F353948

General Info

Members Datasets Scaffolds Average Seq Length
241 169 482 86

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0623164|Ga0373937_0623164_66_362
Length 98
Sequence MPSFWRERRTPMAEIVYLLCAITSITCALLLYQGYRRTRTRLLFWSGLCFVGLAANNVLLFIDLVIAPDIDLSIPRSVAALTGMLALIFGLVWESRAL

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
70 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
95 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
96 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
97 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
98 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
99 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
100 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
101 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
102 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
103 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
106 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
107 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
108 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
109 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
110 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
111 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
112 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
113 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
114 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
115 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
116 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
117 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
118 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
134 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
135 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
136 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
149 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
155 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
156 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
157 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
158 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
161 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
162 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
168 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
169 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.51
Metatranscriptomes 1.66
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.39
Nodule 0.41
Rhizoplane 2.07
Rhizosphere 86.72
Stem 0
Stem Tuber 0
Unclassified 27.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0623164 3300036401 Unclassified 1024
2 rootH1_10104199 3300003316 Bacteria 2022
3 rootH1_10129329 3300003316 Unclassified 1175
4 rootL2_10030216 3300003322 Unclassified 2150
5 rootL2_10361096 3300003322 Unclassified 1225
6 rootH1_10114351 3300003323 Bacteria 7068
7 rootH1_10255655 3300003323 Bacteria 1961
8 rootH1_10304514 3300003323 Bacteria 2634
9 Ga0058862_12578914 3300004803 Bacteria 1096
10 Ga0070658_10555884 3300005327 Bacteria 993
11 Ga0070683_101154276 3300005329 Bacteria 744
12 Ga0070680_100177395 3300005336 Bacteria 1794
13 Ga0070680_101141949 3300005336 Unclassified 673
14 Ga0070682_100066546 3300005337 Bacteria 2293
15 Ga0070682_101230684 3300005337 Bacteria 633
