F355375

General Info

Members Datasets Scaffolds Average Seq Length
243 136 486 205

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100026023|Ga0070700_1000260235
Length 243
Sequence LCPVLFRSDWSATVSVAGRRASEDACAPVVNCTPQACVPNMVRDGIPFVIVPIVLAIIPLIFGYWWAAIPLLLIAAFMAYFFRNPRRSIPLVPGIVVAPADGRVTLVRPADDKNPESLVSIFLSPFDVHLNRAPIAGEIVEIAYKKGKFVMATKEESRDLNEQNRLIIKGDRMVVTCTQIAGVLARRIVCWKRRGERVECGELFGMIKFGSRTDLLMPREIEIVIKTGMRVRGGETIIGKIKS

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
118 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
119 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.82
Rhizosphere 97.94
Stem 0
Stem Tuber 0
Unclassified 31.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_100026023 3300005441 Unclassified 3450
2 JGI24034J26672_10000005 3300002239 Bacteria 404185
3 rootL2_10187782 3300003322 Unclassified 2767
4 Ga0065704_10154953 3300005289 Bacteria 1398
5 Ga0065707_10005657 3300005295 Unclassified 3013
6 Ga0070676_10145240 3300005328 Bacteria 1514
7 Ga0070676_10298063 3300005328 Bacteria 1092
8 Ga0070690_100062439 3300005330 Bacteria 2402
9 Ga0068869_100021522 3300005334 Bacteria 4437
10 Ga0068869_100240482 3300005334 Unclassified 1442
11 Ga0070680_100002766 3300005336 Bacteria 13024
12 Ga0070680_100048117 3300005336 Bacteria 3475
13 Ga0070680_100069450 3300005336 Bacteria 2893
14 Ga0070682_100000123 3300005337 Bacteria 68616
15 Ga0070689_100214508 3300005340 Bacteria 1577
16 Ga0070691_10112010 3300005341 Bacteria 1366
17 Ga0070692_10072699 3300005345 Bacteria 1835
18 Ga0070668_100022530 3300005347 Unclassified 4762
19 Ga0070669_100002372 3300005353 Bacteria 13620
20 Ga0070669_100625191 3300005353 Bacteria 904
21 Ga0070675_100046286 3300005354 Bacteria 3562
22 Ga0070675_100274077 3300005354 Bacteria 1481
23 Ga0070671_100026645 3300005355 Unclassified 4753
24 Ga0070673_100039588 3300005364 Bacteria 3609
25 Ga0070673_100068605 3300005364 Bacteria 2840
26 Ga0070673_100109062 3300005364 Bacteria 2293
27 Ga0070673_100278481 3300005364 Bacteria 1466
28 Ga0070703_10000145 3300005406 Bacteria 36771
29 Ga0070701_10060846 3300005438 Bacteria 1990
30 Ga0070705_100592551 3300005440 Unclassified 856
31 Ga0070705_100679114 3300005440 Bacteria 806
32 Ga0070700_100054741 3300005441 Bacteria 2494
33 Ga0070694_100001069 3300005444 Bacteria 15658
34 Ga0070694_100051650 3300005444 Bacteria 2776
35 Ga0070694_100058449 3300005444 Unclassified 2624
36 Ga0070708_100746566 3300005445 Archaea 920
37 Ga0070662_100967012 3300005457 Unclassified 728
38 Ga0068867_100095794 3300005459 Unclassified 2258
39 Ga0070706_100005318 3300005467 Bacteria 12269
40 Ga0070706_100030025 3300005467 Bacteria 5006
41 Ga0070707_100000562 3300005468 Bacteria 37302
42 Ga0070707_100010695 3300005468 Bacteria 8547
43 Ga0070698_100018094 3300005471 Bacteria 7420
44 Ga0070698_100345420 3300005471 Unclassified 1419
45 Ga0070699_100239158 3300005518 Unclassified 1620
