F354799

General Info

Members Datasets Scaffolds Average Seq Length
242 176 207 180

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100051300|Ga0307408_1000513003
Length 206
Sequence MLKSISLPLMLSVLFVENGVFCTSKFMIEKTAIEYREVISSCKALFEKKTRDYGTAWRILRLPSITDQIFIKAQRIRSIQEKGTQKVGDPVRDEFIGIINYCIIAMVQMQLSGSDKMDLAFEDIEGLYDKAVNETSELLQNKNHDYGEAWRDMRVTSITDIILMKLLRVKQIEDNEGQTLVSEGVKANYQDMINYSVFALIKLKDL

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
3 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
4 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
5 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
6 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
7 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
8 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
9 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
10 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
11 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
12 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
13 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
14 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
15 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
16 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
17 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
18 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
19 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
20 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
21 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
22 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
23 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
24 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
25 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
26 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
27 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
28 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
29 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
30 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
31 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
32 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
33 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
36 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
51 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
52 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
75 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
76 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
112 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
113 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
114 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
115 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
116 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
117 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
118 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
119 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
134 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
135 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
141 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
142 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
143 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
144 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
145 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
146 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
147 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
148 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
149 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
150 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
151 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
152 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
153 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
154 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
158 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
159 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
160 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
161 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
162 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
163 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
164 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
165 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
166 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
167 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
168 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
171 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
172 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
173 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
174 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
175 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
176 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.12
Metatranscriptomes 0
Isolates 14.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.16