16 Ga0070660_101570393 3300005339 Bacteria 560
17 Ga0070661_100742543 3300005344 Bacteria 802
18 Ga0070661_100878505 3300005344 Bacteria 739
19 Ga0070659_101498232 3300005366 Bacteria 601
20 Ga0070714_100168201 3300005435 Bacteria 1988
21 Ga0070700_101567710 3300005441 Bacteria 562
22 Ga0070681_10321762 3300005458 Unclassified 1456
23 Ga0070681_10413722 3300005458 Unclassified 1260
24 Ga0070681_10651942 3300005458 Bacteria 968
25 Ga0070681_11871938 3300005458 Bacteria 527
26 Ga0068867_101320251 3300005459 Bacteria 666
27 Ga0070679_100228600 3300005530 Bacteria 1820
28 Ga0070679_100239935 3300005530 Bacteria 1770
29 Ga0070679_100533958 3300005530 Bacteria 1117
30 Ga0070684_100595828 3300005535 Bacteria 1027
31 Ga0068853_100131262 3300005539 Bacteria 2242
32 Ga0068853_101236349 3300005539 Bacteria 721
33 Ga0070693_101124745 3300005547 Bacteria 600
34 Ga0070665_100040468 3300005548 Bacteria 4684
35 Ga0070665_100173345 3300005548 Bacteria 2158
36 Ga0068855_100438825 3300005563 Unclassified 1426
37 Ga0068855_101399670 3300005563 Bacteria 721
38 Ga0068855_101619161 3300005563 Unclassified 662
39 Ga0068855_101977322 3300005563 Unclassified 589
40 Ga0070664_102033249 3300005564 Bacteria 545
41 Ga0068857_100005825 3300005577 Bacteria 10524
42 Ga0068857_101961765 3300005577 Unclassified 574
43 Ga0068856_101110678 3300005614 Bacteria 808
44 Ga0068856_101746581 3300005614 Bacteria 634
45 Ga0068866_10470729 3300005718 Bacteria 826
46 Ga0081538_10011124 3300005981 Bacteria 7314
47 Ga0081538_10114774 3300005981 Bacteria 1311
48 Ga0070717_10112407 3300006028 Bacteria 2324
49 Ga0075365_10457336 3300006038 Bacteria 901
50 Ga0075368_10482024 3300006042 Unclassified 552
51 Ga0075370_10491370 3300006353 Unclassified 740
52 Ga0075428_101993045 3300006844 Unclassified 602
53 Ga0079104_1010707 3300006946 Bacteria 2995
54 Ga0105240_10096871 3300009093 Unclassified 3595
55 Ga0105241_10028514 3300009174 Bacteria 4161
56 Ga0105237_10187791 3300009545 Unclassified 2066
57 Ga0105237_11477385 3300009545 Bacteria 686
58 Ga0105238_10617023 3300009551 Bacteria 1093
59 Ga0105238_10891445 3300009551 Bacteria 908
60 Ga0157370_10036268 3300013104 Bacteria 4786
61 Ga0157369_10240624 3300013105 Unclassified 1891
62 Ga0157369_10350614 3300013105 Bacteria 1533
63 Ga0157374_10498128 3300013296 Unclassified 1223
64 Ga0157378_10925354 3300013297 Bacteria 903
65 Ga0157372_10482486 3300013307 Bacteria 1445
66 Ga0157372_10522967 3300013307 Unclassified 1383
67 Ga0157372_10843481 3300013307 Unclassified 1064
68 Ga0157372_11342835 3300013307 Unclassified 825
69 Ga0157372_12415986 3300013307 Unclassified 603
70 Ga0224712_10099648 3300022467 Bacteria 1230
71 Ga0207642_10370640 3300025899 Bacteria 850
72 Ga0207699_10560303 3300025906 Unclassified 829
73 Ga0207705_10057740 3300025909 Bacteria 2799
74 Ga0207705_10532886 3300025909 Bacteria 913
75 Ga0207705_11361128 3300025909 Bacteria 541
76 Ga0207654_10899634 3300025911 Bacteria 642
77 Ga0207707_10177311 3300025912 Bacteria 1861
78 Ga0207671_10248429 3300025914 Unclassified 1398
79 Ga0207693_10148226 3300025915 Bacteria 1845
80 Ga0207660_11584773 3300025917 Unclassified 528
81 Ga0207662_11319217 3300025918 Bacteria 513
82 Ga0207649_11353203 3300025920 Bacteria 563
83 Ga0207652_10205812 3300025921 Unclassified 1771
