F354554

General Info

Members Datasets Scaffolds Average Seq Length
242 157 484 285

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100022209|Ga0075428_1000222096
Length 335
Sequence MSVLDGPRRELRRVLVGGRPHQVVVDGDQLVLDDGRRLPEAEAVHLPPVDPGTIVCVHLNYGSRAVELGRDMAGEHPTYFLKPRTTVNAHRGELVRPADCQLLNYEGEVAAVVGRPMRGVAADDVWDHLAGFCAANDAGIHDFRDTDAGSMLRVKGQDGFCPLGPGLVSGVDIRRSALRTLVNGTIVQEAKVEEMTWGIDELLADITRHVTLLPGDVVLTGTPWHSRPVFPGDTVEIEVDGIGRLTNRVVTAPAPADGRGFPASVSKTSLAVALGSDYRRLKAQGITPSAQAYRSRRDQLVAANMTAGPPTAPGQPQPTVARDAASLSTELDQPS

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
60 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
82 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
86 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
94 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
95 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
96 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
97 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
147 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
148 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
149 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
150 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
151 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
153 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.13
Nodule 0
Rhizoplane 1.24
Rhizosphere 92.56
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100022209 3300006844 Bacteria 7025
2 JGI24752J21851_1012559 3300001976 Bacteria 1108
3 JGI25153J46596_10000010 3300003215 Bacteria 337769
4 Ga0070691_10118083 3300005341 Bacteria 1333
5 Ga0070661_100000046 3300005344 Bacteria 92262
6 Ga0070668_100320635 3300005347 Bacteria 1304
7 Ga0070710_10092049 3300005437 Bacteria 1790
8 Ga0070711_100091366 3300005439 Bacteria 2194
9 Ga0070700_100050478 3300005441 Bacteria 2586
10 Ga0070700_100282200 3300005441 Bacteria 1204
11 Ga0070694_100029994 3300005444 Bacteria 3554
12 Ga0070708_100055197 3300005445 Bacteria 3532
13 Ga0068867_100166134 3300005459 Bacteria 1744
14 Ga0070706_100004158 3300005467 Bacteria 14075
15 Ga0070707_100007452 3300005468 Bacteria 10160
16 Ga0070698_100001792 3300005471 Bacteria 23885
17 Ga0070698_100045406 3300005471 Bacteria 4497
18 Ga0070697_100046819 3300005536 Bacteria 3506
19 Ga0070672_100144644 3300005543 Bacteria 1964
20 Ga0070704_100048074 3300005549 Bacteria 2984
21 Ga0068857_100173285 3300005577 Bacteria 1962
22 Ga0068856_100361361 3300005614 Bacteria 1470
23 Ga0068852_100110725 3300005616 Bacteria 2496
24 Ga0068866_10056970 3300005718 Bacteria 2012
25 Ga0068862_100051731 3300005844 Bacteria 3513
26 Ga0068862_100186764 3300005844 Bacteria 1863
27 Ga0081455_10000887 3300005937 Bacteria 38694
28 Ga0081455_10005247 3300005937 Bacteria 14240
29 Ga0081455_10016707 3300005937 Bacteria 7069
30 Ga0081455_10073967 3300005937 Bacteria 2816
31 Ga0081538_10001297 3300005981 Bacteria 25909