46 Ga0070679_100000011 3300005530 Bacteria 162902
47 Ga0070686_100019015 3300005544 Unclassified 4042
48 Ga0070686_100151665 3300005544 Bacteria 1624
49 Ga0070695_100079664 3300005545 Bacteria 2163
50 Ga0070695_100101685 3300005545 Bacteria 1937
51 Ga0070695_100179805 3300005545 Bacteria 1498
52 Ga0070704_100075126 3300005549 Bacteria 2467
53 Ga0070704_100123185 3300005549 Bacteria 1996
54 Ga0070664_100464750 3300005564 Bacteria 1163
55 Ga0068854_101118557 3300005578 Archaea 702
56 Ga0068852_100333630 3300005616 Bacteria 1476
57 Ga0068859_100019866 3300005617 Bacteria 6744
58 Ga0068859_100108935 3300005617 Bacteria 2831
59 Ga0068859_100262267 3300005617 Bacteria 1819
60 Ga0068864_100119279 3300005618 Bacteria 2357
61 Ga0068864_100140257 3300005618 Bacteria 2180
62 Ga0068864_101093040 3300005618 Unclassified 793
63 Ga0068866_10078511 3300005718 Unclassified 1766
64 Ga0068861_100292988 3300005719 Unclassified 1406
65 Ga0068861_100362028 3300005719 Unclassified 1276
66 Ga0068861_100517728 3300005719 Unclassified 1081
67 Ga0068861_100794856 3300005719 Unclassified 887
68 Ga0068858_100000134 3300005842 Bacteria 77566
69 Ga0068858_100050132 3300005842 Unclassified 3864
70 Ga0068858_100122707 3300005842 Bacteria 2431
71 Ga0068858_100181799 3300005842 Unclassified 1986
72 Ga0068860_100005379 3300005843 Bacteria 12991
73 Ga0068860_100046415 3300005843 Unclassified 4141
74 Ga0068860_100833874 3300005843 Unclassified 936
75 Ga0068860_101102974 3300005843 Bacteria 813
76 Ga0068862_100010977 3300005844 Bacteria 7480
77 Ga0068862_100031718 3300005844 Unclassified 4463
78 Ga0068862_100456842 3300005844 Unclassified 1205
79 Ga0081455_10221427 3300005937 Bacteria 1402
80 Ga0081539_10002990 3300005985 Bacteria 22130
81 Ga0081539_10220198 3300005985 Unclassified 864
82 Ga0075428_100090360 3300006844 Unclassified 3340
83 Ga0075428_100150070 3300006844 Unclassified 2532
84 Ga0075428_100293713 3300006844 Bacteria 1748
85 Ga0075431_100021953 3300006847 Bacteria 6527
86 Ga0075431_100100502 3300006847 Unclassified 2984
87 Ga0075433_10013607 3300006852 Bacteria 6623
88 Ga0075433_10160283 3300006852 Bacteria 2002
89 Ga0075433_10993454 3300006852 Unclassified 731
90 Ga0075434_100044720 3300006871 Unclassified 4392
91 Ga0075434_100257622 3300006871 Unclassified 1763
92 Ga0068865_100103969 3300006881 Bacteria 2084
93 Ga0068865_100450146 3300006881 Bacteria 1064
94 Ga0075436_100000008 3300006914 Bacteria 279288
95 Ga0097620_100019868 3300006931 Bacteria 6744
96 Ga0097620_100108934 3300006931 Bacteria 2831
97 Ga0097620_100262290 3300006931 Bacteria 1819
98 Ga0075435_100268827 3300007076 Unclassified 1454
99 Ga0099794_10008083 3300007265 Unclassified 4356
100 Ga0099795_10100350 3300007788 Unclassified 1135
101 Ga0111539_10030531 3300009094 Bacteria 6549
102 Ga0111539_10038050 3300009094 Bacteria 5804
103 Ga0111539_10065418 3300009094 Bacteria 4296