84 Ga0207652_10388835 3300025921 Bacteria 1259
85 Ga0207652_10542506 3300025921 Bacteria 1045
86 Ga0207652_10878985 3300025921 Unclassified 793
87 Ga0207652_10898995 3300025921 Bacteria 782
88 Ga0207694_10631159 3300025924 Bacteria 902
89 Ga0207664_10481656 3300025929 Bacteria 1110
90 Ga0207644_10438423 3300025931 Unclassified 1072
91 Ga0207661_11511244 3300025944 Bacteria 615
92 Ga0207679_12033568 3300025945 Bacteria 523
93 Ga0207667_10858469 3300025949 Bacteria 902
94 Ga0207667_11120762 3300025949 Bacteria 769
95 Ga0207651_11699089 3300025960 Bacteria 568
96 Ga0207668_10651701 3300025972 Unclassified 922
97 Ga0207658_11459403 3300025986 Unclassified 626
98 Ga0207639_10217170 3300026041 Bacteria 1649
99 Ga0207702_11572551 3300026078 Bacteria 651
100 Ga0207702_11760708 3300026078 Bacteria 612
101 Ga0207648_10517941 3300026089 Bacteria 1093
102 Ga0207674_10009122 3300026116 Bacteria 11382
103 Ga0207674_11823692 3300026116 Unclassified 575
104 Ga0207698_11533934 3300026142 Unclassified 682
105 Ga0209813_10167854 3300027866 Unclassified 795
106 Ga0209974_10423804 3300027876 Bacteria 525
107 Ga0268266_10010872 3300028379 Bacteria 7928
108 Ga0268266_10119715 3300028379 Bacteria 2342
109 Ga0265326_10102284 3300028558 Unclassified 813
110 Ga0265334_10205412 3300028573 Unclassified 683
111 Ga0307517_10250791 3300028786 Bacteria 1039
112 Ga0307515_10583742 3300028794 Unclassified 727
113 Ga0265338_10007155 3300028800 Bacteria 13970
114 Ga0265338_10456605 3300028800 Bacteria 904
115 Ga0265338_10690260 3300028800 Unclassified 705
116 Ga0265328_10094751 3300031239 Unclassified 1104
117 Ga0307513_10580580 3300031456 Unclassified 831
118 Ga0307405_10144653 3300031731 Bacteria 1663
119 Ga0307405_10775078 3300031731 Bacteria 801
120 Ga0307413_10229135 3300031824 Bacteria 1363
121 Ga0307413_11276417 3300031824 Unclassified 641
122 Ga0307410_10253993 3300031852 Bacteria 1368
123 Ga0307410_10723464 3300031852 Bacteria 841
124 Ga0307406_11221916 3300031901 Bacteria 653
125 Ga0307407_11505732 3300031903 Bacteria 532
126 Ga0307412_10166698 3300031911 Bacteria 1643
127 Ga0307412_10187203 3300031911 Bacteria 1562
128 Ga0307412_10272043 3300031911 Bacteria 1326
129 Ga0307412_10503418 3300031911 Unclassified 1009
130 Ga0307412_11525809 3300031911 Bacteria 608
131 Ga0307412_11588908 3300031911 Bacteria 597
132 Ga0307412_11696562 3300031911 Unclassified 579
133 Ga0307412_12067286 3300031911 Bacteria 528
134 Ga0307409_100545951 3300031995 Bacteria 1137
135 Ga0307416_100372270 3300032002 Bacteria 1455
136 Ga0307416_101687698 3300032002 Bacteria 738
137 Ga0307414_10033357 3300032004 Bacteria 3402
138 Ga0307414_10034856 3300032004 Bacteria 3342
139 Ga0307414_10074617 3300032004 Bacteria 2458
140 Ga0307414_10514498 3300032004 Bacteria 1061
141 Ga0373959_0036167 3300034820 Bacteria 1018
142 Ga0395899_0003578 3300037312 Bacteria 12304
143 Ga0395900_0027847 3300037418 Bacteria 5789
144 Ga0395900_0040721 3300037418 Bacteria 4788
145 Ga0395898_0017736 3300037466 Bacteria 7264
146 Ga0395898_0607701 3300037466 Unclassified 1036
147 Ga0395905_0008204 3300037471 Bacteria 10315
148 Ga0395905_0338921 3300037471 Bacteria 1394
149 Ga0395905_1038670 3300037471 Bacteria 723
150 Ga0395901_0371964 3300038443 Unclassified 1472
151 Ga0395901_0607175 3300038443 Bacteria 1102