32 Ga0081538_10057374 3300005981 Bacteria 2269
33 Ga0081539_10018087 3300005985 Bacteria 4908
34 Ga0081539_10072205 3300005985 Bacteria 1846
35 Ga0070717_10090760 3300006028 Bacteria 2579
36 Ga0075432_10001939 3300006058 Bacteria 6867
37 Ga0075428_100044696 3300006844 Bacteria 4867
38 Ga0075430_100050674 3300006846 Bacteria 3500
39 Ga0075430_100162829 3300006846 Bacteria 1857
40 Ga0075431_100036392 3300006847 Bacteria 5070
41 Ga0075434_100026602 3300006871 Bacteria 5669
42 Ga0075429_100010818 3300006880 Bacteria 7890
43 Ga0068865_100044498 3300006881 Bacteria 3039
44 Ga0075436_100031231 3300006914 Bacteria 3667
45 Ga0105240_10206536 3300009093 Bacteria 2298
46 Ga0111539_10273045 3300009094 Bacteria 1968
47 Ga0105245_10084518 3300009098 Bacteria 2908
48 Ga0105245_10137990 3300009098 Bacteria 2294
49 Ga0105245_10342877 3300009098 Bacteria 1478
50 Ga0114129_10044519 3300009147 Bacteria 6244
51 Ga0105243_10021817 3300009148 Bacteria 4862
52 Ga0105243_10068555 3300009148 Bacteria 2859
53 Ga0157370_10141912 3300013104 Bacteria 2238
54 Ga0157378_10003134 3300013297 Bacteria 14695
55 Ga0163162_10324976 3300013306 Bacteria 1671
56 Ga0157375_10818092 3300013308 Bacteria 1080
57 Ga0157377_10027157 3300014745 Bacteria 3071
58 Ga0157379_10367678 3300014968 Bacteria 1319
59 Ga0209257_1018645 3300025304 Bacteria 2655
60 Ga0207642_10136142 3300025899 Bacteria 1289
61 Ga0207647_10114613 3300025904 Bacteria 1592
62 Ga0207684_10006226 3300025910 Bacteria 10897
63 Ga0207649_10000072 3300025920 Bacteria 87103
64 Ga0207646_10003081 3300025922 Bacteria 19171
65 Ga0207704_10103568 3300025938 Bacteria 1904
66 Ga0207677_10411442 3300026023 Bacteria 1149
67 Ga0207648_10199269 3300026089 Bacteria 1776
68 Ga0207675_100007763 3300026118 Bacteria 10122
69 Ga0207698_10007037 3300026142 Bacteria 7043
70 Ga0207428_10010675 3300027907 Bacteria 8191
71 Ga0207428_10037274 3300027907 Bacteria 3957
72 Ga0268265_10346236 3300028380 Bacteria 1355
73 Ga0307517_10133586 3300028786 Bacteria 1775
74 Ga0265760_10050306 3300031090 Bacteria 1254
75 Ga0265325_10000060 3300031241 Bacteria 75733
76 Ga0265331_10000236 3300031250 Bacteria 66655
77 Ga0265327_10000007 3300031251 Bacteria 678515
78 Ga0265327_10000740 3300031251 Bacteria 50953
79 Ga0307509_10117032 3300031507 Bacteria 2653
80 Ga0307408_100030904 3300031548 Bacteria 3723
81 Ga0265313_10005080 3300031595 Bacteria 9803
82 Ga0307516_10000734 3300031730 Bacteria 44635
83 Ga0307516_10185572 3300031730 Bacteria 1810
84 Ga0307410_10009482 3300031852 Bacteria 5459
85 Ga0307406_10000008 3300031901 Bacteria 120233
86 Ga0307409_100000046 3300031995 Bacteria 43611
87 Ga0307416_100000121 3300032002 Bacteria 46909
88 Ga0307414_10056088 3300032004 Bacteria 2762
89 Ga0307411_10087206 3300032005 Unclassified 2167
90 Ga0307411_10774353 3300032005 Bacteria 843
91 Ga0307415_100005264 3300032126 Bacteria 6847
