F354062

General Info

Members Datasets Scaffolds Average Seq Length
241 164 482 132

Family's Representative Sequence

Representative Sequence 3300046663|Ga0495635_0171598|Ga0495635_0171598_875_1357
Length 160
Sequence MIVLDASALVELILSTPTGQLIAARIADPAEGLHAPHLADVEVVQALRRYVRERTINADAAAVALDDFRALDLQRHAHEPLLDRVWELRENLTAYDAVYVALAEVLDATMLTCDGPLSRAPGVAGRAILVQAKHSGRSIVSQRPSQTVHSGRERITACGT

Samples

Sample ID Description Type Environment
1 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
90 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
105 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
106 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
107 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
108 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
161 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.07
Nodule 0
Rhizoplane 5.39
Rhizosphere 89.21
Stem 0
Stem Tuber 0
Unclassified 26.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495635_0171598 3300046663 Bacteria 1475
2 Ga0065707_10241203 3300005295 Unclassified 1155
3 Ga0070683_101293097 3300005329 Unclassified 701
4 Ga0070670_100260594 3300005331 Bacteria 1511
5 Ga0070670_100769531 3300005331 Unclassified 868
6 Ga0070677_10104280 3300005333 Bacteria 1256
7 Ga0070677_10302936 3300005333 Unclassified 813
8 Ga0070682_100882438 3300005337 Unclassified 733
9 Ga0070668_100080312 3300005347 Bacteria 2555
10 Ga0070668_100892701 3300005347 Bacteria 794
11 Ga0070675_100216279 3300005354 Bacteria 1667
12 Ga0070675_100798977 3300005354 Bacteria 862
13 Ga0070671_101208505 3300005355 Bacteria 665
14 Ga0070671_101608884 3300005355 Unclassified 576
15 Ga0070674_100568821 3300005356 Bacteria 953
16 Ga0070674_101962980 3300005356 Unclassified 532
17 Ga0070673_100186800 3300005364 Bacteria 1777
18 Ga0070667_100636715 3300005367 Bacteria 984
19 Ga0070714_100082163 3300005435 Bacteria 2806
20 Ga0070714_101122869 3300005435 Unclassified 766
21 Ga0070714_101131262 3300005435 Bacteria 763
22 Ga0070713_100556693 3300005436 Bacteria 1086
23 Ga0070701_10634927 3300005438 Bacteria 711
24 Ga0070711_100144191 3300005439 Bacteria 1789
25 Ga0070700_101393379 3300005441 Unclassified 592
26 Ga0070694_100391863 3300005444 Bacteria 1085
27 Ga0070694_101267184 3300005444 Bacteria 619
28 Ga0070708_100855048 3300005445 Unclassified 854
29 Ga0070663_100102827 3300005455 Bacteria 2135
30 Ga0070678_100141853 3300005456 Bacteria 1923
31 Ga0070678_100566126 3300005456 Bacteria 1010
32 Ga0070662_100084352 3300005457 Bacteria 2373
33 Ga0070706_100026863 3300005467 Bacteria 5296
34 Ga0070706_100823419 3300005467 Bacteria 859
35 Ga0070707_101017614 3300005468 Unclassified 794
36 Ga0070698_100226390 3300005471 Unclassified 1803
37 Ga0070699_100000050 3300005518 Bacteria 117160
38 Ga0070699_100033610 3300005518 Bacteria 4430
39 Ga0070679_100313304 3300005530 Bacteria 1519
40 Ga0070684_101771424 3300005535 Bacteria 583
41 Ga0070697_100669952 3300005536 Bacteria 914
42 Ga0070697_101182663 3300005536 Bacteria 681
43 Ga0070665_100247366 3300005548 Bacteria 1783
44 Ga0070665_100437343 3300005548 Bacteria 1317
45 Ga0070704_100142967 3300005549 Bacteria 1871
46 Ga0070704_100857802 3300005549 Unclassified 814
47 Ga0070664_100334872 3300005564 Bacteria 1374
48 Ga0070664_101032135 3300005564 Bacteria 773
49 Ga0070664_101902154 3300005564 Unclassified 564
50 Ga0068852_101337202 3300005616 Unclassified 738
51 Ga0068859_100000213 3300005617 Bacteria 58017
52 Ga0068859_102059761 3300005617 Unclassified 630
53 Ga0068864_100167368 3300005618 Bacteria 2002
54 Ga0068864_101576730 3300005618 Unclassified 660
55 Ga0068861_101254054 3300005719 Bacteria 719
56 Ga0068861_102057478 3300005719 Unclassified 570
