 286
78 3300037068 Ga0373925_0133449 Ga0373925_0133449_394_1362 286
79 3300039437 Ga0436365_0376759 Ga0436365_0376759_1877_2788 286
80 3300046517 Ga0495630_0263316 Ga0495630_0263316_43_1011 286
81 3300047319 Ga0495674_0232833 Ga0495674_0232833_184_1152 286
82 3300048909 Ga0496106_0045642 Ga0496106_0045642_611_1555 286
83 3300050507 nmdc:mga05p37_599085_c1 nmdc:mga05p37_599085_c1_10_960 286
84 3300053153 Ga0500616_0146350 Ga0500616_0146350_88_1029 286
85 iso_pu_bacteria 2891088606 2891091635 286
86 3300005937 Ga0081455_10136160 Ga0081455_101361602 287
87 3300048903 Ga0496100_0004174 Ga0496100_0004174_393_1313 287
88 3300048905 Ga0496102_0011421 Ga0496102_0011421_5257_6177 287
89 3300048907 Ga0496104_0002612 Ga0496104_0002612_12521_13441 287
90 3300048911 Ga0496108_0147250 Ga0496108_0147250_325_1245 287
91 3300048916 Ga0496113_0160943 Ga0496113_0160943_94_1014 287
92 3300049590 Ga0501074_0417410 Ga0501074_0417410_17_922 287
93 3300035171 Ga0373946_0077499 Ga0373946_0077499_263_1243 288
94 3300048915 Ga0496112_0284406 Ga0496112_0284406_296_1252 288
95 3300048918 Ga0496115_0023638 Ga0496115_0023638_804_1793 288
96 3300049569 Ga0501032_0033307 Ga0501032_0033307_221_1132 288
97 3300049569 Ga0501032_0144918 Ga0501032_0144918_490_1401 288
98 3300049570 Ga0501033_0062197 Ga0501033_0062197_645_1556 288
99 3300049572 Ga0501036_0050769 Ga0501036_0050769_1194_2105 288
100 3300049572 Ga0501036_0255978 Ga0501036_0255978_490_1401 288
101 3300049573 Ga0501037_0090463 Ga0501037_0090463_1194_2105 288
102 3300049574 Ga0501038_0103715 Ga0501038_0103715_964_1875 288
103 3300049574 Ga0501038_0139376 Ga0501038_0139376_884_1795 288
104 3300049575 Ga0501039_0239511 Ga0501039_0239511_461_1372 288
105 3300049576 Ga0501040_0183483 Ga0501040_0183483_289_1200 288
106 3300049579 Ga0501043_0063313 Ga0501043_0063313_1939_2850 288
107 3300049581 Ga0501047_0128481 Ga0501047_0128481_714_1625 288
108 3300049582 Ga0501048_0048779 Ga0501048_0048779_700_1611 288
109 3300049583 Ga0501067_0048775 Ga0501067_0048775_417_1328 288
110 3300049584 Ga0501068_0016405 Ga0501068_0016405_2906_3817 288
111 3300049585 Ga0501069_0064066 Ga0501069_0064066_1082_1993 288
112 3300049586 Ga0501070_0356654 Ga0501070_0356654_109_1020 288
113 3300049588 Ga0501072_0015559 Ga0501072_0015559_1391_2302 288
114 3300049588 Ga0501072_0080823 Ga0501072_0080823_794_1705 288
115 3300049589 Ga0501073_0105388 Ga0501073_0105388_937_1848 288
116 3300049590 Ga0501074_0128372 Ga0501074_0128372_231_1142 288
117 3300049590 Ga0501074_0171903 Ga0501074_0171903_534_1445 288
118 3300049742 Ga0501080_0070084 Ga0501080_0070084_1860_2771 288
119 3300049742 Ga0501080_0150231 Ga0501080_0150231_453_1364 288
120 3300049744 Ga0501083_0014587 Ga0501083_0014587_850_1761 288
121 3300049744 Ga0501083_0080861 Ga0501083_0080861_582_1493 288
122 3300005337 Ga0070682_100070624 Ga0070682_1000706242 289
123 3300005547 Ga0070693_100027173 Ga0070693_1000271733 289
124 3300006038 Ga0075365_10033254 Ga0075365_100332542 289
125 3300006177 Ga0075362_10073214 Ga0075362_100732142 289
126 3300049583 Ga0501067_0022701 Ga0501067_0022701_2284_3198 289
127 3300049823 Ga0501044_0088133 Ga0501044_0088133_1959_2873 289
128 3300036401 Ga0373937_0615520 Ga0373937_0615520_93_1007 290
129 3300048903 Ga0496100_0199573 Ga0496100_0199573_407_1339 290
130 3300048907 Ga0496104_0000645 Ga0496104_0000645_9458_10390 290
131 3300048908 Ga0496105_0011193 Ga0496105_0011193_1859_2791 290
132 3300048912 Ga0496109_0088482 Ga0496109_0088482_1787_2719 290