92 Ga0307415_100228883 3300032126 Bacteria 1496
93 Ga0373943_0061830 3300035170 Bacteria 1873
94 Ga0373925_0024679 3300037068 Bacteria 4390
95 Ga0395900_0004232 3300037418 Bacteria 15234
96 Ga0395900_0053917 3300037418 Bacteria 4139
97 Ga0395900_0764252 3300037418 Bacteria 896
98 Ga0395898_0149995 3300037466 Bacteria 2231
99 Ga0395905_0114634 3300037471 Bacteria 2532
100 Ga0395905_0228775 3300037471 Bacteria 1739
101 Ga0395905_0280632 3300037471 Bacteria 1552
102 Ga0395901_0069043 3300038443 Bacteria 3680
103 Ga0395901_0075086 3300038443 Bacteria 3526
104 Ga0439455_0052602 3300042012 Bacteria 1067
105 Ga0466965_0023569 3300044683 Bacteria 2972
106 Ga0466961_0029680 3300044693 Bacteria 3513
107 Ga0466963_0179930 3300044694 Bacteria 1476
108 Ga0466971_0015314 3300044719 Bacteria 3374
109 Ga0466968_0096079 3300044735 Bacteria 1319
110 Ga0466970_0034983 3300044765 Bacteria 2661
111 Ga0466957_0061527 3300044842 Bacteria 2305
112 Ga0466960_0005747 3300044901 Bacteria 4935
113 Ga0466959_0067798 3300045049 Bacteria 2586
114 Ga0495603_0110861 3300046455 Bacteria 1601
115 Ga0495629_0010092 3300046459 Bacteria 6890
116 Ga0495582_0000326 3300046473 Bacteria 26091
117 Ga0495584_0118155 3300046491 Bacteria 1343
118 Ga0495644_0048292 3300046523 Bacteria 1599
119 Ga0495665_0007940 3300046531 Bacteria 5754
120 Ga0495656_0095499 3300046615 Bacteria 1367
121 Ga0495658_0015487 3300046683 Bacteria 3912
122 Ga0495613_0000892 3300046689 Bacteria 22978
123 Ga0495581_0002879 3300047315 Bacteria 9834
124 Ga0495676_0010866 3300047321 Bacteria 8235
125 Ga0495680_0288302 3300047322 Unclassified 1155
126 Ga0496109_0035632 3300048912 Bacteria 4490
127 Ga0496114_0005894 3300048917 Bacteria 9630
128 Ga0496115_0637010 3300048918 Bacteria 844
129 Ga0496126_0001427 3300048929 Bacteria 37551
130 Ga0501031_0012254 3300049568 Bacteria 5588
131 Ga0501031_0027263 3300049568 Bacteria 3724
132 Ga0501032_0015967 3300049569 Bacteria 5286
133 Ga0501032_0024730 3300049569 Bacteria 4144
134 Ga0501032_0045496 3300049569 Bacteria 2968
135 Ga0501034_0241124 3300049571 Bacteria 1754
136 Ga0501036_0022894 3300049572 Bacteria 5260
137 Ga0501036_0029707 3300049572 Bacteria 4617
138 Ga0501036_0055516 3300049572 Unclassified 3356
139 Ga0501037_0024802 3300049573 Bacteria 4433
140 Ga0501037_0044784 3300049573 Bacteria 3249
141 Ga0501037_0098801 3300049573 Bacteria 2108
142 Ga0501038_0046452 3300049574 Bacteria 3765
143 Ga0501038_0111258 3300049574 Bacteria 2269
144 Ga0501038_0171135 3300049574 Bacteria 1758
145 Ga0501039_0014467 3300049575 Bacteria 6040
146 Ga0501039_0023734 3300049575 Bacteria 4707
147 Ga0501039_0039359 3300049575 Bacteria 3651
148 Ga0501040_0003026 3300049576 Bacteria 10897
149 Ga0501040_0005291 3300049576 Bacteria 8346
150 Ga0501040_0195539 3300049576 Bacteria 1435
151 Ga0501041_0006222 3300049577 Bacteria 6979
152 Ga0501042_0024358 3300049578 Bacteria 4244