57 Ga0068858_100104654 3300005842 Bacteria 2641
58 Ga0068862_100298743 3300005844 Bacteria 1481
59 Ga0075432_10129584 3300006058 Unclassified 954
60 Ga0075366_10172307 3300006195 Unclassified 1313
61 Ga0075366_10247659 3300006195 Bacteria 1087
62 Ga0097621_100373275 3300006237 Bacteria 1273
63 Ga0075428_100056076 3300006844 Bacteria 4317
64 Ga0075428_100215994 3300006844 Bacteria 2072
65 Ga0075428_100801643 3300006844 Unclassified 1001
66 Ga0075431_100090967 3300006847 Bacteria 3149
67 Ga0075431_100140549 3300006847 Bacteria 2489
68 Ga0075431_100296116 3300006847 Bacteria 1635
69 Ga0075431_100922576 3300006847 Unclassified 842
70 Ga0075433_10021319 3300006852 Bacteria 5433
71 Ga0075429_100320765 3300006880 Bacteria 1356
72 Ga0075436_100072667 3300006914 Bacteria 2380
73 Ga0097620_100000213 3300006931 Bacteria 58017
74 Ga0097620_102059832 3300006931 Unclassified 630
75 Ga0075435_100482695 3300007076 Bacteria 1071
76 Ga0075435_100566610 3300007076 Bacteria 984
77 Ga0099794_10183526 3300007265 Bacteria 1068
78 Ga0099795_10119785 3300007788 Bacteria 1051
79 Ga0111539_10052612 3300009094 Bacteria 4848
80 Ga0111539_11294495 3300009094 Unclassified 846
81 Ga0105245_11295406 3300009098 Unclassified 778
82 Ga0114129_10003253 3300009147 Bacteria 22800
83 Ga0114129_10061376 3300009147 Bacteria 5253
84 Ga0114129_10975548 3300009147 Bacteria 1069
85 Ga0105248_10005817 3300009177 Bacteria 13556
86 Ga0105248_10211121 3300009177 Bacteria 2187
87 Ga0099796_10040553 3300010159 Bacteria 1572
88 Ga0157374_10369454 3300013296 Bacteria 1427
89 Ga0163162_10006372 3300013306 Bacteria 11428
90 Ga0163163_10044522 3300014325 Bacteria 4354
91 Ga0163163_10062309 3300014325 Bacteria 3695
92 Ga0157380_10031506 3300014326 Bacteria 4071
93 Ga0157380_10057548 3300014326 Bacteria 3096
94 Ga0157380_10494504 3300014326 Bacteria 1186
95 Ga0157380_11747324 3300014326 Unclassified 680
96 Ga0182008_10852180 3300014497 Unclassified 533
97 Ga0157376_10733174 3300014969 Bacteria 996
98 Ga0163161_10170306 3300017792 Bacteria 1665
99 Ga0213872_10033373 3300021361 Bacteria 2358
100 Ga0213876_10101551 3300021384 Bacteria 1525
101 Ga0213875_10000182 3300021388 Bacteria 64147
102 Ga0213875_10119502 3300021388 Unclassified 1231
103 Ga0207682_10034758 3300025893 Bacteria 2033
104 Ga0207682_10400071 3300025893 Unclassified 649
105 Ga0207645_10304218 3300025907 Unclassified 1062
106 Ga0207707_10036002 3300025912 Bacteria 4328
107 Ga0207663_10488004 3300025916 Bacteria 955
108 Ga0207652_10646387 3300025921 Bacteria 946
109 Ga0207646_10136173 3300025922 Bacteria 2211
110 Ga0207650_10701175 3300025925 Unclassified 855
111 Ga0207650_10934314 3300025925 Unclassified 737
112 Ga0207659_10043870 3300025926 Bacteria 3144
113 Ga0207664_10502123 3300025929 Unclassified 1086
114 Ga0207664_11088570 3300025929 Unclassified 715
115 Ga0207664_11584252 3300025929 Unclassified 577
116 Ga0207709_11479654 3300025935 Unclassified 563
117 Ga0207711_10345205 3300025941 Bacteria 1378
118 Ga0207668_10372123 3300025972 Bacteria 1200
119 Ga0207658_10122952 3300025986 Bacteria 2072
120 Ga0207678_10163667 3300026067 Bacteria 1900
121 Ga0207676_10650219 3300026095 Bacteria 1017
122 Ga0207676_11846524 3300026095 Unclassified 603
123 Ga0207675_100672032 3300026118 Unclassified 1043
124 Ga0207675_101381018 3300026118 Unclassified 725
125 Ga0207675_101631194 3300026118 Bacteria 665
126 Ga0207683_10087589 3300026121 Bacteria 2769
127 Ga0207698_10710705 3300026142 Bacteria 1001
128 Ga0209588_1051131 3300027671 Bacteria 1337
129 Ga0207428_10019097 3300027907 Bacteria 5846
130 Ga0268266_10669103 3300028379 Bacteria 1000
131 Ga0268266_11148234 3300028379 Unclassified 751