Nodule 2.07
Rhizoplane 1.65
Rhizosphere 63.64
Stem 0
Stem Tuber 0
Unclassified 21.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10001789 3300003316 Bacteria 33903
2 rootH1_10001789 3300003323 Bacteria 4140
3 rootH1_10145387 3300003316 Bacteria 5377
4 rootH2_10000767 3300003320 Bacteria 103925
5 rootH2_10094531 3300003320 Bacteria 2398
6 rootH2_10280569 3300003320 Bacteria 2369
7 rootL2_10013475 3300003322 Bacteria 5536
8 rootL2_10013925 3300003322 Bacteria 12595
9 rootL2_10018962 3300003322 Bacteria 2865
10 rootL2_10111323 3300003322 Bacteria 11409
11 rootL2_10190836 3300003322 Bacteria 3575
12 rootL2_10291255 3300003322 Bacteria 1044
13 rootH1_10000207 3300003323 Bacteria 45314
14 rootH1_10054743 3300003323 Bacteria 14007
15 rootH1_10054744 3300003323 Bacteria 6340
16 rootH1_10062063 3300003323 Bacteria 9053
17 rootH1_10072960 3300003323 Bacteria 2220
18 Ga0055531_10000018 3300003794 Bacteria 175214
19 Ga0065165_1001251 3300005262 Bacteria 28797
20 Ga0065165_1109594 3300005262 Bacteria 681
21 Ga0065714_10013046 3300005288 Bacteria 1908
22 Ga0065714_10071907 3300005288 Bacteria 3470
23 Ga0065714_10141641 3300005288 Bacteria 1164
24 Ga0065715_10091710 3300005293 Bacteria 5593
25 Ga0065715_10163889 3300005293 Bacteria 1604
26 Ga0065715_10227967 3300005293 Bacteria 1245
27 Ga0065715_10259215 3300005293 Bacteria 1143
28 Ga0065715_10488182 3300005293 Bacteria 791
29 Ga0070690_100230916 3300005330 Bacteria 1301
30 Ga0070677_10294657 3300005333 Bacteria 822
31 Ga0070682_100108905 3300005337 Bacteria 1843
32 Ga0070682_100397041 3300005337 Bacteria 1042
33 Ga0070665_101059167 3300005548 Bacteria 823
34 Ga0068859_100082758 3300005617 Bacteria 3252
35 Ga0097621_100451598 3300006237 Bacteria 1158
36 Ga0068871_100617875 3300006358 Bacteria 987
37 Ga0068871_100806254 3300006358 Bacteria 866
38 Ga0075429_100369731 3300006880 Bacteria 1255
39 Ga0097620_100082758 3300006931 Bacteria 3252
40 Ga0099824_1001692 3300006942 Bacteria 31554
41 Ga0079104_1000355 3300006946 Bacteria 55363
42 Ga0099826_10000491 3300006948 Bacteria 19248
43 Ga0105244_10000035 3300009036 Bacteria 168428
44 Ga0105240_10206941 3300009093 Bacteria 2296
45 Ga0111539_10004374 3300009094 Bacteria 18490
46 Ga0111539_10034362 3300009094 Bacteria 6148
47 Ga0157373_10239586 3300013100 Bacteria 1282
48 Ga0157371_10008879 3300013102 Bacteria 7960
49 Ga0157370_10001219 3300013104 Bacteria 32226
50 Ga0157370_10003070 3300013104 Bacteria 19793
51 Ga0157370_10030088 3300013104 Bacteria 5322
52 Ga0157370_10053615 3300013104 Bacteria 3845
53 Ga0157370_10217449 3300013104 Bacteria 1770
54 Ga0157369_10004617 3300013105 Bacteria 16189
55 Ga0163162_10028500 3300013306 Bacteria 5526
56 Ga0157375_11378312 3300013308 Bacteria 830
57 Ga0157380_10024316 3300014326 Bacteria 4583
58 Ga0157380_10299466 3300014326 Bacteria 1481
59 Ga0157380_11589698 3300014326 Bacteria 709
60 Ga0182006_1004252 3300015261 Bacteria 7092
61 Ga0163161_10000007 3300017792 Bacteria 301614
62 Ga0163161_10016531 3300017792 Bacteria 5152
63 Ga0163161_10831553 3300017792 Bacteria 778
64 Ga0209050_1005212 3300025298 Bacteria 8309
65 Ga0209050_1068437 3300025298 Bacteria 804
66 Ga0209257_1000023 3300025304 Bacteria 753019
67 Ga0207655_1000008 3300025728 Bacteria 734289
68 Ga0207665_10093026 3300025939 Bacteria 2093
69 Ga0207667_10985220 3300025949 Bacteria 831
70 Ga0207641_10290703 3300026088 Bacteria 1540
71 Ga0207676_10891886 3300026095 Bacteria 872
72 Ga0207674_10836646 3300026116 Bacteria 888
73 Ga0207698_10789707 3300026142 Bacteria 951
74 Ga0207698_11191380 3300026142 Bacteria 775
75 Ga0209281_1000116 3300027111 Bacteria 209707
76 Ga0209489_109819 3300027361 Bacteria 11473
77 Ga0209968_1005342 3300027526 Bacteria 1932
78 Ga0209966_1028261 3300027695 Bacteria 1125
79 Ga0209974_10065835 3300027876 Bacteria 1231
80 Ga0207428_10249561 3300027907 Bacteria 1324
81 Ga0207428_10347311 3300027907 Bacteria 1092
82 Ga0268266_11280107 3300028379 Bacteria 708
83 Ga0265318_10011573 3300028577 Bacteria 3792
84 Ga0307515_10000009 3300028794 Bacteria 653206
85 Ga0307515_10501598 3300028794 Bacteria 824
86 Ga0265330_10258781 3300031235 Bacteria 733
87 Ga0265320_10090584 3300031240 Bacteria 1417
88 Ga0265331_10031684 3300031250 Bacteria 2626
89 Ga0265327_10130715 3300031251 Bacteria 1182
90 Ga0307513_10080027 3300031456 Bacteria 3372
91 Ga0307513_10273789 3300031456 Bacteria 1470
92 Ga0307509_10023163 3300031507 Bacteria 6983
93 Ga0307509_10037445 3300031507 Bacteria 5304
94 Ga0307408_100004300 3300031548 Bacteria 9666
95 Ga0307408_100012183 3300031548 Bacteria 5692
96 Ga0307408_100051300 3300031548 Bacteria 2971
97 Ga0307514_10120012 3300031649 Bacteria 1837
98 Ga0265314_10024189 3300031711 Bacteria 4609
99 Ga0307516_10312006 3300031730 Bacteria 1246
100 Ga0307405_10021662 3300031731 Bacteria 3617
101 Ga0307405_10090195 3300031731 Bacteria 2027
102 Ga0307413_10000153 3300031824 Bacteria 18700
103 Ga0307413_10873047 3300031824 Bacteria 762