133 3300048913 Ga0496110_0439313 Ga0496110_0439313_254_1162 290
134 3300048915 Ga0496112_0214597 Ga0496112_0214597_25_957 290
135 3300049568 Ga0501031_0078613 Ga0501031_0078613_801_1781 290
136 3300049572 Ga0501036_0035306 Ga0501036_0035306_1190_2170 290
137 3300049580 Ga0501046_0004123 Ga0501046_0004123_1669_2649 290
138 3300049582 Ga0501048_0025192 Ga0501048_0025192_2474_3454 290
139 3300054114 Ga0501084_0062834 Ga0501084_0062834_1341_2321 290
140 3300005564 Ga0070664_100449955 Ga0070664_1004499552 291
141 3300005614 Ga0068856_100073360 Ga0068856_1000733602 291
142 3300048904 Ga0496101_0036131 Ga0496101_0036131_773_1705 291
143 3300048909 Ga0496106_0000741 Ga0496106_0000741_21661_22593 291
144 3300048912 Ga0496109_0234123 Ga0496109_0234123_50_982 291
145 3300048913 Ga0496110_0017259 Ga0496110_0017259_1142_2074 291
146 3300048913 Ga0496110_0023375 Ga0496110_0023375_4062_4994 291
147 3300048914 Ga0496111_0008574 Ga0496111_0008574_1116_2048 291
148 3300048914 Ga0496111_0126103 Ga0496111_0126103_214_1146 291
149 3300048915 Ga0496112_0038951 Ga0496112_0038951_288_1220 291
150 3300048915 Ga0496112_0193595 Ga0496112_0193595_775_1707 291
151 3300048918 Ga0496115_0095986 Ga0496115_0095986_578_1510 291
152 3300050492 nmdc:mga0yw44_65842_c1 nmdc:mga0yw44_65842_c1_327_1256 291
153 3300053119 Ga0500595_036016 Ga0500595_036016_456_1367 291
154 3300006195 Ga0075366_10002442 Ga0075366_100024429 292
155 3300021388 Ga0213875_10063998 Ga0213875_100639981 292
156 3300036401 Ga0373937_0006933 Ga0373937_0006933_1671_2666 292
157 3300037853 Ga0436364_1503894 Ga0436364_1503894_2308_3231 292
158 3300048903 Ga0496100_0022751 Ga0496100_0022751_1380_2309 292
159 3300048907 Ga0496104_0041713 Ga0496104_0041713_2405_3334 292
160 3300048908 Ga0496105_0033130 Ga0496105_0033130_2032_2961 292
161 3300048909 Ga0496106_0185123 Ga0496106_0185123_209_1138 292
162 3300048914 Ga0496111_0114062 Ga0496111_0114062_246_1175 292
163 3300050493 nmdc:mga0k408_24769_c1 nmdc:mga0k408_24769_c1_802_1722 292
164 3300025936 Ga0207670_10304778 Ga0207670_103047782 293
165 3300049571 Ga0501034_0290260 Ga0501034_0290260_414_1361 293
166 3300005354 Ga0070675_100129846 Ga0070675_1001298462 294
167 3300005356 Ga0070674_100043432 Ga0070674_1000434322 294
168 3300005364 Ga0070673_100054608 Ga0070673_1000546085 294
169 3300014326 Ga0157380_10174041 Ga0157380_101740412 294
170 3300025926 Ga0207659_10139035 Ga0207659_101390353 294
171 3300025960 Ga0207651_10243995 Ga0207651_102439952 294
172 3300026075 Ga0207708_10090831 Ga0207708_100908312 294
173 3300031456 Ga0307513_10162222 Ga0307513_101622223 294
174 3300050496 nmdc:mga07m45_38000_c1 nmdc:mga07m45_38000_c1_962_1885 294
175 3300006881 Ga0068865_100089123 Ga0068865_1000891232 295
176 3300025941 Ga0207711_10005997 Ga0207711_1000599710 295
177 3300031456 Ga0307513_10090760 Ga0307513_100907601 295
178 3300035242 Ga0373962_0008678 Ga0373962_0008678_1533_2489 295
179 3300035691 Ga0373931_0003448 Ga0373931_0003448_1685_2641 295
180 3300048903 Ga0496100_0130839 Ga0496100_0130839_578_1534 295
181 3300048904 Ga0496101_0015722 Ga0496101_0015722_2391_3347 295
182 3300048905 Ga0496102_0107589 Ga0496102_0107589_1034_1990 295
183 3300048906 Ga0496103_0056587 Ga0496103_0056587_322_1278 295
184 3300048907 Ga0496104_0015366 Ga0496104_0015366_4686_5642 295
185 3300048910 Ga0496107_0016568 Ga0496107_0016568_1126_2082 295
186 3300048912 Ga0496109_0013908 Ga0496109_0013908_5993_6949 295
187 3300048913 Ga0496110_0003581 Ga0496110_0003581_5856_6812 295