153 Ga0501042_0045196 3300049578 Bacteria 3138
154 Ga0501043_0008098 3300049579 Bacteria 8294
155 Ga0501043_0032422 3300049579 Bacteria 4108
156 Ga0501043_0113142 3300049579 Bacteria 2131
157 Ga0501046_0039899 3300049580 Bacteria 3755
158 Ga0501046_0206809 3300049580 Bacteria 1458
159 Ga0501047_0001864 3300049581 Bacteria 20298
160 Ga0501047_0068539 3300049581 Bacteria 3417
161 Ga0501048_0001843 3300049582 Bacteria 16093
162 Ga0501048_0112762 3300049582 Bacteria 1920
163 Ga0501068_0005713 3300049584 Bacteria 6818
164 Ga0501068_0013243 3300049584 Bacteria 4690
165 Ga0501068_0308282 3300049584 Unclassified 1014
166 Ga0501069_0005998 3300049585 Bacteria 6339
167 Ga0501069_0066654 3300049585 Bacteria 2013
168 Ga0501070_0050616 3300049586 Unclassified 3448
169 Ga0501071_0002925 3300049587 Bacteria 10547
170 Ga0501071_0069878 3300049587 Bacteria 2558
171 Ga0501072_0000884 3300049588 Bacteria 21964
172 Ga0501072_0007753 3300049588 Bacteria 8153
173 Ga0501072_0313148 3300049588 Bacteria 1247
174 Ga0501073_0011724 3300049589 Bacteria 6399
175 Ga0501073_0012065 3300049589 Bacteria 6309
176 Ga0501073_0039282 3300049589 Bacteria 3353
177 Ga0501073_0276546 3300049589 Bacteria 1158
178 Ga0501074_0011003 3300049590 Bacteria 6568
179 Ga0501074_0046436 3300049590 Bacteria 3140
180 Ga0501074_0197099 3300049590 Bacteria 1435
181 Ga0501075_0006020 3300049591 Bacteria 8314
182 Ga0501075_0015087 3300049591 Bacteria 5543
183 Ga0501075_0034980 3300049591 Bacteria 3744
184 Ga0501076_0003379 3300049592 Bacteria 11206
185 Ga0501076_0008004 3300049592 Bacteria 7718
186 Ga0501076_0025667 3300049592 Bacteria 4562
187 Ga0501077_0005569 3300049593 Bacteria 7668
188 Ga0501077_0007279 3300049593 Bacteria 6827
189 Ga0501077_0020056 3300049593 Bacteria 4230
190 Ga0501077_0088011 3300049593 Bacteria 1968
191 Ga0501077_0365796 3300049593 Bacteria 921
192 Ga0501079_0001375 3300049741 Bacteria 17131
193 Ga0501079_0015311 3300049741 Bacteria 5850
194 Ga0501079_0330042 3300049741 Bacteria 1195
195 Ga0501080_0020759 3300049742 Bacteria 6082
196 Ga0501080_0040057 3300049742 Bacteria 4372
197 Ga0501080_0107077 3300049742 Bacteria 2591
198 Ga0501080_0215818 3300049742 Bacteria 1757
199 Ga0501081_0002926 3300049743 Bacteria 10831
200 Ga0501081_0002950 3300049743 Bacteria 10791
201 Ga0501083_0019543 3300049744 Bacteria 4718
202 Ga0501083_0024105 3300049744 Bacteria 4218
203 Ga0501083_0042663 3300049744 Bacteria 3074
204 Ga0501035_0015373 3300049822 Bacteria 7062
205 Ga0501035_0051357 3300049822 Bacteria 3692
206 Ga0501044_0005214 3300049823 Bacteria 14461
207 Ga0501044_0018018 3300049823 Bacteria 7572
208 Ga0501044_0074248 3300049823 Bacteria 3455
209 Ga0501044_0076843 3300049823 Bacteria 3388
210 Ga0501044_0079216 3300049823 Bacteria 3329
211 Ga0501044_0120754 3300049823 Bacteria 2622
212 Ga0501044_0165766 3300049823 Bacteria 2184
213 Ga0501045_0001464 3300049824 Bacteria 15701
