F353947

General Info

Members Datasets Scaffolds Average Seq Length
241 158 234 148

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0231360|Ga0373937_0231360_187_705
Length 172
Sequence MRLDMTTLRASAHTAAVTEEYKDMSEEALDQMGPIDYVVIEWEGKLPSGEAMPLLVDLVDRGIVRILDLAFIAKDEGGNVVDLTIDEVGEVSAEFATFEGAASGLLGDDDIAEAATALEPGTAAAVLVWENSWAAPFAVALRKSGGQLVASGRIPVQAIVASLEATEAAAGA

Samples

Sample ID Description Type Environment
1 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
2 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
3 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
4 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
5 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
6 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
7 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
64 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
77 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
88 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
89 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
90 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
91 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
92 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
93 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
94 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
99 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
100 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
115 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
116 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
119 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
146 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
147 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
148 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
149 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
155 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.61
Metatranscriptomes 2.49
Isolates 2.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.47
Nodule 0
Rhizoplane 7.47
Rhizosphere 78.42
Stem 0
Stem Tuber 0
Unclassified 6.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100286270 3300005338 Bacteria 1396
2 Ga0068868_100700743 3300005338 Bacteria 906
3 Ga0070661_101670503 3300005344 Bacteria 539
4 Ga0070674_100241333 3300005356 Unclassified 1415
5 Ga0070674_100810272 3300005356 Bacteria 809
6 Ga0070688_101192470 3300005365 Bacteria 611
7 Ga0070700_100005815 3300005441 Bacteria 6547
8 Ga0070679_100287170 3300005530 Bacteria 1597
9 Ga0070684_101251596 3300005535 Bacteria 698
10 Ga0070684_101526204 3300005535 Bacteria 630
11 Ga0070686_100180542 3300005544 Bacteria 1499
12 Ga0070665_100203762 3300005548 Bacteria 1979
13 Ga0068855_100450704 3300005563 Bacteria 1404
14 Ga0070664_100398032 3300005564 Bacteria 1259
15 Ga0068857_100886033 3300005577 Bacteria 855
16 Ga0068856_101922941 3300005614 Unclassified 602
17 Ga0068864_101356253 3300005618 Bacteria 712
18 Ga0068864_101379681 3300005618 Bacteria 706
19 Ga0068861_100204140 3300005719 Bacteria 1661
20 Ga0081455_10435335 3300005937 Bacteria 900
21 Ga0081539_10001832 3300005985 Bacteria 33546
22 Ga0075365_10005647 3300006038 Bacteria 6774
23 Ga0075368_10327670 3300006042 Bacteria 664
24 Ga0075363_100586924 3300006048 Bacteria 667
25 Ga0075364_10191501 3300006051 Unclassified 1385
26 Ga0075364_10560139 3300006051 Bacteria 781
27 Ga0075364_10594241 3300006051 Bacteria 756
28 Ga0075364_10863728 3300006051 Bacteria 616
29 Ga0075367_10408679 3300006178 Bacteria 859
30 Ga0075428_100281608 3300006844 Bacteria 1789
31 Ga0075431_100013833 3300006847 Bacteria 8150
32 Ga0075431_101021433 3300006847 Bacteria 793
33 Ga0075436_100063224 3300006914 Bacteria 2558
34 Ga0105250_10129507 3300009092 Bacteria 1041
35 Ga0111539_10786352 3300009094 Bacteria 1107
36 Ga0111539_10969215 3300009094 Bacteria 989
37 Ga0111539_11074348 3300009094 Bacteria 935