188 3300048914 Ga0496111_0095952 Ga0496111_0095952_748_1704 295
189 3300048915 Ga0496112_0489828 Ga0496112_0489828_112_1068 295
190 3300049590 Ga0501074_0126118 Ga0501074_0126118_312_1268 295
191 3300005330 Ga0070690_100091073 Ga0070690_1000910732 296
192 3300005331 Ga0070670_100306884 Ga0070670_1003068842 296
193 3300005340 Ga0070689_100002808 Ga0070689_1000028087 296
194 3300005343 Ga0070687_100173740 Ga0070687_1001737402 296
195 3300005347 Ga0070668_100023759 Ga0070668_1000237593 296
196 3300005353 Ga0070669_100076125 Ga0070669_1000761253 296
197 3300005356 Ga0070674_100041860 Ga0070674_1000418602 296
198 3300005367 Ga0070667_100131416 Ga0070667_1001314162 296
199 3300005458 Ga0070681_10158524 Ga0070681_101585243 296
200 3300005466 Ga0070685_10111491 Ga0070685_101114911 296
201 3300005544 Ga0070686_100075523 Ga0070686_1000755232 296
202 3300005617 Ga0068859_100252856 Ga0068859_1002528562 296
203 3300005618 Ga0068864_100063998 Ga0068864_1000639983 296
204 3300005843 Ga0068860_100209685 Ga0068860_1002096852 296
205 3300006931 Ga0097620_100252842 Ga0097620_1002528422 296
206 3300009148 Ga0105243_10389510 Ga0105243_103895102 296
207 3300009177 Ga0105248_10327040 Ga0105248_103270402 296
208 3300014325 Ga0163163_10024888 Ga0163163_100248884 296
209 3300025912 Ga0207707_10268102 Ga0207707_102681022 296
210 3300025917 Ga0207660_10190792 Ga0207660_101907921 296
211 3300025926 Ga0207659_10141045 Ga0207659_101410453 296
212 3300025936 Ga0207670_10003194 Ga0207670_100031945 296
213 3300025941 Ga0207711_10218104 Ga0207711_102181042 296
214 3300025961 Ga0207712_10165914 Ga0207712_101659142 296
215 3300025972 Ga0207668_10020685 Ga0207668_100206853 296
216 3300025986 Ga0207658_10394865 Ga0207658_103948651 296
217 3300026095 Ga0207676_10046072 Ga0207676_100460722 296
218 3300026118 Ga0207675_100441756 Ga0207675_1004417561 296
219 3300026121 Ga0207683_10012539 Ga0207683_100125397 296
220 3300035691 Ga0373931_0000543 Ga0373931_0000543_1584_2567 296
221 3300048912 Ga0496109_0005806 Ga0496109_0005806_514_1497 296
222 3300053108 Ga0500562_022293 Ga0500562_022293_321_1277 296
223 3300006846 Ga0075430_100097203 Ga0075430_1000972033 297
224 3300050508 nmdc:mga09592_305318_c1 nmdc:mga09592_305318_c1_309_1298 299
225 3300053139 Ga0500568_0055208 Ga0500568_0055208_203_1165 299
226 3300006177 Ga0075362_10046965 Ga0075362_100469652 301
227 3300006358 Ga0068871_100351900 Ga0068871_1003519001 303
228 3300050496 nmdc:mga07m45_73044_c1 nmdc:mga07m45_73044_c1_144_1109 303
229 3300005937 Ga0081455_10004914 Ga0081455_100049142 306
230 3300049585 Ga0501069_0108512 Ga0501069_0108512_332_1303 306
231 3300049822 Ga0501035_0001181 Ga0501035_0001181_14727_15698 306
232 3300005364 Ga0070673_100111667 Ga0070673_1001116672 307
233 3300005438 Ga0070701_10021462 Ga0070701_100214621 307
234 3300005937 Ga0081455_10129614 Ga0081455_101296142 307
235 3300025960 Ga0207651_10187268 Ga0207651_101872682 307
236 3300005327 Ga0070658_10037047 Ga0070658_100370473 308
237 3300014326 Ga0157380_10442552 Ga0157380_104425521 308
238 3300025919 Ga0207657_10052351 Ga0207657_100523513 308
239 3300025921 Ga0207652_10021185 Ga0207652_100211853 308
240 3300005615 Ga0070702_100072436 Ga0070702_1000724362 310
241 3300031247 Ga0265340_10045644 Ga0265340_100456441 312
242 3300003215 JGI25153J46596_10001258 JGI25153J46596_1000125815 319
243 3300025297 Ga0209758_1000179 Ga0209758_100017915 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23016