214 Ga0501045_0019826 3300049824 Bacteria 4799
215 nmdc:mga05p37_260303_c1 3300050507 Bacteria 2076
216 nmdc:mga05p37_9531_c1 3300050507 Bacteria 11497
217 nmdc:mga09592_23975_c1 3300050508 Bacteria 5043
218 nmdc:mga0qj67_82803_c1 3300050509 Bacteria 2573
219 nmdc:mga06r32_25392_c1 3300050510 Bacteria 5513
220 nmdc:mga06r32_51527_c1 3300050510 Bacteria 3940
221 nmdc:mga08y16_50979_c1 3300050511 Bacteria 4330
222 nmdc:mga0n895_111342_c1 3300050512 Bacteria 2754
223 nmdc:mga0n895_14290_c1 3300050512 Bacteria 7204
224 nmdc:mga08x19_33263_c1 3300050514 Bacteria 3254
225 Ga0495619_0155031 3300053085 Bacteria 1580
226 Ga0500644_0044461 3300053088 Bacteria 1491
227 Ga0500641_0006667 3300053096 Bacteria 4101
228 Ga0500595_001125 3300053119 Bacteria 14818
229 Ga0500642_0002749 3300053130 Bacteria 5210
230 Ga0500588_0000152 3300053146 Bacteria 9172
231 Ga0500604_0003628 3300053151 Bacteria 4153
232 Ga0500616_0000399 3300053153 Bacteria 59548
233 Ga0500609_000529 3300053731 Bacteria 5731
234 Ga0501084_0000895 3300054114 Bacteria 23045
235 Ga0501084_0007495 3300054114 Bacteria 8996
236 Ga0501082_0003540 3300060353 Bacteria 13636
237 Ga0501082_0031882 3300060353 Bacteria 4545
238 Ga0501082_0231992 3300060353 Unclassified 1606
239 Ga0501082_0276044 3300060353 Bacteria 1463
240 Ga0501082_0314680 3300060353 Bacteria 1363
241 Ga0466962_0090697 3300061719 Bacteria 1464
242 Ga0530510_0002885 3300061734 Bacteria 11797
243 Ga0075428_100022209
244 JGI24752J21851_1012559
245 JGI25153J46596_10000010
246 Ga0070691_10118083
247 Ga0070661_100000046
248 Ga0070668_100320635
249 Ga0070710_10092049
250 Ga0070711_100091366
251 Ga0070700_100050478
252 Ga0070700_100282200
253 Ga0070694_100029994
254 Ga0070708_100055197
255 Ga0068867_100166134
256 Ga0070706_100004158
257 Ga0070707_100007452
258 Ga0070698_100001792
259 Ga0070698_100045406
260 Ga0070697_100046819
261 Ga0070672_100144644
262 Ga0070704_100048074
263 Ga0068857_100173285
264 Ga0068856_100361361
265 Ga0068852_100110725
266 Ga0068866_10056970
267 Ga0068862_100051731
268 Ga0068862_100186764
269 Ga0081455_10000887
270 Ga0081455_10005247
271 Ga0081455_10016707
272 Ga0081455_10073967
273 Ga0081538_10001297
274 Ga0081538_10057374
275 Ga0081539_10018087
276 Ga0081539_10072205
277 Ga0070717_10090760
278 Ga0075432_10001939
279 Ga0075428_100044696
280 Ga0075430_100050674
281 Ga0075430_100162829
282 Ga0075431_100036392
283 Ga0075434_100026602
284 Ga0075429_100010818
285 Ga0068865_100044498
286 Ga0075436_100031231
287 Ga0105240_10206536
288 Ga0111539_10273045
289 Ga0105245_10084518
290 Ga0105245_10137990
291 Ga0105245_10342877
292 Ga0114129_10044519
293 Ga0105243_10021817
294 Ga0105243_10068555
295 Ga0157370_10141912
296 Ga0157378_10003134
297 Ga0163162_10324976
298 Ga0157375_10818092
299 Ga0157377_10027157
300 Ga0157379_10367678
301 Ga0209257_1018645
302 Ga0207642_10136142
303 Ga0207647_10114613
304 Ga0207684_10006226