38 Ga0111539_13160272 3300009094 Bacteria 531
39 Ga0105243_10146478 3300009148 Bacteria 2021
40 Ga0105237_10070497 3300009545 Bacteria 3491
41 Ga0105237_10916056 3300009545 Bacteria 884
42 Ga0105238_10417685 3300009551 Bacteria 1336
43 Ga0105239_10043147 3300010375 Bacteria 4942
44 Ga0105239_10726644 3300010375 Bacteria 1136
45 Ga0105246_11506175 3300011119 Bacteria 632
46 Ga0157374_10114156 3300013296 Unclassified 2600
47 Ga0157375_10385949 3300013308 Bacteria 1567
48 Ga0163163_10309627 3300014325 Bacteria 1632
49 Ga0163163_10384645 3300014325 Bacteria 1461
50 Ga0163163_11094882 3300014325 Bacteria 860
51 Ga0182008_10092238 3300014497 Bacteria 1494
52 Ga0206356_10291529 3300020070 Bacteria 832
53 Ga0206349_1967475 3300020075 Bacteria 562
54 Ga0206350_10812950 3300020080 Bacteria 1257
55 Ga0206354_10784667 3300020081 Bacteria 1249
56 Ga0207671_10321913 3300025914 Bacteria 1224
57 Ga0207671_10602523 3300025914 Bacteria 875
58 Ga0207669_10237140 3300025937 Bacteria 1350
59 Ga0207704_11158562 3300025938 Bacteria 658
60 Ga0207667_11001995 3300025949 Bacteria 823
61 Ga0207668_11424491 3300025972 Bacteria 625
62 Ga0207640_10630417 3300025981 Bacteria 911
63 Ga0207678_10238720 3300026067 Bacteria 1557
64 Ga0207678_10248902 3300026067 Bacteria 1522
65 Ga0207708_10029533 3300026075 Bacteria 4156
66 Ga0207648_10739522 3300026089 Bacteria 913
67 Ga0207676_11885418 3300026095 Bacteria 596
68 Ga0207674_10637078 3300026116 Bacteria 1029
69 Ga0207675_100170616 3300026118 Bacteria 2079
70 Ga0207683_10219591 3300026121 Bacteria 1732
71 Ga0307513_10320977 3300031456 Bacteria 1307
72 Ga0307408_100378549 3300031548 Bacteria 1209
73 Ga0307408_100606077 3300031548 Unclassified 974
74 Ga0316579_10170585 3300031691 Unclassified 1052
75 Ga0316576_10004873 3300031727 Bacteria 8113
76 Ga0316576_10091199 3300031727 Bacteria 2270
77 Ga0316576_10299331 3300031727 Bacteria 1202
78 Ga0307405_10379237 3300031731 Bacteria 1100
79 Ga0307405_10625433 3300031731 Bacteria 882
80 Ga0307413_10113827 3300031824 Bacteria 1817
81 Ga0307413_10529442 3300031824 Bacteria 952
82 Ga0307413_11513957 3300031824 Bacteria 593
83 Ga0307410_10100719 3300031852 Bacteria 2070
84 Ga0307410_10156630 3300031852 Bacteria 1702
85 Ga0307410_10176366 3300031852 Bacteria 1615
86 Ga0307410_10414340 3300031852 Bacteria 1091
87 Ga0307410_10514682 3300031852 Bacteria 987
88 Ga0307410_10538195 3300031852 Bacteria 966
89 Ga0307406_10026568 3300031901 Bacteria 3479
90 Ga0307406_10082604 3300031901 Bacteria 2140
91 Ga0307406_10230170 3300031901 Bacteria 1384
92 Ga0307407_10244771 3300031903 Bacteria 1225
93 Ga0307407_10254815 3300031903 Bacteria 1204
94 Ga0307407_10632486 3300031903 Bacteria 800
95 Ga0307407_11231339 3300031903 Bacteria 585
96 Ga0307412_10079202 3300031911 Bacteria 2266
97 Ga0307412_10609547 3300031911 Bacteria 926
98 Ga0307412_10789726 3300031911 Bacteria 823
99 Ga0307409_100026000 3300031995 Bacteria 4120
100 Ga0307409_100128329 3300031995 Bacteria 2162
101 Ga0307409_100219818 3300031995 Unclassified 1714
102 Ga0307409_100328598 3300031995 Bacteria 1434
103 Ga0307409_100359367 3300031995 Bacteria 1377
104 Ga0307409_100384956 3300031995 Bacteria 1335
105 Ga0307409_101229564 3300031995 Bacteria 773
106 Ga0307409_101309078 3300031995 Bacteria 750
107 Ga0307416_100090707 3300032002 Bacteria 2622
108 Ga0307416_100097892 3300032002 Bacteria 2542
109 Ga0307416_100665273 3300032002 Bacteria 1127
110 Ga0307416_100767673 3300032002 Bacteria 1058
111 Ga0307414_10399044 3300032004 Bacteria 1194
112 Ga0307414_10475478 3300032004 Unclassified 1101
113 Ga0307414_10522387 3300032004 Bacteria 1054
114 Ga0307411_10534506 3300032005 Bacteria 997
115 Ga0307415_100090479 3300032126 Bacteria 2214
116 Ga0307415_100102813 3300032126 Bacteria 2100
117 Ga0307415_100429236 3300032126 Bacteria 1136
118 Ga0307415_100568749 3300032126 Bacteria 1003
119 Ga0307415_100864131 3300032126 Bacteria 831