RsmI_C

RsmI C-terminal HTH domain

280

325

0.94

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

46

246

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fq6-assembly1.cif.gz_A the crystal structure of a methyltransferase domain from bacteroides thetaiotaomicron vpi 0.9066 152 263
3ffy-assembly1.cif.gz_A-2 putative tetrapyrrole (corrin/porphyrin) methyltransferase from bacteroides fragilis. 0.9053 154 261
3hh1-assembly2.cif.gz_C the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.8868 49 148
3fq6-assembly1.cif.gz_A the crystal structure of a methyltransferase domain from bacteroides thetaiotaomicron vpi 0.8766 152 263
3hh1-assembly1.cif.gz_B the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.8702 49 149
ID Description Score Start End Superfamily
3kwpA02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9305 149 263 3.30.950.10
af_P9WGW7_115_230_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9295 149 262 3.30.950.10
5hw4C02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9289 149 260 3.30.950.10
af_Q2G1S1_111_230_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9194 149 265 3.30.950.10
af_Q338C6_169_282_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9156 150 263 3.30.950.10
ID Description Score Start End GO Terms
AF-A0A434SIK6-F1-model_v4 rRNA (Cytidine-2'-O-)-methyltransferase 0.9856 35 125 GO:0008168
GO:0032259
AF-A0A7C6TVT8-F1-model_v4 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase 0.9708 53 131 GO:0008168
GO:0032259
AF-A0A3C1WV85-F1-model_v4 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase 0.9554 51 130 GO:0008168
GO:0032259
AF-A0A7X6PCS8-F1-model_v4 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase 0.9493 53 130 GO:0008168
GO:0032259
AF-A0A7C6TVT8-F1-model_v4 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase 0.9472 53 131 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
82.35 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map