104 Ga0307410_10000169 3300031852 Bacteria 23923
105 Ga0307406_10000038 3300031901 Bacteria 76386
106 Ga0307407_10003762 3300031903 Bacteria 6306
107 Ga0307412_10005509 3300031911 Bacteria 7109
108 Ga0307412_10070740 3300031911 Bacteria 2379
109 Ga0307409_100053393 3300031995 Bacteria 3105
110 Ga0307409_100068985 3300031995 Bacteria 2799
111 Ga0307409_100303238 3300031995 Bacteria 1487
112 Ga0307416_100001003 3300032002 Bacteria 14962
113 Ga0307416_100002120 3300032002 Bacteria 11208
114 Ga0307414_10000001 3300032004 Bacteria 1352954
115 Ga0307414_10000038 3300032004 Bacteria 150774
116 Ga0307414_10007868 3300032004 Bacteria 6011
117 Ga0307414_10074360 3300032004 Bacteria 2461
118 Ga0307414_10412392 3300032004 Bacteria 1176
119 Ga0307414_10599657 3300032004 Bacteria 987
120 Ga0307411_10000005 3300032005 Bacteria 391311
121 Ga0307411_10203257 3300032005 Bacteria 1523
122 Ga0307415_101307657 3300032126 Bacteria 687
123 Ga0307510_10095776 3300033180 Bacteria 2787
124 Ga0373931_0122282 3300035691 Bacteria 1489
125 Ga0373935_0029451 3300035692 Bacteria 3399
126 Ga0373927_0056329 3300035695 Bacteria 2541
127 Ga0373937_0674502 3300036401 Unclassified 980
128 Ga0395900_0174892 3300037418 Bacteria 2184
129 Ga0395898_0977106 3300037466 Bacteria 783
130 Ga0439447_001933 3300041407 Bacteria 7583
131 Ga0439466_0002927 3300041411 Bacteria 6675
132 Ga0439466_0046591 3300041411 Bacteria 1431
133 Ga0451789_0593288 3300041443 Bacteria 1014
134 Ga0451797_0485024 3300041453 Bacteria 691
135 Ga0451798_0194346 3300041458 Bacteria 1133
136 Ga0451804_0196619 3300041463 Bacteria 1217
137 Ga0451849_0615044 3300041505 Bacteria 899
138 Ga0451843_0514722 3300041509 Bacteria 1055
139 Ga0439445_0074885 3300042004 Bacteria 941
140 Ga0451577_0003863 3300042876 Bacteria 16270
141 Ga0451577_0066083 3300042876 Bacteria 3226
142 Ga0453683_0030979 3300044673 Bacteria 3379
143 Ga0453684_0001882 3300044712 Bacteria 54512
144 Ga0453684_0003905 3300044712 Bacteria 32755
145 Ga0453684_0510814 3300044712 Bacteria 1329
146 Ga0451576_0010901 3300045051 Bacteria 10391
147 Ga0451576_0027872 3300045051 Bacteria 6060
148 Ga0451576_0139302 3300045051 Bacteria 2531
149 Ga0451576_1166338 3300045051 Bacteria 805
150 Ga0495638_0000001 3300046460 Bacteria 1114121
151 Ga0495606_0023320 3300046507 Bacteria 4487
152 Ga0495618_0698599 3300046514 Bacteria 597
153 Ga0495632_0045661 3300046519 Unclassified 2181
154 Ga0495643_0003785 3300046522 Bacteria 10937
155 Ga0495654_0075812 3300046530 Bacteria 1586
156 Ga0495587_0496219 3300046536 Bacteria 675
157 Ga0495625_0010644 3300046660 Bacteria 7581
158 Ga0495674_0702206 3300047319 Bacteria 794
159 Ga0496116_0000041 3300048919 Bacteria 343299
160 Ga0496117_0040239 3300048920 Bacteria 3440
161 Ga0496118_0053141 3300048921 Bacteria 3083
162 Ga0496124_0062177 3300048927 Bacteria 3125
163 Ga0496125_0000026 3300048928 Bacteria 397380
164 Ga0496126_0048765 3300048929 Bacteria 3868
165 Ga0501069_0019281 3300049585 Bacteria 3687
166 Ga0501207_024797 3300049654 Bacteria 980
167 Ga0501222_013170 3300049662 Bacteria 1088
168 Ga0501236_000162 3300049670 Bacteria 6947
169 Ga0501246_007675 3300049676 Bacteria 944
170 Ga0501247_006418 3300049677 Unclassified 1331
171 Ga0501249_000004 3300049679 Bacteria 226777
172 Ga0501249_059855 3300049679 Bacteria 881
173 Ga0501253_066253 3300049683 Bacteria 789
174 Ga0501257_002398 3300049686 Bacteria 3948
175 Ga0501257_018922 3300049686 Bacteria 1609
176 Ga0501259_017133 3300049688 Bacteria 1253
177 Ga0501241_015841 3300049758 Bacteria 1372
178 Ga0501264_000196 3300049761 Bacteria 9755
179 Ga0501266_000007 3300049763 Bacteria 291751
180 Ga0501268_039477 3300049765 Bacteria 884
181 Ga0501269_019021 3300049766 Bacteria 853
182 Ga0501280_001008 3300049776 Bacteria 5836
183 Ga0501280_018895 3300049776 Bacteria 1012
184 nmdc:mga09592_443390_c1 3300050508 Bacteria 1120
185 nmdc:mga08y16_2913_c1 3300050511 Bacteria 17607
186 nmdc:mga08y16_59856_c1 3300050511 Bacteria 3978
187 Ga0500646_0008247 3300053090 Bacteria 2666
188 Ga0500646_0173637 3300053090 Bacteria 726
189 Ga0500651_0385276 3300053093 Bacteria 790
190 Ga0500641_0000006 3300053096 Bacteria 223991
191 Ga0500641_0000092 3300053096 Bacteria 34933
192 Ga0500641_0000156 3300053096 Bacteria 25459
193 Ga0500556_0018915 3300053104 Bacteria 2182
194 Ga0500557_066479 3300053105 Bacteria 1177
195 Ga0500562_031824 3300053108 Bacteria 1392
196 Ga0500614_173727 3300053123 Bacteria 657
197 Ga0500618_005768 3300053125 Bacteria 3723
198 Ga0500655_001530 3300053133 Bacteria 4378
199 Ga0500658_0000013 3300053134 Bacteria 153702
200 Ga0500559_0069686 3300053136 Bacteria 1581
201 Ga0500604_0000784 3300053151 Bacteria 8759
202 Ga0500616_0000009 3300053153 Bacteria 779095
203 Ga0500616_0048834 3300053153 Bacteria 2242
204 Ga0500622_0000048 3300053156 Bacteria 147112
205 Ga0500622_0000052 3300053156 Bacteria 145201
206 Ga0500627_0150018 3300053158 Bacteria 1053
207 Ga0500584_017909 3300053726 Bacteria 3277