104 Ga0111539_10101344 3300009094 Bacteria 3381
105 Ga0111539_10127624 3300009094 Bacteria 2979
106 Ga0111539_10462894 3300009094 Unclassified 1477
107 Ga0105245_10990505 3300009098 Unclassified 885
108 Ga0105247_10000022 3300009101 Bacteria 219796
109 Ga0114129_10010337 3300009147 Bacteria 13309
110 Ga0114129_10057817 3300009147 Bacteria 5426
111 Ga0105243_10000207 3300009148 Bacteria 68914
112 Ga0105243_10000245 3300009148 Bacteria 62285
113 Ga0105243_10038720 3300009148 Bacteria 3714
114 Ga0105243_10058486 3300009148 Unclassified 3072
115 Ga0105243_10143328 3300009148 Bacteria 2041
116 Ga0105243_11380199 3300009148 Unclassified 724
117 Ga0105241_10126993 3300009174 Unclassified 2061
118 Ga0105242_10000095 3300009176 Bacteria 62254
119 Ga0105242_10001183 3300009176 Bacteria 20547
120 Ga0105242_10481119 3300009176 Bacteria 1177
121 Ga0105248_10004079 3300009177 Bacteria 16149
122 Ga0105248_10047410 3300009177 Bacteria 4818
123 Ga0105248_10116782 3300009177 Unclassified 3009
124 Ga0105249_10000288 3300009553 Bacteria 51931
125 Ga0105249_10011609 3300009553 Bacteria 7743
126 Ga0105249_10081849 3300009553 Unclassified 3002
127 Ga0105249_10726531 3300009553 Bacteria 1054
128 Ga0105239_10218759 3300010375 Bacteria 2136
129 Ga0105246_10497237 3300011119 Bacteria 1035
130 Ga0157378_10000191 3300013297 Bacteria 59071
131 Ga0157378_10008819 3300013297 Bacteria 8780
132 Ga0157378_10052878 3300013297 Bacteria 3614
133 Ga0163162_10000211 3300013306 Bacteria 54106
134 Ga0163162_10009647 3300013306 Bacteria 9389
135 Ga0163162_10210799 3300013306 Unclassified 2073
136 Ga0163162_10427373 3300013306 Unclassified 1457
137 Ga0157375_10079867 3300013308 Bacteria 3307
138 Ga0157375_10094752 3300013308 Bacteria 3055
139 Ga0157375_10101203 3300013308 Bacteria 2964
140 Ga0157375_10262289 3300013308 Bacteria 1889
141 Ga0163163_10042266 3300014325 Bacteria 4463
142 Ga0163163_10117397 3300014325 Unclassified 2692
143 Ga0163163_10251318 3300014325 Bacteria 1818
144 Ga0163163_10421436 3300014325 Bacteria 1394
145 Ga0157380_10010321 3300014326 Bacteria 6714
146 Ga0157380_10098312 3300014326 Unclassified 2432
147 Ga0157379_10086673 3300014968 Unclassified 2807
148 Ga0157379_10120807 3300014968 Bacteria 2356
149 Ga0207672_1000046 3300025223 Bacteria 16046
150 Ga0207653_10000008 3300025885 Bacteria 197323
151 Ga0207642_10003303 3300025899 Bacteria 5071
152 Ga0207710_10000001 3300025900 Bacteria 1797433
153 Ga0207645_10100761 3300025907 Bacteria 1863
154 Ga0207645_10104476 3300025907 Bacteria 1829
155 Ga0207684_10007438 3300025910 Bacteria 9858
156 Ga0207684_10013064 3300025910 Bacteria 7188
157 Ga0207684_10290775 3300025910 Unclassified 1409
158 Ga0207707_10000028 3300025912 Bacteria 167115
159 Ga0207660_10001672 3300025917 Bacteria 14861
160 Ga0207660_10070839 3300025917 Bacteria 2535
161 Ga0207660_10580940 3300025917 Bacteria 912
162 Ga0207662_10031912 3300025918 Unclassified 3063
