F354794

General Info

Members Datasets Scaffolds Average Seq Length
242 185 484 278

Family's Representative Sequence

Representative Sequence 3300031507|Ga0307509_10049662|Ga0307509_100496626
Length 306
Sequence MSFGVPGRPSRHLTKGNPMEENPMDKTRSHPTAHIARRMFELLEPVCLVTFAADECNEELAALGHRTYWDGYFASRAAPLGRVPAQVVHAAFYNFADGEAARHIPSAWETIPPEASVAARQRGSAASLRRILGDELADSPGLVRAADLTTKAATSAPTEGRVMYAGMRTLEVPGDPVARLWHSATMLREHRGDGHIAALVGARIGGTEAHVLSALDMGIHPPESFGRIHHLPKEHLAAVMDGLRERGLVDSDGHFTDLGRATKQHVETLTDELAAPPYDALSPAELDELIAELEPITANLVATGSQ

Samples

Sample ID Description Type Environment
1 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
32 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
70 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
71 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
72 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
73 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
75 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
76 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
84 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
104 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
160 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
162 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
163 2643221647 Streptomyces sp. Root369 Isolate Unclassified
164 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
165 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
166 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
167 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
168 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
169 2867428634 Streptomyces sp. RP5T Isolate Unclassified
170 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
171 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
172 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
173 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
174 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
175 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
176 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
177 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
178 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
179 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
180 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
181 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
182 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
183 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
184 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
185 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.67
Metatranscriptomes 0.41
Isolates 9.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.44
Nodule 0
Rhizoplane 5.37
Rhizosphere 74.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307509_10049662 3300031507 Bacteria 4497
2 JGI24739J22299_10042258 3300001989 Bacteria 1513
3 JGI24737J22298_10009727 3300001990 Bacteria 3186
4 JGI24735J21928_10014760 3300002067 Bacteria 2444
5 JGI24738J21930_10006698 3300002075 Bacteria 2681