152 Ga0439438_029571 3300041405 Bacteria 1466
153 Ga0439439_0006456 3300041406 Bacteria 2713
154 Ga0439447_019539 3300041407 Bacteria 1805
155 Ga0439461_0077278 3300041410 Bacteria 780
156 Ga0439466_0004616 3300041411 Bacteria 5291
157 Ga0439466_0005181 3300041411 Bacteria 4992
158 Ga0439465_0001420 3300041413 Bacteria 7747
159 Ga0451789_0329588 3300041443 Unclassified 589
160 Ga0451800_0718555 3300041459 Unclassified 704
161 Ga0451802_2199240 3300041460 Unclassified 627
162 Ga0451807_0001008 3300041486 Unclassified 993
163 Ga0451853_3639756 3300041512 Unclassified 601
164 Ga0439431_0000546 3300041997 Bacteria 8004
165 Ga0439431_0000834 3300041997 Bacteria 6657
166 Ga0439433_0000350 3300041999 Bacteria 8165
167 Ga0439442_042283 3300042002 Bacteria 958
168 Ga0439445_0000625 3300042004 Bacteria 7280
169 Ga0439445_0001687 3300042004 Bacteria 4841
170 Ga0439432_002313 3300042006 Bacteria 7182
171 Ga0439449_0002980 3300042007 Bacteria 6601
172 Ga0439452_002959 3300042010 Bacteria 6049
173 Ga0439457_015217 3300042014 Bacteria 1719
174 Ga0439462_0000866 3300042015 Bacteria 6353
175 Ga0439462_0010657 3300042015 Bacteria 2331
176 Ga0450890_027533 3300042127 Bacteria 796
177 Ga0450892_001494 3300042130 Bacteria 2248
178 Ga0439446_0002005 3300042156 Bacteria 4816
179 Ga0439446_0043902 3300042156 Bacteria 1322
180 Ga0439446_0177833 3300042156 Bacteria 710
181 Ga0450909_018429 3300042185 Bacteria 1036
182 Ga0439434_0024912 3300042435 Bacteria 1805
183 Ga0466972_0002589 3300044658 Bacteria 8974
184 Ga0453683_0742927 3300044673 Bacteria 644
185 Ga0466965_0348303 3300044683 Bacteria 811
186 Ga0466966_0625005 3300044684 Bacteria 648
187 Ga0466966_0880357 3300044684 Unclassified 540
188 Ga0466961_0982938 3300044693 Bacteria 502
189 Ga0466963_0301530 3300044694 Bacteria 1127
190 Ga0466963_0629224 3300044694 Unclassified 757
191 Ga0466963_0978467 3300044694 Unclassified 596
192 Ga0466964_0665978 3300044706 Bacteria 577
193 Ga0466971_0493806 3300044719 Bacteria 603
194 Ga0466970_0026700 3300044765 Bacteria 3026
195 Ga0466957_0061216 3300044842 Bacteria 2309
196 Ga0466960_0439012 3300044901 Bacteria 757
197 Ga0466959_0221377 3300045049 Bacteria 1312
198 Ga0466959_0225125 3300045049 Bacteria 1299
199 Ga0451576_0909394 3300045051 Bacteria 923
200 Ga0466967_0802054 3300045976 Bacteria 935
201 Ga0495621_0072132 3300046539 Bacteria 1274
202 Ga0495621_0075772 3300046539 Bacteria 1247
203 Ga0495597_0115673 3300046542 Bacteria 1121
204 Ga0495677_0103028 3300047445 Bacteria 1082
205 Ga0495615_0303708 3300048090 Bacteria 518
206 Ga0496106_0361203 3300048909 Bacteria 1167
207 Ga0496126_0315531 3300048929 Bacteria 1286
208 Ga0495682_0246390 3300049460 Unclassified 632
209 Ga0501040_1082620 3300049576 Bacteria 581
210 Ga0501047_0144675 3300049581 Bacteria 2255
211 Ga0501047_0311370 3300049581 Bacteria 1415
212 Ga0501048_1352276 3300049582 Bacteria 512
213 Ga0501070_1238860 3300049586 Unclassified 571
214 Ga0501071_0473265 3300049587 Bacteria 960
215 Ga0501071_1474897 3300049587 Bacteria 525
216 Ga0501072_0181192 3300049588 Unclassified 1680
217 Ga0501073_1216569 3300049589 Unclassified 517
218 Ga0501076_0375334 3300049592 Unclassified 1169
219 Ga0501249_080567 3300049679 Bacteria 766
220 Ga0501261_091024 3300049690 Bacteria 567