163 Ga0207652_10000443 3300025921 Bacteria 42831
164 Ga0207646_10004429 3300025922 Bacteria 15249
165 Ga0207646_10009214 3300025922 Bacteria 9785
166 Ga0207646_10341633 3300025922 Bacteria 1353
167 Ga0207650_10106299 3300025925 Bacteria 2167
168 Ga0207659_10158822 3300025926 Bacteria 1773
169 Ga0207644_10013022 3300025931 Bacteria 5534
170 Ga0207644_10354730 3300025931 Unclassified 1192
171 Ga0207706_10785343 3300025933 Unclassified 810
172 Ga0207686_10000126 3300025934 Bacteria 61970
173 Ga0207686_10000820 3300025934 Bacteria 18978
174 Ga0207709_10000258 3300025935 Bacteria 63271
175 Ga0207709_10187093 3300025935 Unclassified 1467
176 Ga0207670_10019533 3300025936 Bacteria 4140
177 Ga0207704_10153324 3300025938 Bacteria 1629
178 Ga0207665_10019224 3300025939 Bacteria 4489
179 Ga0207711_10073642 3300025941 Unclassified 2969
180 Ga0207679_10278499 3300025945 Bacteria 1433
181 Ga0207651_10017177 3300025960 Bacteria 4266
182 Ga0207651_10027582 3300025960 Bacteria 3569
183 Ga0207712_10000180 3300025961 Bacteria 65420
184 Ga0207712_10593051 3300025961 Bacteria 958
185 Ga0207668_10049552 3300025972 Unclassified 2888
186 Ga0207677_10442842 3300026023 Bacteria 1111
187 Ga0207703_10000481 3300026035 Bacteria 41719
188 Ga0207703_10036393 3300026035 Unclassified 3918
189 Ga0207708_10013207 3300026075 Bacteria 6165
190 Ga0207708_10015735 3300026075 Bacteria 5675
191 Ga0207708_10065451 3300026075 Unclassified 2778
192 Ga0207708_10202196 3300026075 Bacteria 1585
193 Ga0207641_10130938 3300026088 Bacteria 2253
194 Ga0207676_10015161 3300026095 Bacteria 5559
195 Ga0207676_10112253 3300026095 Bacteria 2283
196 Ga0207675_100192011 3300026118 Unclassified 1959
197 Ga0207675_100413186 3300026118 Bacteria 1332
198 Ga0207675_100425453 3300026118 Unclassified 1312
199 Ga0207675_100454698 3300026118 Bacteria 1269
200 Ga0209588_1024854 3300027671 Bacteria 1893
201 Ga0207428_10002967 3300027907 Bacteria 16785
202 Ga0268265_10018901 3300028380 Unclassified 4783
203 Ga0268265_10062368 3300028380 Unclassified 2864
204 Ga0268264_10028440 3300028381 Bacteria 4573
205 Ga0268264_10095613 3300028381 Bacteria 2571
206 Ga0307513_10005443 3300031456 Bacteria 16822
207 Ga0395900_0084857 3300037418 Bacteria 3255
208 Ga0395905_0128242 3300037471 Bacteria 2386
209 Ga0395901_1191637 3300038443 Unclassified 728
210 Ga0436365_1161930 3300039437 Bacteria 1559
211 Ga0439434_0020860 3300042435 Unclassified 1968
212 Ga0451577_0114665 3300042876 Bacteria 2412
213 Ga0453683_0004520 3300044673 Bacteria 9849
214 Ga0453684_0148057 3300044712 Bacteria 2794
215 Ga0495632_0051096 3300046519 Bacteria 2036
216 Ga0495663_0000586 3300046525 Bacteria 12771
217 Ga0495663_0214067 3300046525 Unclassified 676
218 Ga0495598_0041227 3300046537 Unclassified 1349
219 Ga0495621_0040369 3300046539 Bacteria 1635
220 Ga0495633_0098281 3300046558 Unclassified 1359
221 Ga0495656_0100559 3300046615 Unclassified 1337