6 Ga0070683_100242724 3300005329 Bacteria 1713
7 Ga0068868_100251860 3300005338 Bacteria 1487
8 Ga0070668_100031793 3300005347 Bacteria 4016
9 Ga0070668_100243507 3300005347 Bacteria 1490
10 Ga0070667_100178162 3300005367 Bacteria 1879
11 Ga0070714_100228967 3300005435 Bacteria 1711
12 Ga0070714_100475984 3300005435 Bacteria 1189
13 Ga0070713_100134771 3300005436 Bacteria 2181
14 Ga0070711_100108606 3300005439 Bacteria 2033
15 Ga0070698_100003967 3300005471 Bacteria 16282
16 Ga0070698_100218397 3300005471 Bacteria 1840
17 Ga0070684_100440434 3300005535 Bacteria 1204
18 Ga0070665_100008607 3300005548 Bacteria 10324
19 Ga0068855_100178901 3300005563 Bacteria 2399
20 Ga0068856_100122883 3300005614 Bacteria 2598
21 Ga0068856_100163869 3300005614 Bacteria 2234
22 Ga0068863_100009493 3300005841 Bacteria 9489
23 Ga0068860_100000555 3300005843 Bacteria 45431
24 Ga0068860_100015957 3300005843 Bacteria 7332
25 Ga0081455_10212534 3300005937 Bacteria 1440
26 Ga0081455_10401689 3300005937 Bacteria 951
27 Ga0081539_10163207 3300005985 Bacteria 1060
28 Ga0070717_10015989 3300006028 Bacteria 5809
29 Ga0075365_10042087 3300006038 Bacteria 2985
30 Ga0075365_10085785 3300006038 Bacteria 2139
31 Ga0075365_10126590 3300006038 Bacteria 1765
32 Ga0075368_10033584 3300006042 Bacteria 1996
33 Ga0075363_100010505 3300006048 Bacteria 4402
34 Ga0070712_100055320 3300006175 Bacteria 2779
35 Ga0075367_10008765 3300006178 Bacteria 5256
36 Ga0075367_10018211 3300006178 Bacteria 3871
37 Ga0075370_10034749 3300006353 Bacteria 2826
38 Ga0105245_10120317 3300009098 Bacteria 2452
39 Ga0105238_10367316 3300009551 Bacteria 1429
40 Ga0105033_100709 3300009986 Bacteria 2580
41 Ga0105035_100542 3300009988 Bacteria 2321
42 Ga0105239_10528219 3300010375 Bacteria 1343
43 Ga0105246_10072156 3300011119 Bacteria 2433
44 Ga0157369_10138920 3300013105 Bacteria 2571
45 Ga0157372_10002683 3300013307 Bacteria 19253
46 Ga0157372_10627538 3300013307 Bacteria 1252
47 Ga0157375_10108367 3300013308 Bacteria 2872
48 Ga0157380_10393666 3300014326 Bacteria 1312
49 Ga0157379_10015477 3300014968 Bacteria 6694
50 Ga0157376_10650941 3300014969 Bacteria 1054
51 Ga0183367_1011 3300015688 Bacteria 397353
52 Ga0213875_10027056 3300021388 Bacteria 2728
53 Ga0213875_10123845 3300021388 Bacteria 1208
54 Ga0207426_1000547 3300025302 Bacteria 52775
55 Ga0207426_1000630 3300025302 Bacteria 44678
56 Ga0207692_10063852 3300025898 Bacteria 1915
57 Ga0207647_10002242 3300025904 Bacteria 14730
58 Ga0207685_10100653 3300025905 Bacteria 1235
59 Ga0207699_10245459 3300025906 Bacteria 1232
60 Ga0207693_10036861 3300025915 Bacteria 3856
61 Ga0207663_10079078 3300025916 Bacteria 2146
62 Ga0207646_10129137 3300025922 Bacteria 2274
63 Ga0207687_10302703 3300025927 Bacteria 1288
64 Ga0207700_10040625 3300025928 Bacteria 3396
65 Ga0207644_10005308 3300025931 Bacteria 8409
66 Ga0207661_10144946 3300025944 Bacteria 2048
67 Ga0207661_10532798 3300025944 Bacteria 1075
68 Ga0207667_10007029 3300025949 Bacteria 13598
69 Ga0207668_10017218 3300025972 Bacteria 4524