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031649 Ga0307514_10120012 Ga0307514_101200123 158
2 3300014326 Ga0157380_10024316 Ga0157380_100243164 166
3 3300009094 Ga0111539_10034362 Ga0111539_100343623 167
4 3300014326 Ga0157380_10299466 Ga0157380_102994662 167
5 3300027907 Ga0207428_10249561 Ga0207428_102495611 167
6 3300050511 nmdc:mga08y16_2913_c1 nmdc:mga08y16_2913_c1_12909_13412 167
7 3300053090 Ga0500646_0173637 Ga0500646_0173637_199_705 168
8 3300032004 Ga0307414_10412392 Ga0307414_104123921 169
9 3300005333 Ga0070677_10294657 Ga0070677_102946571 171
10 iso_pu_bacteria 2833640130 2833640416 174
11 iso_pu_bacteria 2965320100 2965323409 174
12 iso_pu_bacteria 2513020052 2513233468 175
13 iso_pu_bacteria 2519899754 2520878761 175
14 iso_pu_bacteria 2738541279 2738731874 175
15 iso_pu_bacteria 2738541285 2738764439 175
16 iso_pu_bacteria 2738543007 2739213454 175
17 iso_pu_bacteria 2739367857 2740000723 175
18 iso_pu_bacteria 2739367858 2740005539 175
19 iso_pu_bacteria 2816332280 2817415734 175
20 iso_pu_bacteria 2857613821 2857614478 175
21 iso_pu_bacteria 2857618242 2857619148 175
22 iso_pu_bacteria 2903895155 2903898524 175
23 iso_pu_bacteria 2904419702 2904419764 175
24 iso_pu_bacteria 2904555929 2904556553 175
25 iso_pu_bacteria 2919191525 2919193045 175
26 iso_pu_bacteria 2958458903 2958463339 175
27 iso_pu_bacteria 8055592153 8055594118 175
28 iso_pu_bacteria 2643221600 2644011536 176
29 iso_pu_bacteria 2643221667 2644369933 176
30 iso_pu_bacteria 2643221716 2644642222 176
31 iso_pu_bacteria 2643221725 2644685323 176
32 iso_pu_bacteria 2802428842 2802654238 176
33 iso_pu_bacteria 2839989709 2839990368 176
34 iso_pu_bacteria 2881247448 2881248435 176
35 iso_pu_bacteria 2881359912 2881362547 176
36 iso_pu_bacteria 2929150217 2929152982 176
37 iso_pu_bacteria 2977268062 2977269646 176
38 iso_pu_bacteria 8054307821 8054308291 176
39 iso_pu_bacteria 8055419101 8055421411 176
40 iso_pu_bacteria 8056440228 8056441988 176
41 3300003322 rootL2_10018962 rootL2_100189624 177
42 3300049585 Ga0501069_0019281 Ga0501069_0019281_2840_3373 177
43 iso_pu_bacteria 2919509842 2919511659 177
44 iso_pu_bacteria 2919692658 2919696768 177
45 3300003320 rootH2_10280569 rootH2_102805691 178
46 3300003322 rootL2_10190836 rootL2_101908362 178
47 3300003322 rootL2_10291255 rootL2_102912552 178
48 3300003323 rootH1_10054743 rootH1_100547435 178
49 3300003794 Ga0055531_10000018 Ga0055531_1000001850 178
50 3300005617 Ga0068859_100082758 Ga0068859_1000827583 178
51 3300006358 Ga0068871_100617875 Ga0068871_1006178752 178
52 3300006931 Ga0097620_100082758 Ga0097620_1000827582 178
53 3300025304 Ga0209257_1000023 Ga0209257_1000023672 178
54 3300025939 Ga0207665_10093026 Ga0207665_100930263 178
55 3300027526 Ga0209968_1005342 Ga0209968_10053423 178
56 3300031251 Ga0265327_10130715 Ga0265327_101307152 178
57 3300031507 Ga0307509_10023163 Ga0307509_100231634 178
58 3300035691 Ga0373931_0122282 Ga0373931_0122282_433_969 178
59 3300035692 Ga0373935_0029451 Ga0373935_0029451_1796_2332 178
60 3300036401 Ga0373937_0674502 Ga0373937_0674502_140_676 178
61 3300042876 Ga0451577_0066083 Ga0451577_0066083_574_1110 178
62 3300044712 Ga0453684_0001882 Ga0453684_0001882_9843_10379 178
63 3300045051 Ga0451576_0010901 Ga0451576_0010901_7355_7891 178
64 3300046514 Ga0495618_0698599 Ga0495618_0698599_46_582 178
65 3300046519 Ga0495632_0045661 Ga0495632_0045661_1471_2007 178
66 3300046536 Ga0495587_0496219 Ga0495587_0496219_81_617 178
67 3300053123 Ga0500614_173727 Ga0500614_173727_21_584 178