222 Ga0495656_0136636 3300046615 Bacteria 1171
223 Ga0495659_0015547 3300046664 Bacteria 2503
224 Ga0495659_0075962 3300046664 Bacteria 1267
225 Ga0495636_0046983 3300047318 Bacteria 1802
226 Ga0496106_0018498 3300048909 Bacteria 5153
227 Ga0496106_0434838 3300048909 Bacteria 1054
228 Ga0501036_0803854 3300049572 Unclassified 774
229 Ga0501076_0485379 3300049592 Bacteria 1018
230 Ga0501079_0596772 3300049741 Unclassified 869
231 Ga0501081_0514966 3300049743 Bacteria 892
232 nmdc:mga05p37_467381_c1 3300050507 Unclassified 1456
233 nmdc:mga05p37_64113_c1 3300050507 Unclassified 4521
234 nmdc:mga09592_40863_c1 3300050508 Unclassified 3897
235 nmdc:mga06r32_184835_c1 3300050510 Unclassified 2071
236 nmdc:mga06r32_90802_c1 3300050510 Unclassified 2984
237 nmdc:mga08y16_155593_c1 3300050511 Bacteria 2376
238 nmdc:mga08y16_195415_c1 3300050511 Unclassified 2097
239 nmdc:mga08y16_30070_c1 3300050511 Bacteria 5719
240 nmdc:mga08y16_55290_c1 3300050511 Unclassified 4148
241 nmdc:mga0n895_89999_c1 3300050512 Unclassified 3070
242 nmdc:mga0rr50_402_c1 3300050513 Bacteria 23540
243 nmdc:mga08x19_16_c1 3300050514 Bacteria 348119
244 Ga0070700_100026023
245 JGI24034J26672_10000005
246 rootL2_10187782
247 Ga0065704_10154953
248 Ga0065707_10005657
249 Ga0070676_10145240
250 Ga0070676_10298063
251 Ga0070690_100062439
252 Ga0068869_100021522
253 Ga0068869_100240482
254 Ga0070680_100002766
255 Ga0070680_100048117
256 Ga0070680_100069450
257 Ga0070682_100000123
258 Ga0070689_100214508
259 Ga0070691_10112010
260 Ga0070692_10072699
261 Ga0070668_100022530
262 Ga0070669_100002372
263 Ga0070669_100625191
264 Ga0070675_100046286
265 Ga0070675_100274077
266 Ga0070671_100026645
267 Ga0070673_100039588
268 Ga0070673_100068605
269 Ga0070673_100109062
270 Ga0070673_100278481
271 Ga0070703_10000145
272 Ga0070701_10060846
273 Ga0070705_100592551
274 Ga0070705_100679114
275 Ga0070700_100054741
276 Ga0070694_100001069
277 Ga0070694_100051650
278 Ga0070694_100058449
279 Ga0070708_100746566
280 Ga0070662_100967012
281 Ga0068867_100095794
282 Ga0070706_100005318
283 Ga0070706_100030025
284 Ga0070707_100000562
285 Ga0070707_100010695
286 Ga0070698_100018094
287 Ga0070698_100345420
288 Ga0070699_100239158
289 Ga0070679_100000011
290 Ga0070686_100019015
291 Ga0070686_100151665
292 Ga0070695_100079664
293 Ga0070695_100101685
294 Ga0070695_100179805
295 Ga0070704_100075126
296 Ga0070704_100123185
297 Ga0070664_100464750
298 Ga0068854_101118557
299 Ga0068852_100333630
300 Ga0068859_100019866
301 Ga0068859_100108935
302 Ga0068859_100262267
303 Ga0068864_100119279
304 Ga0068864_100140257
305 Ga0068864_101093040
306 Ga0068866_10078511
307 Ga0068861_100292988
308 Ga0068861_100362028
309 Ga0068861_100517728
310 Ga0068861_100794856
311 Ga0068858_100000134
312 Ga0068858_100050132
313 Ga0068858_100122707
314 Ga0068858_100181799
315 Ga0068860_100005379
316 Ga0068860_100046415
317 Ga0068860_100833874