70 Ga0207668_10402005 3300025972 Bacteria 1158
71 Ga0207702_10435774 3300026078 Bacteria 1269
72 Ga0207641_10006749 3300026088 Bacteria 9617
73 Ga0207675_100420406 3300026118 Bacteria 1320
74 Ga0209813_10001448 3300027866 Bacteria 5352
75 Ga0268266_10030740 3300028379 Bacteria 4561
76 Ga0268264_10000264 3300028381 Bacteria 93499
77 Ga0268264_10020598 3300028381 Bacteria 5388
78 Ga0307512_10011731 3300030522 Bacteria 8284
79 Ga0307513_10039244 3300031456 Bacteria 5250
80 Ga0307513_10179420 3300031456 Bacteria 1983
81 Ga0307508_10112202 3300031616 Bacteria 2326
82 Ga0307413_10178319 3300031824 Bacteria 1512
83 Ga0307410_10240975 3300031852 Bacteria 1401
84 Ga0307409_100017559 3300031995 Bacteria 4775
85 Ga0307414_10078806 3300032004 Bacteria 2403
86 Ga0316214_1004333 3300033545 Bacteria 1826
87 Ga0316212_1001091 3300033547 Bacteria 3609
88 Ga0373951_0000052 3300035091 Bacteria 46256
89 Ga0373923_0137367 3300035111 Bacteria 1103
90 Ga0373956_0071174 3300035119 Bacteria 1587
91 Ga0373957_0011107 3300035120 Bacteria 2997
92 Ga0373943_0042718 3300035170 Bacteria 2198
93 Ga0373937_0049560 3300036401 Bacteria 3845
94 Ga0372808_020586 3300036459 Bacteria 948
95 Ga0373925_0106629 3300037068 Bacteria 2160
96 Ga0395898_0024651 3300037466 Bacteria 6068
97 Ga0436364_1502071 3300037853 Bacteria 21788
98 Ga0395901_0149004 3300038443 Bacteria 2459
99 Ga0439431_0010569 3300041997 Bacteria 2096
100 Ga0466969_0018677 3300044656 Bacteria 3610
101 Ga0466972_0005000 3300044658 Bacteria 6648
102 Ga0466972_0014527 3300044658 Bacteria 3943
103 Ga0466972_0025271 3300044658 Bacteria 2945
104 Ga0466972_0048552 3300044658 Bacteria 2050
105 Ga0466965_0008158 3300044683 Bacteria 4836
106 Ga0466965_0074901 3300044683 Bacteria 1706
107 Ga0466966_0003993 3300044684 Bacteria 9743
108 Ga0466966_0025001 3300044684 Bacteria 3903
109 Ga0466961_0000164 3300044693 Bacteria 45069
110 Ga0466961_0005931 3300044693 Bacteria 7743
111 Ga0466961_0020106 3300044693 Bacteria 4297
112 Ga0466961_0028370 3300044693 Bacteria 3599
113 Ga0466961_0057168 3300044693 Bacteria 2484
114 Ga0466961_0254188 3300044693 Bacteria 1079
115 Ga0466963_0026748 3300044694 Bacteria 3692
116 Ga0466963_0040453 3300044694 Bacteria 3055
117 Ga0466964_0017253 3300044706 Bacteria 2763
118 Ga0466971_0001716 3300044719 Bacteria 9284
119 Ga0466970_0006270 3300044765 Bacteria 5938
120 Ga0466970_0013204 3300044765 Bacteria 4233
121 Ga0466970_0162820 3300044765 Bacteria 1234
122 Ga0466957_0003698 3300044842 Bacteria 8447
123 Ga0466960_0014144 3300044901 Bacteria 3407
124 Ga0466960_0028427 3300044901 Bacteria 2558
125 Ga0466960_0055103 3300044901 Bacteria 1933
126 Ga0466959_0011062 3300045049 Bacteria 6475
127 Ga0466959_0122938 3300045049 Bacteria 1843
128 Ga0466958_0009315 3300045836 Bacteria 5470
129 Ga0466958_0095027 3300045836 Bacteria 1847
130 Ga0466958_0210377 3300045836 Bacteria 1239
131 Ga0466967_0069881 3300045976 Bacteria 3140
132 Ga0466967_0138455 3300045976 Bacteria 2265
133 Ga0495603_0082964 3300046455 Bacteria 1877