132 Ga0268265_10169265 3300028380 Bacteria 1865
133 Ga0373943_0329353 3300035170 Bacteria 872
134 Ga0373946_0048790 3300035171 Bacteria 1764
135 Ga0373924_0245147 3300035410 Unclassified 793
136 Ga0373935_0498582 3300035692 Bacteria 884
137 Ga0373947_0219940 3300035725 Bacteria 1248
138 Ga0316584_0643811 3300036712 Unclassified 731
139 Ga0373925_1071989 3300037068 Unclassified 663
140 Ga0395899_0047060 3300037312 Bacteria 3211
141 Ga0395899_0762978 3300037312 Bacteria 601
142 Ga0395900_0135326 3300037418 Bacteria 2524
143 Ga0395898_0019720 3300037466 Bacteria 6858
144 Ga0395905_0500564 3300037471 Bacteria 1115
145 Ga0395905_0674115 3300037471 Bacteria 936
146 Ga0436364_0276897 3300037853 Bacteria 48262
147 Ga0436364_1134426 3300037853 Bacteria 2859
148 Ga0395901_0014435 3300038443 Bacteria 8038
149 Ga0436365_0720006 3300039437 Bacteria 1107
150 Ga0436365_1767705 3300039437 Bacteria 1021
151 Ga0436361_0343456 3300039447 Bacteria 10041
152 Ga0436361_0815130 3300039447 Bacteria 2353
153 Ga0436361_1137946 3300039447 Bacteria 1533
154 Ga0436363_0692061 3300039450 Unclassified 517
155 Ga0451807_0242874 3300041486 Bacteria 939
156 Ga0450894_000860 3300042131 Bacteria 4849
157 Ga0450896_034410 3300042133 Bacteria 775
158 Ga0450908_014834 3300042184 Bacteria 1398
159 Ga0450918_009540 3300042531 Unclassified 1701
160 Ga0466964_0206568 3300044706 Bacteria 946
161 Ga0466968_0397968 3300044735 Bacteria 675
162 Ga0466967_0020928 3300045976 Bacteria 5299
163 Ga0466967_0619940 3300045976 Bacteria 1068
164 Ga0495638_0003005 3300046460 Bacteria 13459
165 Ga0495683_0334734 3300047323 Bacteria 642
166 Ga0496100_0239403 3300048903 Bacteria 1338
167 Ga0496104_0065839 3300048907 Bacteria 3439
168 Ga0496105_0013669 3300048908 Bacteria 6445
169 Ga0496108_0001656 3300048911 Bacteria 17657
170 Ga0496109_0005517 3300048912 Bacteria 10593
171 Ga0496110_0011557 3300048913 Bacteria 7235
172 Ga0496111_0001681 3300048914 Bacteria 12889
173 Ga0496112_0000414 3300048915 Bacteria 28126
174 Ga0496112_0500062 3300048915 Bacteria 1151
175 Ga0496112_0528137 3300048915 Bacteria 1114
176 Ga0496113_0001520 3300048916 Bacteria 12991
177 Ga0496115_0011102 3300048918 Bacteria 6750
178 Ga0501031_0057518 3300049568 Unclassified 2534
179 Ga0501032_0044451 3300049569 Unclassified 3006
180 Ga0501033_0325029 3300049570 Bacteria 1080
181 Ga0501033_0348115 3300049570 Unclassified 1038
182 Ga0501033_0555650 3300049570 Bacteria 790
183 Ga0501034_0521061 3300049571 Bacteria 1100
184 Ga0501036_0064172 3300049572 Bacteria 3109
185 Ga0501037_0099440 3300049573 Bacteria 2101
186 Ga0501038_0176725 3300049574 Unclassified 1725
187 Ga0501039_0680804 3300049575 Unclassified 805
188 Ga0501042_0963862 3300049578 Bacteria 621
189 Ga0501043_0093193 3300049579 Unclassified 2368
190 Ga0501043_0123523 3300049579 Bacteria 2030
191 Ga0501043_0232234 3300049579 Bacteria 1425
192 Ga0501046_0509343 3300049580 Bacteria 861
193 Ga0501047_0007442 3300049581 Bacteria 10304
194 Ga0501047_0534335 3300049581 Bacteria 998
195 Ga0501047_1115845 3300049581 Unclassified 602
196 Ga0501069_0186114 3300049585 Unclassified 1201
197 Ga0501070_0000025 3300049586 Bacteria 152175
198 Ga0501073_0702423 3300049589 Bacteria 698
199 Ga0501075_0437738 3300049591 Bacteria 997
200 Ga0501076_0703439 3300049592 Bacteria 834
201 Ga0501077_0467970 3300049593 Bacteria 807
202 Ga0501257_009220 3300049686 Bacteria 2226
203 Ga0501079_0157529 3300049741 Bacteria 1770
204 Ga0501079_0168031 3300049741 Unclassified 1711
205 Ga0501080_0023329 3300049742 Bacteria 5737
206 Ga0501081_0261951 3300049743 Bacteria 1264
207 Ga0501083_0462044 3300049744 Bacteria 826
208 Ga0501035_0000365 3300049822 Bacteria 52161