221 Ga0501080_0176766 3300049742 Bacteria 1966
222 Ga0501081_0145265 3300049743 Bacteria 1702
223 Ga0501083_0174844 3300049744 Bacteria 1403
224 Ga0501035_0140522 3300049822 Bacteria 2100
225 nmdc:mga07m45_456949_c1 3300050496 Unclassified 740
226 Ga0500654_104463 3300053099 Unclassified 1191
227 Ga0500572_210346 3300053111 Unclassified 637
228 Ga0500595_004240 3300053119 Bacteria 6477
229 Ga0500559_0576186 3300053136 Unclassified 512
230 Ga0500568_0103043 3300053139 Bacteria 1070
231 Ga0500590_277034 3300053148 Unclassified 647
232 Ga0500604_0222440 3300053151 Unclassified 651
233 Ga0500616_0083224 3300053153 Bacteria 1603
234 Ga0501084_0367575 3300054114 Bacteria 1215
235 Ga0587070_180548 3300059491 Unclassified 549
236 Ga0587115_092916 3300059626 Unclassified 550
237 Ga0466962_0562685 3300061719 Bacteria 579
238 Ga0530510_0934770 3300061734 Unclassified 663
239 Ga0530510_1363278 3300061734 Unclassified 544
240 2644221951 2643221639 Bacteria 6649903
241 2885192579 2885192300 Bacteria 5882526
242 Ga0373937_0623164
243 rootH1_10104199
244 rootH1_10129329
245 rootL2_10030216
246 rootL2_10361096
247 rootH1_10114351
248 rootH1_10255655
249 rootH1_10304514
250 Ga0058862_12578914
251 Ga0070658_10555884
252 Ga0070683_101154276
253 Ga0070680_100177395
254 Ga0070680_101141949
255 Ga0070682_100066546
256 Ga0070682_101230684
257 Ga0070660_101570393
258 Ga0070661_100742543
259 Ga0070661_100878505
260 Ga0070659_101498232
261 Ga0070714_100168201
262 Ga0070700_101567710
263 Ga0070681_10321762
264 Ga0070681_10413722
265 Ga0070681_10651942
266 Ga0070681_11871938
267 Ga0068867_101320251
268 Ga0070679_100228600
269 Ga0070679_100239935
270 Ga0070679_100533958
271 Ga0070684_100595828
272 Ga0068853_100131262
273 Ga0068853_101236349
274 Ga0070693_101124745
275 Ga0070665_100040468
276 Ga0070665_100173345
277 Ga0068855_100438825
278 Ga0068855_101399670
279 Ga0068855_101619161
280 Ga0068855_101977322
281 Ga0070664_102033249
282 Ga0068857_100005825
283 Ga0068857_101961765
284 Ga0068856_101110678
285 Ga0068856_101746581
286 Ga0068866_10470729
287 Ga0081538_10011124
288 Ga0081538_10114774
289 Ga0070717_10112407
290 Ga0075365_10457336
291 Ga0075368_10482024
292 Ga0075370_10491370
293 Ga0075428_101993045
294 Ga0079104_1010707
295 Ga0105240_10096871
296 Ga0105241_10028514
297 Ga0105237_10187791
298 Ga0105237_11477385
299 Ga0105238_10617023
300 Ga0105238_10891445
301 Ga0157370_10036268
302 Ga0157369_10240624
303 Ga0157369_10350614
304 Ga0157374_10498128
305 Ga0157378_10925354
306 Ga0157372_10482486
307 Ga0157372_10522967
308 Ga0157372_10843481
309 Ga0157372_11342835
310 Ga0157372_12415986
311 Ga0224712_10099648
312 Ga0207642_10370640
313 Ga0207699_10560303
314 Ga0207705_10057740
315 Ga0207705_10532886
316 Ga0207705_11361128
317 Ga0207654_10899634
318 Ga0207707_10177311
319 Ga0207671_10248429
320 Ga0207693_10148226
321 Ga0207660_11584773
322 Ga0207662_11319217
323 Ga0207649_11353203
324 Ga0207652_10205812
325 Ga0207652_10388835
326 Ga0207652_10542506
327 Ga0207652_10878985
328 Ga0207652_10898995
329 Ga0207694_10631159
330 Ga0207664_10481656
331 Ga0207644_10438423
332 Ga0207661_11511244
333 Ga0207679_12033568
334 Ga0207667_10858469
335 Ga0207667_11120762
336 Ga0207651_11699089
337 Ga0207668_10651701
338 Ga0207658_11459403
339 Ga0207639_10217170
340 Ga0207702_11572551