134 Ga0495629_0012069 3300046459 Bacteria 6263
135 Ga0495629_0028237 3300046459 Bacteria 3983
136 Ga0495638_0059221 3300046460 Bacteria 2372
137 Ga0495651_0035359 3300046462 Bacteria 3890
138 Ga0495651_0063528 3300046462 Bacteria 2822
139 Ga0495653_0121951 3300046463 Bacteria 1856
140 Ga0495650_0036975 3300046471 Bacteria 2130
141 Ga0495620_0058898 3300046515 Bacteria 1607
142 Ga0495628_0013159 3300046516 Bacteria 6964
143 Ga0495652_0232571 3300046529 Bacteria 1377
144 Ga0495640_0012689 3300046533 Bacteria 6432
145 Ga0495587_0305433 3300046536 Bacteria 889
146 Ga0495667_0098392 3300046559 Bacteria 1894
147 Ga0495657_0033891 3300046675 Bacteria 3551
148 Ga0495599_0078214 3300046678 Bacteria 2065
149 Ga0495613_0005022 3300046689 Bacteria 9935
150 Ga0495624_0321410 3300046690 Bacteria 932
151 Ga0495600_0102608 3300046809 Bacteria 1864
152 Ga0495604_0031313 3300047317 Bacteria 4219
153 Ga0495604_0039086 3300047317 Bacteria 3730
154 Ga0495676_0000537 3300047321 Bacteria 31037
155 Ga0495680_0016987 3300047322 Bacteria 6230
156 Ga0496102_0000015 3300048905 Bacteria 304524
157 Ga0496103_0000020 3300048906 Bacteria 234050
158 Ga0496104_0048708 3300048907 Bacteria 3995
159 Ga0496105_0037087 3300048908 Bacteria 4016
160 Ga0496105_0152356 3300048908 Bacteria 1900
161 Ga0496108_0000234 3300048911 Bacteria 49801
162 Ga0496108_0072675 3300048911 Bacteria 2904
163 Ga0496108_0238590 3300048911 Bacteria 1581
164 Ga0496109_0261990 3300048912 Bacteria 1628
165 Ga0496111_0058293 3300048914 Bacteria 2796
166 Ga0496111_0229423 3300048914 Bacteria 1379
167 Ga0496114_0004597 3300048917 Bacteria 10719
168 Ga0496114_0104216 3300048917 Bacteria 2425
169 Ga0496116_0000139 3300048919 Bacteria 151501
170 Ga0496117_0000047 3300048920 Bacteria 299632
171 Ga0496118_0000548 3300048921 Bacteria 61825
172 Ga0496119_0007062 3300048922 Bacteria 10216
173 Ga0496120_0002103 3300048923 Bacteria 21313
174 Ga0496121_0178565 3300048924 Bacteria 1535
175 Ga0496124_0041337 3300048927 Bacteria 3979
176 Ga0496125_0010003 3300048928 Bacteria 9639
177 Ga0496126_0000049 3300048929 Bacteria 317568
178 Ga0501032_0056992 3300049569 Bacteria 2625
179 Ga0501032_0118069 3300049569 Bacteria 1754
180 Ga0501033_0254983 3300049570 Bacteria 1242
181 Ga0501033_0263436 3300049570 Bacteria 1219
182 Ga0501033_0347185 3300049570 Bacteria 1040
183 Ga0501034_0119961 3300049571 Bacteria 2616
184 Ga0501036_0032361 3300049572 Bacteria 4418
185 Ga0501037_0014503 3300049573 Bacteria 5797
186 Ga0501037_0223343 3300049573 Bacteria 1324
187 Ga0501037_0280143 3300049573 Bacteria 1162
188 Ga0501038_0094974 3300049574 Bacteria 2491
189 Ga0501038_0175449 3300049574 Bacteria 1732
190 Ga0501039_0108583 3300049575 Bacteria 2169
191 Ga0501039_0268018 3300049575 Bacteria 1342
192 Ga0501043_0015474 3300049579 Bacteria 5975
193 Ga0501046_0061909 3300049580 Bacteria 2924
194 Ga0501047_0013024 3300049581 Bacteria 7877
195 Ga0501047_0311524 3300049581 Bacteria 1414
196 Ga0501047_0662885 3300049581 Bacteria 862
197 Ga0501048_0092885 3300049582 Bacteria 2128