209 Ga0501035_0000501 3300049822 Bacteria 44157
210 Ga0501035_1464086 3300049822 Bacteria 522
211 Ga0501044_0009185 3300049823 Bacteria 10798
212 Ga0501044_0162645 3300049823 Bacteria 2207
213 Ga0501044_0174998 3300049823 Bacteria 2116
214 Ga0501044_0666277 3300049823 Bacteria 928
215 Ga0501045_0111471 3300049824 Bacteria 2029
216 nmdc:mga0k408_308435_c1 3300050493 Unclassified 945
217 nmdc:mga06z11_269135_c1 3300050494 Unclassified 1007
218 nmdc:mga05p37_104068_c1 3300050507 Bacteria 3493
219 nmdc:mga05p37_1565934_c1 3300050507 Bacteria 652
220 nmdc:mga05p37_466013_c1 3300050507 Bacteria 1459
221 nmdc:mga05p37_56520_c1 3300050507 Unclassified 4832
222 nmdc:mga09592_411909_c1 3300050508 Bacteria 1168
223 nmdc:mga06r32_337023_c1 3300050510 Bacteria 1493
224 nmdc:mga06r32_69228_c1 3300050510 Bacteria 3410
225 nmdc:mga06r32_710658_c1 3300050510 Unclassified 970
226 nmdc:mga08y16_1400857_c1 3300050511 Unclassified 662
227 nmdc:mga08y16_1546866_c1 3300050511 Unclassified 622
228 nmdc:mga08y16_31356_c1 3300050511 Bacteria 5590
229 nmdc:mga0n895_1395701_c1 3300050512 Unclassified 669
230 nmdc:mga0rr50_1387733_c1 3300050513 Unclassified 595
231 nmdc:mga0rr50_1618560_c1 3300050513 Unclassified 546
232 nmdc:mga08x19_99135_c1 3300050514 Bacteria 1931
233 nmdc:mga0a205_109584_c1 3300050515 Bacteria 2659
234 Ga0495595_0536194 3300053084 Bacteria 597
235 Ga0500645_017811 3300053730 Bacteria 2223
236 Ga0501084_0181659 3300054114 Bacteria 1776
237 Ga0501084_0464554 3300054114 Bacteria 1070
238 Ga0501084_0731963 3300054114 Bacteria 834
239 Ga0501082_0193717 3300060353 Bacteria 1768
240 Ga0501082_0474094 3300060353 Bacteria 1094
241 Ga0530510_1256245 3300061734 Bacteria 568
242 Ga0495635_0171598
243 Ga0065707_10241203
244 Ga0070683_101293097
245 Ga0070670_100260594
246 Ga0070670_100769531
247 Ga0070677_10104280
248 Ga0070677_10302936
249 Ga0070682_100882438
250 Ga0070668_100080312
251 Ga0070668_100892701
252 Ga0070675_100216279
253 Ga0070675_100798977
254 Ga0070671_101208505
255 Ga0070671_101608884
256 Ga0070674_100568821
257 Ga0070674_101962980
258 Ga0070673_100186800
259 Ga0070667_100636715
260 Ga0070714_100082163
261 Ga0070714_101122869
262 Ga0070714_101131262
263 Ga0070713_100556693
264 Ga0070701_10634927
265 Ga0070711_100144191
266 Ga0070700_101393379
267 Ga0070694_100391863
268 Ga0070694_101267184
269 Ga0070708_100855048
270 Ga0070663_100102827
271 Ga0070678_100141853
272 Ga0070678_100566126
273 Ga0070662_100084352
274 Ga0070706_100026863
275 Ga0070706_100823419
276 Ga0070707_101017614
277 Ga0070698_100226390
278 Ga0070699_100000050
279 Ga0070699_100033610
280 Ga0070679_100313304
281 Ga0070684_101771424
282 Ga0070697_100669952
283 Ga0070697_101182663
284 Ga0070665_100247366
285 Ga0070665_100437343
286 Ga0070704_100142967
287 Ga0070704_100857802
288 Ga0070664_100334872
289 Ga0070664_101032135
290 Ga0070664_101902154
291 Ga0068852_101337202
292 Ga0068859_100000213
293 Ga0068859_102059761
294 Ga0068864_100167368
295 Ga0068864_101576730
296 Ga0068861_101254054
297 Ga0068861_102057478
298 Ga0068858_100104654
299 Ga0068862_100298743
300 Ga0075432_10129584
301 Ga0075366_10172307
302 Ga0075366_10247659
303 Ga0097621_100373275
304 Ga0075428_100056076
305 Ga0075428_100215994
306 Ga0075428_100801643
307 Ga0075431_100090967
308 Ga0075431_100140549
309 Ga0075431_100296116
310 Ga0075431_100922576
311 Ga0075433_10021319
312 Ga0075429_100320765
313 Ga0075436_100072667
314 Ga0097620_100000213
315 Ga0097620_102059832
316 Ga0075435_100482695
317 Ga0075435_100566610
318 Ga0099794_10183526
319 Ga0099795_10119785
320 Ga0111539_10052612
321 Ga0111539_11294495
322 Ga0105245_11295406
323 Ga0114129_10003253