68 3300053125 Ga0500618_005768 Ga0500618_005768_440_976 178
69 3300053153 Ga0500616_0048834 Ga0500616_0048834_1020_1556 178
70 iso_pu_bacteria 2919683626 2919687721 178
71 3300003322 rootL2_10013475 rootL2_100134757 179
72 3300003323 rootH1_10054744 rootH1_100547444 179
73 3300005262 Ga0065165_1109594 Ga0065165_11095941 179
74 3300005288 Ga0065714_10013046 Ga0065714_100130461 179
75 3300005288 Ga0065714_10141641 Ga0065714_101416412 179
76 3300005293 Ga0065715_10227967 Ga0065715_102279672 179
77 3300005293 Ga0065715_10259215 Ga0065715_102592152 179
78 3300006880 Ga0075429_100369731 Ga0075429_1003697312 179
79 3300006942 Ga0099824_1001692 Ga0099824_100169216 179
80 3300006946 Ga0079104_1000355 Ga0079104_100035516 179
81 3300006948 Ga0099826_10000491 Ga0099826_1000049115 179
82 3300009036 Ga0105244_10000035 Ga0105244_1000003523 179
83 3300009094 Ga0111539_10004374 Ga0111539_100043744 179
84 3300014326 Ga0157380_11589698 Ga0157380_115896982 179
85 3300017792 Ga0163161_10000007 Ga0163161_1000000796 179
86 3300025298 Ga0209050_1005212 Ga0209050_10052127 179
87 3300025298 Ga0209050_1068437 Ga0209050_10684372 179
88 3300025728 Ga0207655_1000008 Ga0207655_1000008149 179
89 3300027111 Ga0209281_1000116 Ga0209281_100011615 179
90 3300027361 Ga0209489_109819 Ga0209489_1098192 179
91 3300027695 Ga0209966_1028261 Ga0209966_10282612 179
92 3300027907 Ga0207428_10347311 Ga0207428_103473111 179
93 3300031548 Ga0307408_100004300 Ga0307408_10000430011 179
94 3300031731 Ga0307405_10090195 Ga0307405_100901951 179
95 3300031824 Ga0307413_10000153 Ga0307413_100001537 179
96 3300031824 Ga0307413_10873047 Ga0307413_108730472 179
97 3300031852 Ga0307410_10000169 Ga0307410_1000016920 179
98 3300031901 Ga0307406_10000038 Ga0307406_1000003817 179
99 3300031903 Ga0307407_10003762 Ga0307407_100037624 179
100 3300031911 Ga0307412_10070740 Ga0307412_100707402 179
101 3300031995 Ga0307409_100068985 Ga0307409_1000689854 179
102 3300032002 Ga0307416_100002120 Ga0307416_10000212012 179
103 3300032004 Ga0307414_10000001 Ga0307414_10000001711 179
104 3300032004 Ga0307414_10074360 Ga0307414_100743601 179
105 3300032005 Ga0307411_10000005 Ga0307411_100000056 179
106 3300032005 Ga0307411_10203257 Ga0307411_102032572 179
107 3300033180 Ga0307510_10095776 Ga0307510_100957763 179
108 3300041411 Ga0439466_0002927 Ga0439466_0002927_5181_5720 179
109 3300041411 Ga0439466_0046591 Ga0439466_0046591_851_1390 179
110 3300041458 Ga0451798_0194346 Ga0451798_0194346_330_869 179
111 3300041509 Ga0451843_0514722 Ga0451843_0514722_299_838 179
112 3300042004 Ga0439445_0074885 Ga0439445_0074885_390_929 179
113 3300046460 Ga0495638_0000001 Ga0495638_0000001_252464_253003 179
114 3300046530 Ga0495654_0075812 Ga0495654_0075812_490_1029 179
115 3300049677 Ga0501247_006418 Ga0501247_006418_224_763 179
116 3300049679 Ga0501249_000004 Ga0501249_000004_213178_213717 179
117 3300049679 Ga0501249_059855 Ga0501249_059855_298_837 179
118 3300049758 Ga0501241_015841 Ga0501241_015841_48_587 179
119 3300049763 Ga0501266_000007 Ga0501266_000007_240224_240763 179
120 3300049766 Ga0501269_019021 Ga0501269_019021_140_679 179
121 3300049776 Ga0501280_001008 Ga0501280_001008_2031_2570 179
122 3300050508 nmdc:mga09592_443390_c1 nmdc:mga09592_443390_c1_175_714 179
123 3300050511 nmdc:mga08y16_59856_c1 nmdc:mga08y16_59856_c1_355_894 179
124 3300053093 Ga0500651_0385276 Ga0500651_0385276_11_550 179
125 3300053096 Ga0500641_0000006 Ga0500641_0000006_195686_196225 179
126 3300053096 Ga0500641_0000156 Ga0500641_0000156_11035_11574 179