198 Ga0501067_0039573 3300049583 Bacteria 2618
199 Ga0501068_0085802 3300049584 Bacteria 1938
200 Ga0501070_0392389 3300049586 Bacteria 1123
201 Ga0501071_0048235 3300049587 Bacteria 3062
202 Ga0501035_0039216 3300049822 Bacteria 4287
203 Ga0501035_0067378 3300049822 Bacteria 3176
204 Ga0501035_0094123 3300049822 Bacteria 2635
205 Ga0501044_0048178 3300049823 Bacteria 4403
206 Ga0501044_0660670 3300049823 Bacteria 933
207 nmdc:mga03n38_239156_c1 3300050490 Bacteria 955
208 nmdc:mga00v17_66725_c1 3300050491 Bacteria 2222
209 nmdc:mga0yw44_72045_c1 3300050492 Bacteria 2147
210 nmdc:mga06z11_1875_c1 3300050494 Bacteria 7923
211 nmdc:mga04h51_1538_c1 3300050495 Bacteria 5352
212 nmdc:mga07m45_132490_c1 3300050496 Bacteria 1442
213 nmdc:mga07m45_19165_c1 3300050496 Bacteria 3704
214 nmdc:mga08x19_51187_c1 3300050514 Bacteria 2652
215 Ga0495655_0035234 3300053083 Bacteria 1244
216 Ga0466962_0002911 3300061719 Bacteria 8160
217 Ga0466962_0029754 3300061719 Bacteria 2615
218 Ga0530510_0291559 3300061734 Bacteria 1220
219 2585302945 2582581313 Bacteria 10042643
220 2644267272 2643221647 Bacteria 10741251
221 2786666718 2786546132 Bacteria 10419719
222 2795792974 2795385472 Bacteria 6627535
223 2808916943 2808606375 Bacteria 9466072
224 2809593126 2808606522 Bacteria 9488490
225 2862186025 2862178590 Bacteria 8583590
226 2867429659 2867428634 Bacteria 9590268
227 2870787583 2870782633 Bacteria 9624083
228 2877684858 2877676314 Bacteria 9512378
229 2891329219 2891326441 Bacteria 6439512
230 2915365136 2915358134 Bacteria 6050864
231 2917737124 2917736166 Bacteria 9690793
232 2946072523 2946072368 Bacteria 8999607
233 2954681800 2954673503 Bacteria 9685905
234 2954691124 2954682443 Bacteria 9862841
235 2954700812 2954691527 Bacteria 10720516
236 2954706535 2954701450 Bacteria 10834262
237 2954712152 2954711539 Bacteria 10867210
238 2954722097 2954721474 Bacteria 10456478
239 2954739754 2954731030 Bacteria 10243860
240 2954740990 2954740390 Bacteria 10229294
241 2954758577 2954749733 Bacteria 10366972
242 2954759997 2954759201 Bacteria 9358192
243 Ga0307509_10049662
244 JGI24739J22299_10042258
245 JGI24737J22298_10009727
246 JGI24735J21928_10014760
247 JGI24738J21930_10006698
248 Ga0070683_100242724
249 Ga0068868_100251860
250 Ga0070668_100031793
251 Ga0070668_100243507
252 Ga0070667_100178162
253 Ga0070714_100228967
254 Ga0070714_100475984
255 Ga0070713_100134771
256 Ga0070711_100108606
257 Ga0070698_100003967
258 Ga0070698_100218397
259 Ga0070684_100440434
260 Ga0070665_100008607
261 Ga0068855_100178901
262 Ga0068856_100122883
263 Ga0068856_100163869
264 Ga0068863_100009493
265 Ga0068860_100000555
266 Ga0068860_100015957
267 Ga0081455_10212534
268 Ga0081455_10401689
269 Ga0081539_10163207
270 Ga0070717_10015989
271 Ga0075365_10042087
272 Ga0075365_10085785
273 Ga0075365_10126590
274 Ga0075368_10033584
275 Ga0075363_100010505
276 Ga0070712_100055320
277 Ga0075367_10008765
278 Ga0075367_10018211
279 Ga0075370_10034749
280 Ga0105245_10120317
281 Ga0105238_10367316