318 Ga0068860_101102974
319 Ga0068862_100010977
320 Ga0068862_100031718
321 Ga0068862_100456842
322 Ga0081455_10221427
323 Ga0081539_10002990
324 Ga0081539_10220198
325 Ga0075428_100090360
326 Ga0075428_100150070
327 Ga0075428_100293713
328 Ga0075431_100021953
329 Ga0075431_100100502
330 Ga0075433_10013607
331 Ga0075433_10160283
332 Ga0075433_10993454
333 Ga0075434_100044720
334 Ga0075434_100257622
335 Ga0068865_100103969
336 Ga0068865_100450146
337 Ga0075436_100000008
338 Ga0097620_100019868
339 Ga0097620_100108934
340 Ga0097620_100262290
341 Ga0075435_100268827
342 Ga0099794_10008083
343 Ga0099795_10100350
344 Ga0111539_10030531
345 Ga0111539_10038050
346 Ga0111539_10065418
347 Ga0111539_10101344
348 Ga0111539_10127624
349 Ga0111539_10462894
350 Ga0105245_10990505
351 Ga0105247_10000022
352 Ga0114129_10010337
353 Ga0114129_10057817
354 Ga0105243_10000207
355 Ga0105243_10000245
356 Ga0105243_10038720
357 Ga0105243_10058486
358 Ga0105243_10143328
359 Ga0105243_11380199
360 Ga0105241_10126993
361 Ga0105242_10000095
362 Ga0105242_10001183
363 Ga0105242_10481119
364 Ga0105248_10004079
365 Ga0105248_10047410
366 Ga0105248_10116782
367 Ga0105249_10000288
368 Ga0105249_10011609
369 Ga0105249_10081849
370 Ga0105249_10726531
371 Ga0105239_10218759
372 Ga0105246_10497237
373 Ga0157378_10000191
374 Ga0157378_10008819
375 Ga0157378_10052878
376 Ga0163162_10000211
377 Ga0163162_10009647
378 Ga0163162_10210799
379 Ga0163162_10427373
380 Ga0157375_10079867
381 Ga0157375_10094752
382 Ga0157375_10101203
383 Ga0157375_10262289
384 Ga0163163_10042266
385 Ga0163163_10117397
386 Ga0163163_10251318
387 Ga0163163_10421436
388 Ga0157380_10010321
389 Ga0157380_10098312
390 Ga0157379_10086673
391 Ga0157379_10120807
392 Ga0207672_1000046
393 Ga0207653_10000008
394 Ga0207642_10003303
395 Ga0207710_10000001
396 Ga0207645_10100761
397 Ga0207645_10104476
398 Ga0207684_10007438
399 Ga0207684_10013064
400 Ga0207684_10290775
401 Ga0207707_10000028
402 Ga0207660_10001672
403 Ga0207660_10070839
404 Ga0207660_10580940
405 Ga0207662_10031912
406 Ga0207652_10000443
407 Ga0207646_10004429
408 Ga0207646_10009214
409 Ga0207646_10341633
410 Ga0207650_10106299
411 Ga0207659_10158822
412 Ga0207644_10013022
413 Ga0207644_10354730
414 Ga0207706_10785343
415 Ga0207686_10000126
416 Ga0207686_10000820
417 Ga0207709_10000258
418 Ga0207709_10187093
419 Ga0207670_10019533
420 Ga0207704_10153324
421 Ga0207665_10019224
422 Ga0207711_10073642
423 Ga0207679_10278499
424 Ga0207651_10017177
425 Ga0207651_10027582
426 Ga0207712_10000180
427 Ga0207712_10593051
428 Ga0207668_10049552
429 Ga0207677_10442842
430 Ga0207703_10000481
431 Ga0207703_10036393
432 Ga0207708_10013207
433 Ga0207708_10015735
434 Ga0207708_10065451
435 Ga0207708_10202196
436 Ga0207641_10130938
437 Ga0207676_10015161
438 Ga0207676_10112253
439 Ga0207675_100192011
440 Ga0207675_100413186
441 Ga0207675_100425453
442 Ga0207675_100454698