324 Ga0114129_10061376
325 Ga0114129_10975548
326 Ga0105248_10005817
327 Ga0105248_10211121
328 Ga0099796_10040553
329 Ga0157374_10369454
330 Ga0163162_10006372
331 Ga0163163_10044522
332 Ga0163163_10062309
333 Ga0157380_10031506
334 Ga0157380_10057548
335 Ga0157380_10494504
336 Ga0157380_11747324
337 Ga0182008_10852180
338 Ga0157376_10733174
339 Ga0163161_10170306
340 Ga0213872_10033373
341 Ga0213876_10101551
342 Ga0213875_10000182
343 Ga0213875_10119502
344 Ga0207682_10034758
345 Ga0207682_10400071
346 Ga0207645_10304218
347 Ga0207707_10036002
348 Ga0207663_10488004
349 Ga0207652_10646387
350 Ga0207646_10136173
351 Ga0207650_10701175
352 Ga0207650_10934314
353 Ga0207659_10043870
354 Ga0207664_10502123
355 Ga0207664_11088570
356 Ga0207664_11584252
357 Ga0207709_11479654
358 Ga0207711_10345205
359 Ga0207668_10372123
360 Ga0207658_10122952
361 Ga0207678_10163667
362 Ga0207676_10650219
363 Ga0207676_11846524
364 Ga0207675_100672032
365 Ga0207675_101381018
366 Ga0207675_101631194
367 Ga0207683_10087589
368 Ga0207698_10710705
369 Ga0209588_1051131
370 Ga0207428_10019097
371 Ga0268266_10669103
372 Ga0268266_11148234
373 Ga0268265_10169265
374 Ga0373943_0329353
375 Ga0373946_0048790
376 Ga0373924_0245147
377 Ga0373935_0498582
378 Ga0373947_0219940
379 Ga0316584_0643811
380 Ga0373925_1071989
381 Ga0395899_0047060
382 Ga0395899_0762978
383 Ga0395900_0135326
384 Ga0395898_0019720
385 Ga0395905_0500564
386 Ga0395905_0674115
387 Ga0436364_0276897
388 Ga0436364_1134426
389 Ga0395901_0014435
390 Ga0436365_0720006
391 Ga0436365_1767705
392 Ga0436361_0343456
393 Ga0436361_0815130
394 Ga0436361_1137946
395 Ga0436363_0692061
396 Ga0451807_0242874
397 Ga0450894_000860
398 Ga0450896_034410
399 Ga0450908_014834
400 Ga0450918_009540
401 Ga0466964_0206568
402 Ga0466968_0397968
403 Ga0466967_0020928
404 Ga0466967_0619940
405 Ga0495638_0003005
406 Ga0495683_0334734
407 Ga0496100_0239403
408 Ga0496104_0065839
409 Ga0496105_0013669
410 Ga0496108_0001656
411 Ga0496109_0005517
412 Ga0496110_0011557
413 Ga0496111_0001681
414 Ga0496112_0000414
415 Ga0496112_0500062
416 Ga0496112_0528137
417 Ga0496113_0001520
418 Ga0496115_0011102
419 Ga0501031_0057518
420 Ga0501032_0044451
421 Ga0501033_0325029
422 Ga0501033_0348115
423 Ga0501033_0555650
424 Ga0501034_0521061
425 Ga0501036_0064172
426 Ga0501037_0099440
427 Ga0501038_0176725
428 Ga0501039_0680804
429 Ga0501042_0963862
430 Ga0501043_0093193
431 Ga0501043_0123523
432 Ga0501043_0232234
433 Ga0501046_0509343
434 Ga0501047_0007442
435 Ga0501047_0534335
436 Ga0501047_1115845
437 Ga0501069_0186114
438 Ga0501070_0000025
439 Ga0501073_0702423
440 Ga0501075_0437738
441 Ga0501076_0703439
442 Ga0501077_0467970
443 Ga0501257_009220
444 Ga0501079_0157529
445 Ga0501079_0168031
446 Ga0501080_0023329
447 Ga0501081_0261951
448 Ga0501083_0462044
449 Ga0501035_0000365
450 Ga0501035_0000501
451 Ga0501035_1464086
452 Ga0501044_0009185
453 Ga0501044_0162645
454 Ga0501044_0174998
455 Ga0501044_0666277
456 Ga0501045_0111471
457 nmdc:mga0k408_308435_c1
458 nmdc:mga06z11_269135_c1
459 nmdc:mga05p37_104068_c1
460 nmdc:mga05p37_1565934_c1
461 nmdc:mga05p37_466013_c1
462 nmdc:mga05p37_56520_c1
463 nmdc:mga09592_411909_c1
464 nmdc:mga06r32_337023_c1
465 nmdc:mga06r32_69228_c1
466 nmdc:mga06r32_710658_c1
467 nmdc:mga08y16_1400857_c1
468 nmdc:mga08y16_1546866_c1
469 nmdc:mga08y16_31356_c1
470 nmdc:mga0n895_1395701_c1
471 nmdc:mga0rr50_1387733_c1
472 nmdc:mga0rr50_1618560_c1
473 nmdc:mga08x19_99135_c1
474 nmdc:mga0a205_109584_c1
475 Ga0495595_0536194
476 Ga0500645_017811
477 Ga0501084_0181659
478 Ga0501084_0464554
479 Ga0501084_0731963
480 Ga0501082_0193717
481 Ga0501082_0474094
482 Ga0530510_1256245