282 Ga0105033_100709
283 Ga0105035_100542
284 Ga0105239_10528219
285 Ga0105246_10072156
286 Ga0157369_10138920
287 Ga0157372_10002683
288 Ga0157372_10627538
289 Ga0157375_10108367
290 Ga0157380_10393666
291 Ga0157379_10015477
292 Ga0157376_10650941
293 Ga0183367_1011
294 Ga0213875_10027056
295 Ga0213875_10123845
296 Ga0207426_1000547
297 Ga0207426_1000630
298 Ga0207692_10063852
299 Ga0207647_10002242
300 Ga0207685_10100653
301 Ga0207699_10245459
302 Ga0207693_10036861
303 Ga0207663_10079078
304 Ga0207646_10129137
305 Ga0207687_10302703
306 Ga0207700_10040625
307 Ga0207644_10005308
308 Ga0207661_10144946
309 Ga0207661_10532798
310 Ga0207667_10007029
311 Ga0207668_10017218
312 Ga0207668_10402005
313 Ga0207702_10435774
314 Ga0207641_10006749
315 Ga0207675_100420406
316 Ga0209813_10001448
317 Ga0268266_10030740
318 Ga0268264_10000264
319 Ga0268264_10020598
320 Ga0307512_10011731
321 Ga0307513_10039244
322 Ga0307513_10179420
323 Ga0307508_10112202
324 Ga0307413_10178319
325 Ga0307410_10240975
326 Ga0307409_100017559
327 Ga0307414_10078806
328 Ga0316214_1004333
329 Ga0316212_1001091
330 Ga0373951_0000052
331 Ga0373923_0137367
332 Ga0373956_0071174
333 Ga0373957_0011107
334 Ga0373943_0042718
335 Ga0373937_0049560
336 Ga0372808_020586
337 Ga0373925_0106629
338 Ga0395898_0024651
339 Ga0436364_1502071
340 Ga0395901_0149004
341 Ga0439431_0010569
342 Ga0466969_0018677
343 Ga0466972_0005000
344 Ga0466972_0014527
345 Ga0466972_0025271
346 Ga0466972_0048552
347 Ga0466965_0008158
348 Ga0466965_0074901
349 Ga0466966_0003993
350 Ga0466966_0025001
351 Ga0466961_0000164
352 Ga0466961_0005931
353 Ga0466961_0020106
354 Ga0466961_0028370
355 Ga0466961_0057168
356 Ga0466961_0254188
357 Ga0466963_0026748
358 Ga0466963_0040453
359 Ga0466964_0017253
360 Ga0466971_0001716
361 Ga0466970_0006270
362 Ga0466970_0013204
363 Ga0466970_0162820
364 Ga0466957_0003698
365 Ga0466960_0014144
366 Ga0466960_0028427
367 Ga0466960_0055103
368 Ga0466959_0011062
369 Ga0466959_0122938
370 Ga0466958_0009315
371 Ga0466958_0095027
372 Ga0466958_0210377
373 Ga0466967_0069881
374 Ga0466967_0138455
375 Ga0495603_0082964
376 Ga0495629_0012069
377 Ga0495629_0028237
378 Ga0495638_0059221
379 Ga0495651_0035359
380 Ga0495651_0063528
381 Ga0495653_0121951
382 Ga0495650_0036975
383 Ga0495620_0058898
384 Ga0495628_0013159
385 Ga0495652_0232571
386 Ga0495640_0012689
387 Ga0495587_0305433
388 Ga0495667_0098392
389 Ga0495657_0033891
390 Ga0495599_0078214
391 Ga0495613_0005022
392 Ga0495624_0321410
393 Ga0495600_0102608
394 Ga0495604_0031313
395 Ga0495604_0039086
396 Ga0495676_0000537
397 Ga0495680_0016987
398 Ga0496102_0000015
399 Ga0496103_0000020
400 Ga0496104_0048708
401 Ga0496105_0037087
402 Ga0496105_0152356
403 Ga0496108_0000234
404 Ga0496108_0072675
405 Ga0496108_0238590
406 Ga0496109_0261990
407 Ga0496111_0058293
408 Ga0496111_0229423
409 Ga0496114_0004597
410 Ga0496114_0104216
411 Ga0496116_0000139
412 Ga0496117_0000047
413 Ga0496118_0000548
414 Ga0496119_0007062
415 Ga0496120_0002103
416 Ga0496121_0178565
417 Ga0496124_0041337