305 Ga0207649_10000072
306 Ga0207646_10003081
307 Ga0207704_10103568
308 Ga0207677_10411442
309 Ga0207648_10199269
310 Ga0207675_100007763
311 Ga0207698_10007037
312 Ga0207428_10010675
313 Ga0207428_10037274
314 Ga0268265_10346236
315 Ga0307517_10133586
316 Ga0265760_10050306
317 Ga0265325_10000060
318 Ga0265331_10000236
319 Ga0265327_10000007
320 Ga0265327_10000740
321 Ga0307509_10117032
322 Ga0307408_100030904
323 Ga0265313_10005080
324 Ga0307516_10000734
325 Ga0307516_10185572
326 Ga0307410_10009482
327 Ga0307406_10000008
328 Ga0307409_100000046
329 Ga0307416_100000121
330 Ga0307414_10056088
331 Ga0307411_10087206
332 Ga0307411_10774353
333 Ga0307415_100005264
334 Ga0307415_100228883
335 Ga0373943_0061830
336 Ga0373925_0024679
337 Ga0395900_0004232
338 Ga0395900_0053917
339 Ga0395900_0764252
340 Ga0395898_0149995
341 Ga0395905_0114634
342 Ga0395905_0228775
343 Ga0395905_0280632
344 Ga0395901_0069043
345 Ga0395901_0075086
346 Ga0439455_0052602
347 Ga0466965_0023569
348 Ga0466961_0029680
349 Ga0466963_0179930
350 Ga0466971_0015314
351 Ga0466968_0096079
352 Ga0466970_0034983
353 Ga0466957_0061527
354 Ga0466960_0005747
355 Ga0466959_0067798
356 Ga0495603_0110861
357 Ga0495629_0010092
358 Ga0495582_0000326
359 Ga0495584_0118155
360 Ga0495644_0048292
361 Ga0495665_0007940
362 Ga0495656_0095499
363 Ga0495658_0015487
364 Ga0495613_0000892
365 Ga0495581_0002879
366 Ga0495676_0010866
367 Ga0495680_0288302
368 Ga0496109_0035632
369 Ga0496114_0005894
370 Ga0496115_0637010
371 Ga0496126_0001427
372 Ga0501031_0012254
373 Ga0501031_0027263
374 Ga0501032_0015967
375 Ga0501032_0024730
376 Ga0501032_0045496
377 Ga0501034_0241124
378 Ga0501036_0022894
379 Ga0501036_0029707
380 Ga0501036_0055516
381 Ga0501037_0024802
382 Ga0501037_0044784
383 Ga0501037_0098801
384 Ga0501038_0046452
385 Ga0501038_0111258
386 Ga0501038_0171135
387 Ga0501039_0014467
388 Ga0501039_0023734
389 Ga0501039_0039359
390 Ga0501040_0003026
391 Ga0501040_0005291
392 Ga0501040_0195539
393 Ga0501041_0006222
394 Ga0501042_0024358
395 Ga0501042_0045196
396 Ga0501043_0008098
397 Ga0501043_0032422
398 Ga0501043_0113142
399 Ga0501046_0039899
400 Ga0501046_0206809
401 Ga0501047_0001864
402 Ga0501047_0068539
403 Ga0501048_0001843
404 Ga0501048_0112762
405 Ga0501068_0005713
406 Ga0501068_0013243
407 Ga0501068_0308282
408 Ga0501069_0005998
409 Ga0501069_0066654
410 Ga0501070_0050616
411 Ga0501071_0002925
412 Ga0501071_0069878
413 Ga0501072_0000884
414 Ga0501072_0007753
415 Ga0501072_0313148
416 Ga0501073_0011724
417 Ga0501073_0012065
418 Ga0501073_0039282
419 Ga0501073_0276546
420 Ga0501074_0011003
421 Ga0501074_0046436
422 Ga0501074_0197099
423 Ga0501075_0006020
424 Ga0501075_0015087
425 Ga0501075_0034980
426 Ga0501076_0003379
427 Ga0501076_0008004
428 Ga0501076_0025667
429 Ga0501077_0005569
430 Ga0501077_0007279
431 Ga0501077_0020056
432 Ga0501077_0088011
433 Ga0501077_0365796
434 Ga0501079_0001375