341 Ga0207702_11760708
342 Ga0207648_10517941
343 Ga0207674_10009122
344 Ga0207674_11823692
345 Ga0207698_11533934
346 Ga0209813_10167854
347 Ga0209974_10423804
348 Ga0268266_10010872
349 Ga0268266_10119715
350 Ga0265326_10102284
351 Ga0265334_10205412
352 Ga0307517_10250791
353 Ga0307515_10583742
354 Ga0265338_10007155
355 Ga0265338_10456605
356 Ga0265338_10690260
357 Ga0265328_10094751
358 Ga0307513_10580580
359 Ga0307405_10144653
360 Ga0307405_10775078
361 Ga0307413_10229135
362 Ga0307413_11276417
363 Ga0307410_10253993
364 Ga0307410_10723464
365 Ga0307406_11221916
366 Ga0307407_11505732
367 Ga0307412_10166698
368 Ga0307412_10187203
369 Ga0307412_10272043
370 Ga0307412_10503418
371 Ga0307412_11525809
372 Ga0307412_11588908
373 Ga0307412_11696562
374 Ga0307412_12067286
375 Ga0307409_100545951
376 Ga0307416_100372270
377 Ga0307416_101687698
378 Ga0307414_10033357
379 Ga0307414_10034856
380 Ga0307414_10074617
381 Ga0307414_10514498
382 Ga0373959_0036167
383 Ga0395899_0003578
384 Ga0395900_0027847
385 Ga0395900_0040721
386 Ga0395898_0017736
387 Ga0395898_0607701
388 Ga0395905_0008204
389 Ga0395905_0338921
390 Ga0395905_1038670
391 Ga0395901_0371964
392 Ga0395901_0607175
393 Ga0439438_029571
394 Ga0439439_0006456
395 Ga0439447_019539
396 Ga0439461_0077278
397 Ga0439466_0004616
398 Ga0439466_0005181
399 Ga0439465_0001420
400 Ga0451789_0329588
401 Ga0451800_0718555
402 Ga0451802_2199240
403 Ga0451807_0001008
404 Ga0451853_3639756
405 Ga0439431_0000546
406 Ga0439431_0000834
407 Ga0439433_0000350
408 Ga0439442_042283
409 Ga0439445_0000625
410 Ga0439445_0001687
411 Ga0439432_002313
412 Ga0439449_0002980
413 Ga0439452_002959
414 Ga0439457_015217
415 Ga0439462_0000866
416 Ga0439462_0010657
417 Ga0450890_027533
418 Ga0450892_001494
419 Ga0439446_0002005
420 Ga0439446_0043902
421 Ga0439446_0177833
422 Ga0450909_018429
423 Ga0439434_0024912
424 Ga0466972_0002589
425 Ga0453683_0742927
426 Ga0466965_0348303
427 Ga0466966_0625005
428 Ga0466966_0880357
429 Ga0466961_0982938
430 Ga0466963_0301530
431 Ga0466963_0629224
432 Ga0466963_0978467
433 Ga0466964_0665978
434 Ga0466971_0493806
435 Ga0466970_0026700
436 Ga0466957_0061216
437 Ga0466960_0439012
438 Ga0466959_0221377
439 Ga0466959_0225125
440 Ga0451576_0909394
441 Ga0466967_0802054
442 Ga0495621_0072132
443 Ga0495621_0075772
444 Ga0495597_0115673
445 Ga0495677_0103028
446 Ga0495615_0303708
447 Ga0496106_0361203
448 Ga0496126_0315531
449 Ga0495682_0246390
450 Ga0501040_1082620
451 Ga0501047_0144675
452 Ga0501047_0311370
453 Ga0501048_1352276
454 Ga0501070_1238860
455 Ga0501071_0473265
456 Ga0501071_1474897
457 Ga0501072_0181192
458 Ga0501073_1216569
459 Ga0501076_0375334
460 Ga0501249_080567
461 Ga0501261_091024
462 Ga0501080_0176766
463 Ga0501081_0145265
464 Ga0501083_0174844
465 Ga0501035_0140522
466 nmdc:mga07m45_456949_c1
467 Ga0500654_104463
468 Ga0500572_210346
469 Ga0500595_004240
470 Ga0500559_0576186
471 Ga0500568_0103043
472 Ga0500590_277034
473 Ga0500604_0222440
474 Ga0500616_0083224
475 Ga0501084_0367575
476 Ga0587070_180548
477 Ga0587115_092916
478 Ga0466962_0562685
479 Ga0530510_0934770
480 Ga0530510_1363278
481 2644221951
482 2885192579

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19447

DUF5985

Family of unknown function (DUF5985)

12

96

0.98

Map