127 3300053105 Ga0500557_066479 Ga0500557_066479_57_596 179
128 3300053136 Ga0500559_0069686 Ga0500559_0069686_736_1275 179
129 3300053153 Ga0500616_0000009 Ga0500616_0000009_471708_472247 179
130 3300053726 Ga0500584_017909 Ga0500584_017909_523_1062 179
131 iso_pu_bacteria 2739367866 2740031827 179
132 iso_pu_bacteria 2910245624 2910249291 179
133 3300003320 rootH2_10000767 rootH2_1000076734 180
134 3300003320 rootH2_10094531 rootH2_100945312 180
135 3300003322 rootL2_10013925 rootL2_100139254 180
136 3300003323 rootH1_10000207 rootH1_1000020731 180
137 3300005288 Ga0065714_10071907 Ga0065714_100719072 180
138 3300005293 Ga0065715_10163889 Ga0065715_101638891 180
139 3300005293 Ga0065715_10488182 Ga0065715_104881821 180
140 3300005337 Ga0070682_100108905 Ga0070682_1001089052 180
141 3300005337 Ga0070682_100397041 Ga0070682_1003970412 180
142 3300013100 Ga0157373_10239586 Ga0157373_102395862 180
143 3300013102 Ga0157371_10008879 Ga0157371_100088799 180
144 3300013104 Ga0157370_10001219 Ga0157370_1000121925 180
145 3300013104 Ga0157370_10003070 Ga0157370_1000307014 180
146 3300013104 Ga0157370_10030088 Ga0157370_100300887 180
147 3300013105 Ga0157369_10004617 Ga0157369_1000461713 180
148 3300013306 Ga0163162_10028500 Ga0163162_100285005 180
149 3300013308 Ga0157375_11378312 Ga0157375_113783122 180
150 3300015261 Ga0182006_1004252 Ga0182006_10042525 180
151 3300017792 Ga0163161_10016531 Ga0163161_100165316 180
152 3300017792 Ga0163161_10831553 Ga0163161_108315532 180
153 3300026095 Ga0207676_10891886 Ga0207676_108918862 180
154 3300028577 Ga0265318_10011573 Ga0265318_100115732 180
155 3300028794 Ga0307515_10501598 Ga0307515_105015981 180
156 3300031235 Ga0265330_10258781 Ga0265330_102587811 180
157 3300031240 Ga0265320_10090584 Ga0265320_100905842 180
158 3300031250 Ga0265331_10031684 Ga0265331_100316842 180
159 3300031456 Ga0307513_10273789 Ga0307513_102737892 180
160 3300031548 Ga0307408_100051300 Ga0307408_1000513003 180
161 3300031711 Ga0265314_10024189 Ga0265314_100241896 180
162 3300031730 Ga0307516_10312006 Ga0307516_103120062 180
163 3300031731 Ga0307405_10021662 Ga0307405_100216624 180
164 3300031911 Ga0307412_10005509 Ga0307412_100055096 180
165 3300031995 Ga0307409_100053393 Ga0307409_1000533933 180
166 3300032002 Ga0307416_100001003 Ga0307416_10000100310 180
167 3300041407 Ga0439447_001933 Ga0439447_001933_2894_3436 180
168 3300041443 Ga0451789_0593288 Ga0451789_0593288_387_929 180
169 3300041453 Ga0451797_0485024 Ga0451797_0485024_134_676 180
170 3300041463 Ga0451804_0196619 Ga0451804_0196619_491_1033 180
171 3300046507 Ga0495606_0023320 Ga0495606_0023320_23_565 180
172 3300048919 Ga0496116_0000041 Ga0496116_0000041_24861_25403 180
173 3300048920 Ga0496117_0040239 Ga0496117_0040239_2398_2940 180
174 3300048921 Ga0496118_0053141 Ga0496118_0053141_1857_2399 180
175 3300048927 Ga0496124_0062177 Ga0496124_0062177_2569_3111 180
176 3300048928 Ga0496125_0000026 Ga0496125_0000026_23260_23802 180
177 3300048929 Ga0496126_0048765 Ga0496126_0048765_1495_2037 180
178 3300049765 Ga0501268_039477 Ga0501268_039477_21_614 180
179 3300049776 Ga0501280_018895 Ga0501280_018895_36_578 180
180 3300053090 Ga0500646_0008247 Ga0500646_0008247_228_770 180
181 3300053096 Ga0500641_0000092 Ga0500641_0000092_9949_10491 180
182 3300053134 Ga0500658_0000013 Ga0500658_0000013_121027_121569 180
183 3300009093 Ga0105240_10206941 Ga0105240_102069413 181
184 3300025949 Ga0207667_10985220 Ga0207667_109852202 181
185 3300026142 Ga0207698_10789707 Ga0207698_107897072 181