435 Ga0501079_0015311
436 Ga0501079_0330042
437 Ga0501080_0020759
438 Ga0501080_0040057
439 Ga0501080_0107077
440 Ga0501080_0215818
441 Ga0501081_0002926
442 Ga0501081_0002950
443 Ga0501083_0019543
444 Ga0501083_0024105
445 Ga0501083_0042663
446 Ga0501035_0015373
447 Ga0501035_0051357
448 Ga0501044_0005214
449 Ga0501044_0018018
450 Ga0501044_0074248
451 Ga0501044_0076843
452 Ga0501044_0079216
453 Ga0501044_0120754
454 Ga0501044_0165766
455 Ga0501045_0001464
456 Ga0501045_0019826
457 nmdc:mga05p37_260303_c1
458 nmdc:mga05p37_9531_c1
459 nmdc:mga09592_23975_c1
460 nmdc:mga0qj67_82803_c1
461 nmdc:mga06r32_25392_c1
462 nmdc:mga06r32_51527_c1
463 nmdc:mga08y16_50979_c1
464 nmdc:mga0n895_111342_c1
465 nmdc:mga0n895_14290_c1
466 nmdc:mga08x19_33263_c1
467 Ga0495619_0155031
468 Ga0500644_0044461
469 Ga0500641_0006667
470 Ga0500595_001125
471 Ga0500642_0002749
472 Ga0500588_0000152
473 Ga0500604_0003628
474 Ga0500616_0000399
475 Ga0500609_000529
476 Ga0501084_0000895
477 Ga0501084_0007495
478 Ga0501082_0003540
479 Ga0501082_0031882
480 Ga0501082_0231992
481 Ga0501082_0276044
482 Ga0501082_0314680
483 Ga0466962_0090697
484 Ga0530510_0002885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

53

250

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sbi-assembly2.cif.gz_C x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate 0.9465 43 239
6fog-assembly4.cif.gz_D x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. 0.931 45 240
6j5x-assembly1.cif.gz_B crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate 0.9299 1 240
4pfz-assembly1.cif.gz_B x-ray crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase from mycobacterium smegmatis 0.9129 1 241
1wzo-assembly1.cif.gz_A crystal structure of the hpce from thermus thermophilus hb8 0.9124 1 240
ID Description Score Start End Superfamily
af_A0A0R4IWE1_56_289_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9558 38 237 3.90.850.10
af_Q54BF3_56_305_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9512 28 236 3.90.850.10
af_A0A1D8PI10_75_291_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9469 45 237 3.90.850.10
af_P34673_5_211_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9436 43 233 3.90.850.10
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9411 43 240 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A7V1U634-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9862 51 275 GO:0016787
GO:0046872
AF-A0A3C1P1C5-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.9857 2 191 GO:0016853
GO:0046872
AF-A0A1M6K822-F1-model_v4 Fumarylacetoacetate (FAA) hydrolase family protein 0.9715 80 236 GO:0016787
GO:0044281
AF-A0A1I7ERK3-F1-model_v4 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (Catechol pathway) 0.9681 1 239 GO:0003824
GO:0044281
AF-A0A843G7L8-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9637 48 240 GO:0018773
GO:0046872

Map