443 Ga0209588_1024854
444 Ga0207428_10002967
445 Ga0268265_10018901
446 Ga0268265_10062368
447 Ga0268264_10028440
448 Ga0268264_10095613
449 Ga0307513_10005443
450 Ga0395900_0084857
451 Ga0395905_0128242
452 Ga0395901_1191637
453 Ga0436365_1161930
454 Ga0439434_0020860
455 Ga0451577_0114665
456 Ga0453683_0004520
457 Ga0453684_0148057
458 Ga0495632_0051096
459 Ga0495663_0000586
460 Ga0495663_0214067
461 Ga0495598_0041227
462 Ga0495621_0040369
463 Ga0495633_0098281
464 Ga0495656_0100559
465 Ga0495656_0136636
466 Ga0495659_0015547
467 Ga0495659_0075962
468 Ga0495636_0046983
469 Ga0496106_0018498
470 Ga0496106_0434838
471 Ga0501036_0803854
472 Ga0501076_0485379
473 Ga0501079_0596772
474 Ga0501081_0514966
475 nmdc:mga05p37_467381_c1
476 nmdc:mga05p37_64113_c1
477 nmdc:mga09592_40863_c1
478 nmdc:mga06r32_184835_c1
479 nmdc:mga06r32_90802_c1
480 nmdc:mga08y16_155593_c1
481 nmdc:mga08y16_195415_c1
482 nmdc:mga08y16_30070_c1
483 nmdc:mga08y16_55290_c1
484 nmdc:mga0n895_89999_c1
485 nmdc:mga0rr50_402_c1
486 nmdc:mga08x19_16_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02666

PS_Dcarbxylase

Phosphatidylserine decarboxylase

74

239

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cnz-assembly2.cif.gz_G crystal structure of 10pe bound psd from e. coli (2.70 a) 0.8602 39 170
2rqx-assembly1.cif.gz_A solution nmr structure of pmrd from klebsiella pneumoniae 0.6283 95 157
5a65-assembly2.cif.gz_B crystal structure of mouse thiamine triphosphatase in complex with thiamine diphosphate, orthophosphate and magnesium ions. 0.6172 121 178
2xgn-assembly2.cif.gz_B structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway 0.5794 114 176
7cnz-assembly2.cif.gz_G crystal structure of 10pe bound psd from e. coli (2.70 a) 0.5704 39 170
ID Description Score Start End Superfamily
af_P9WHQ5_55_228_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9462 35 198 2.70.70.10
af_P0A8K1_63_285_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8925 39 199 2.70.70.10
af_P9WHQ5_55_228_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8875 35 198 2.70.70.10
af_I1KUF4_411_621_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8867 39 199 2.70.70.10
af_Q58227_16_200_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8821 36 198 2.70.70.10
ID Description Score Start End GO Terms
AF-A0A2W0BGL2-F1-model_v4 Phosphatidylserine decarboxylase family protein 0.9901 81 201 GO:0004609
GO:0005886
GO:0008654
AF-A0A7W0GRY5-F1-model_v4 Phosphatidylserine decarboxylase 0.9888 80 201 GO:0004609
GO:0005886
GO:0008654
AF-A0A0B6WUT5-F1-model_v4 Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] 0.988 3 201 GO:0004609
GO:0005886
GO:0006646
AF-A0A357F416-F1-model_v4 Phosphatidylserine decarboxylase family protein 0.988 95 203 GO:0004609
GO:0005886
GO:0008654
AF-A0A7V9G9S8-F1-model_v4 Phosphatidylserine decarboxylase 0.9878 93 203 GO:0004609
GO:0005886
GO:0008654

Map