186 3300027876 Ga0209974_10065835 Ga0209974_100658352 181
187 3300032004 Ga0307414_10000038 Ga0307414_1000003842 181
188 3300042876 Ga0451577_0003863 Ga0451577_0003863_9754_10299 181
189 3300044673 Ga0453683_0030979 Ga0453683_0030979_2360_2962 181
190 3300044712 Ga0453684_0003905 Ga0453684_0003905_9759_10304 181
191 3300044712 Ga0453684_0510814 Ga0453684_0510814_46_648 181
192 3300045051 Ga0451576_0027872 Ga0451576_0027872_3944_4546 181
193 3300045051 Ga0451576_1166338 Ga0451576_1166338_195_740 181
194 3300053108 Ga0500562_031824 Ga0500562_031824_19_564 181
195 3300053151 Ga0500604_0000784 Ga0500604_0000784_392_937 181
196 3300053156 Ga0500622_0000048 Ga0500622_0000048_93472_94017 181
197 3300053156 Ga0500622_0000052 Ga0500622_0000052_93276_93821 181
198 3300053158 Ga0500627_0150018 Ga0500627_0150018_152_697 181
199 3300003316 rootH1_10145387 rootH1_101453872 182
200 3300005262 Ga0065165_1001251 Ga0065165_100125110 182
201 3300005293 Ga0065715_10091710 Ga0065715_100917105 182
202 3300005548 Ga0070665_101059167 Ga0070665_1010591672 182
203 3300013104 Ga0157370_10053615 Ga0157370_100536152 182
204 3300013104 Ga0157370_10217449 Ga0157370_102174492 182
205 3300026116 Ga0207674_10836646 Ga0207674_108366462 182
206 3300028379 Ga0268266_11280107 Ga0268266_112801071 182
207 3300031456 Ga0307513_10080027 Ga0307513_100800273 182
208 3300031548 Ga0307408_100012183 Ga0307408_1000121834 182
209 3300032004 Ga0307414_10007868 Ga0307414_100078684 182
210 3300032004 Ga0307414_10599657 Ga0307414_105996572 182
211 3300041505 Ga0451849_0615044 Ga0451849_0615044_310_885 182
212 3300045051 Ga0451576_0139302 Ga0451576_0139302_727_1275 182
213 3300046522 Ga0495643_0003785 Ga0495643_0003785_1299_1859 182
214 3300046660 Ga0495625_0010644 Ga0495625_0010644_5140_5700 182
215 3300049654 Ga0501207_024797 Ga0501207_024797_353_901 182
216 3300049662 Ga0501222_013170 Ga0501222_013170_309_857 182
217 3300049670 Ga0501236_000162 Ga0501236_000162_1863_2411 182
218 3300049676 Ga0501246_007675 Ga0501246_007675_148_696 182
219 3300049683 Ga0501253_066253 Ga0501253_066253_230_778 182
220 3300049686 Ga0501257_002398 Ga0501257_002398_2033_2581 182
221 3300049686 Ga0501257_018922 Ga0501257_018922_519_1067 182
222 3300049688 Ga0501259_017133 Ga0501259_017133_434_982 182
223 3300049761 Ga0501264_000196 Ga0501264_000196_4328_4876 182
224 3300053104 Ga0500556_0018915 Ga0500556_0018915_1276_1833 182
225 3300003316 rootH1_10001789 rootH1_100017896 183
226 3300003322 rootL2_10111323 rootL2_101113237 183
227 3300003323 rootH1_10062063 rootH1_100620634 183
228 3300003323 rootH1_10072960 rootH1_100729603 183
229 3300005330 Ga0070690_100230916 Ga0070690_1002309162 183
230 3300006237 Ga0097621_100451598 Ga0097621_1004515982 183
231 3300006358 Ga0068871_100806254 Ga0068871_1008062542 183
232 3300026088 Ga0207641_10290703 Ga0207641_102907032 183
233 3300026142 Ga0207698_11191380 Ga0207698_111913802 183
234 3300028794 Ga0307515_10000009 Ga0307515_10000009103 183
235 3300031507 Ga0307509_10037445 Ga0307509_100374453 183
236 3300031995 Ga0307409_100303238 Ga0307409_1003032382 183
237 3300032126 Ga0307415_101307657 Ga0307415_1013076571 183
238 3300035695 Ga0373927_0056329 Ga0373927_0056329_1763_2332 183
239 3300037418 Ga0395900_0174892 Ga0395900_0174892_1431_2000 183
240 3300037466 Ga0395898_0977106 Ga0395898_0977106_152_721 183
241 3300047319 Ga0495674_0702206 Ga0495674_0702206_142_693 183
242 3300053133 Ga0500655_001530 Ga0500655_001530_2702_3265 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07659