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

2

123

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fe1-assembly1.cif.gz_A-2 crystal structure of pae0151 from pyrobaculum aerophilum 0.8863 2 118
2fe1-assembly1.cif.gz_A-2 crystal structure of pae0151 from pyrobaculum aerophilum 0.7979 2 118
4xgr-assembly1.cif.gz_A crystal structure of addiction module from mycobacterial species 0.7749 1 131
4xgr-assembly1.cif.gz_A crystal structure of addiction module from mycobacterial species 0.7697 1 131
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.7656 2 115
ID Description Score Start End Superfamily
af_P9WFA3_1_120_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9805 1 122 3.40.50.1010
af_P9WFA3_1_120_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9725 1 122 3.40.50.1010
af_P9WFB7_11_132_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9556 1 118 3.40.50.1010
af_P9WFA9_1_117_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9382 1 119 3.40.50.1010
af_P9WFB7_11_132_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9102 1 118 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A6N7W7T3-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9911 1 131 GO:0004518
AF-A0A5M8SWL0-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9899 1 130 GO:0000287
GO:0004540
GO:0090729
AF-A0A522NPG3-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9854 1 131 GO:0000287
GO:0004540
GO:0090729
AF-A0A536XXL5-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9853 1 131 GO:0000287
GO:0004540
GO:0090729
AF-A0A2G5PMG0-F1-model_v4 PIN domain-containing protein 0.9851 2 118 GO:0004518

Map