418 Ga0496125_0010003
419 Ga0496126_0000049
420 Ga0501032_0056992
421 Ga0501032_0118069
422 Ga0501033_0254983
423 Ga0501033_0263436
424 Ga0501033_0347185
425 Ga0501034_0119961
426 Ga0501036_0032361
427 Ga0501037_0014503
428 Ga0501037_0223343
429 Ga0501037_0280143
430 Ga0501038_0094974
431 Ga0501038_0175449
432 Ga0501039_0108583
433 Ga0501039_0268018
434 Ga0501043_0015474
435 Ga0501046_0061909
436 Ga0501047_0013024
437 Ga0501047_0311524
438 Ga0501047_0662885
439 Ga0501048_0092885
440 Ga0501067_0039573
441 Ga0501068_0085802
442 Ga0501070_0392389
443 Ga0501071_0048235
444 Ga0501035_0039216
445 Ga0501035_0067378
446 Ga0501035_0094123
447 Ga0501044_0048178
448 Ga0501044_0660670
449 nmdc:mga03n38_239156_c1
450 nmdc:mga00v17_66725_c1
451 nmdc:mga0yw44_72045_c1
452 nmdc:mga06z11_1875_c1
453 nmdc:mga04h51_1538_c1
454 nmdc:mga07m45_132490_c1
455 nmdc:mga07m45_19165_c1
456 nmdc:mga08x19_51187_c1
457 Ga0495655_0035234
458 Ga0466962_0002911
459 Ga0466962_0029754
460 Ga0530510_0291559
461 2585302945
462 2644267272
463 2786666718
464 2795792974
465 2808916943
466 2809593126
467 2862186025
468 2867429659
469 2870787583
470 2877684858
471 2891329219
472 2915365136
473 2917737124
474 2946072523
475 2954681800
476 2954691124
477 2954700812
478 2954706535
479 2954712152
480 2954722097
481 2954739754
482 2954740990
483 2954758577
484 2954759997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21863

HTH_67

Helix-turn-helix family

36

306

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hso-assembly1.cif.gz_D crystal structure of mycobacterium tuberculosis marr family protein rv2887 complex with dna 0.6545 162 271
5hso-assembly1.cif.gz_C crystal structure of mycobacterium tuberculosis marr family protein rv2887 complex with dna 0.6544 162 271
3ech-assembly1.cif.gz_A the marr-family repressor mexr in complex with its antirepressor armr 0.6475 147 283
3ech-assembly1.cif.gz_A the marr-family repressor mexr in complex with its antirepressor armr 0.6435 147 283
5hso-assembly1.cif.gz_D crystal structure of mycobacterium tuberculosis marr family protein rv2887 complex with dna 0.6009 162 271
ID Description Score Start End Superfamily
3echA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6578 162 283 1.10.10.10
3echA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6318 162 283 1.10.10.10
4ejvA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.5905 150 282 1.10.10.10
4ejvA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.5819 150 282 1.10.10.10
3s2wG00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.5696 162 271 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A511DJ85-F1-model_v4 MarR family transcriptional regulator 0.9887 16 283
AF-A0A640SJU6-F1-model_v4 MarR family transcriptional regulator 0.9869 10 283
AF-A0A3Q9C7W7-F1-model_v4 MarR family transcriptional regulator 0.9857 16 283
AF-A0A511DJ85-F1-model_v4 MarR family transcriptional regulator 0.9851 16 283
AF-A0A1H8KCC6-F1-model_v4 VOC domain-containing protein 0.9843 12 283 GO:0004493
GO:0046491

Map