DUF1599

Nucleotide modification associated domain 1

142

203

0.99

PF07659

DUF1599

Nucleotide modification associated domain 1

49

109

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p06-assembly1.cif.gz_A-2 crystal structure of a predicted coding region af_0060 from archaeoglobus fulgidus dsm 4304 0.7233 93 180
2p06-assembly1.cif.gz_A-2 crystal structure of a predicted coding region af_0060 from archaeoglobus fulgidus dsm 4304 0.7165 93 180
4i1m-assembly1.cif.gz_A crystal structure of the legionella pneumophila gap domain of lepb 0.5732 110 183
1mi6-assembly1.cif.gz_A docking of the modified rf2 x-ray structure into the low resolution cryo-em map of rf2 e.coli 70s ribosome 0.512 36 176
5mdw-assembly1.cif.gz_7 structure of arfa(a18t) and rf2 bound to the 70s ribosome (pre-accommodated state) 0.4477 36 175
ID Description Score Start End Superfamily
af_P38857_10_102_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5063 107 177 1.10.287.70
af_Q8INZ7_26_134_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4975 107 176 1.10.10.1740
af_A4HRF6_3_96_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.482 102 176 1.10.10.1740
af_A3KQM5_149_239_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4792 103 178 1.20.1280.290
af_Q8VY63_30_115_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4753 105 181 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A2M9CUD4-F1-model_v4 Uncharacterized protein DUF1599 0.9807 2 177
AF-A0A7W1FY78-F1-model_v4 DUF1599 domain-containing protein 0.9788 4 124
AF-A0A7M1T6T8-F1-model_v4 DUF1599 domain-containing protein 0.9758 3 177
AF-I4AJ20-F1-model_v4 Nucleotide modification associated domain-containing protein 0.9756 1 177
AF-A0A355BPV3-F1-model_v4 Nucleotide modification associated domain-containing protein 0.9736 4 142

Feature Viewer

pLDDT pTM Quality
87.52 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map