120 Ga0316580_10185442 3300032139 Bacteria 640
121 Ga0316574_0021336 3300035398 Bacteria 3845
122 Ga0373935_0009190 3300035692 Bacteria 5916
123 Ga0373937_0231360 3300036401 Bacteria 1741
124 Ga0316582_0075304 3300036647 Bacteria 2193
125 Ga0316584_0033204 3300036712 Bacteria 3821
126 Ga0316584_0325231 3300036712 Unclassified 1108
127 Ga0395899_0091381 3300037312 Bacteria 2206
128 Ga0395900_0037421 3300037418 Bacteria 5003
129 Ga0395898_0011821 3300037466 Bacteria 9048
130 Ga0395898_0395514 3300037466 Bacteria 1318
131 Ga0395905_0032745 3300037471 Bacteria 4886
132 Ga0395905_1183936 3300037471 Bacteria 668
133 Ga0395901_0005278 3300038443 Bacteria 13050
134 Ga0395901_1239824 3300038443 Bacteria 710
135 Ga0439465_0259323 3300041413 Bacteria 644
136 Ga0451833_1135700 3300041491 Bacteria 509
137 Ga0451837_1856688 3300041494 Bacteria 1771
138 Ga0495641_0253778 3300046461 Bacteria 791
139 Ga0495650_0000079 3300046471 Bacteria 244549
140 Ga0495584_0314685 3300046491 Unclassified 795
141 Ga0495616_0305598 3300046513 Bacteria 671
142 Ga0495616_0401903 3300046513 Bacteria 563
143 Ga0495665_0203364 3300046531 Bacteria 1026
144 Ga0495640_0029305 3300046533 Bacteria 3953
145 Ga0495667_0262816 3300046559 Bacteria 1097
146 Ga0495634_0017000 3300046642 Bacteria 5196
147 Ga0495588_0341478 3300046674 Bacteria 787
148 Ga0495647_0000046 3300046681 Bacteria 35269
149 Ga0495680_0661492 3300047322 Bacteria 693
150 Ga0495684_0523798 3300047471 Bacteria 811
151 Ga0495686_0004478 3300047472 Bacteria 11488
152 Ga0496101_0170029 3300048904 Bacteria 1675
153 Ga0496102_0460659 3300048905 Bacteria 1192
154 Ga0496102_0509511 3300048905 Bacteria 1126
155 Ga0496103_0017183 3300048906 Bacteria 4326
156 Ga0496104_0092675 3300048907 Bacteria 2889
157 Ga0496108_0144153 3300048911 Bacteria 2052
158 Ga0496108_0163050 3300048911 Bacteria 1927
159 Ga0496108_1159403 3300048911 Unclassified 655
160 Ga0496109_0062833 3300048912 Bacteria 3396
161 Ga0496109_0115323 3300048912 Bacteria 2499
162 Ga0496110_0010408 3300048913 Bacteria 7563
163 Ga0496110_0911940 3300048913 Unclassified 785
164 Ga0496111_0417849 3300048914 Bacteria 991
165 Ga0496112_0042887 3300048915 Bacteria 4428
166 Ga0496113_0074344 3300048916 Bacteria 2591
167 Ga0496113_0238771 3300048916 Bacteria 1450
168 Ga0496114_0839264 3300048917 Bacteria 799
169 Ga0496114_1655655 3300048917 Bacteria 528
170 Ga0496118_0245900 3300048921 Bacteria 1020
171 Ga0496119_0045428 3300048922 Bacteria 2753
172 Ga0496120_0001229 3300048923 Bacteria 32395
173 Ga0496120_0344435 3300048923 Bacteria 671
174 Ga0496121_0088796 3300048924 Bacteria 2422
175 Ga0496121_0326338 3300048924 Bacteria 1031
176 Ga0496121_0343145 3300048924 Bacteria 997
177 Ga0496125_0047244 3300048928 Bacteria 3602
178 Ga0501307_025050 3300049162 Bacteria 799
179 Ga0501323_018117 3300049539 Bacteria 909
180 Ga0501031_0021612 3300049568 Bacteria 4195
181 Ga0501033_0898999 3300049570 Bacteria 595
182 Ga0501034_0008714 3300049571 Bacteria 10682
183 Ga0501034_0269961 3300049571 Bacteria 1642
184 Ga0501036_0269542 3300049572 Bacteria 1425
185 Ga0501037_0269345 3300049573 Bacteria 1189
186 Ga0501038_0124161 3300049574 Bacteria 2126
187 Ga0501039_0003946 3300049575 Bacteria 11147
188 Ga0501039_0013406 3300049575 Bacteria 6268
189 Ga0501040_0130053 3300049576 Bacteria 1770
190 Ga0501040_0337773 3300049576 Bacteria 1078
191 Ga0501042_0178863 3300049578 Bacteria 1530
192 Ga0501043_0254237 3300049579 Bacteria 1353
193 Ga0501046_0829967 3300049580 Bacteria 647
194 Ga0501047_0045401 3300049581 Bacteria 4249
195 Ga0501047_0333169 3300049581 Bacteria 1356
196 Ga0501048_0176737 3300049582 Bacteria 1513
197 Ga0501048_0288235 3300049582 Unclassified 1168
198 Ga0501068_0019957 3300049584 Bacteria 3900
199 Ga0501071_0096016 3300049587 Bacteria 2181
200 Ga0501071_1019568 3300049587 Unclassified 639
201 Ga0501072_0182832 3300049588 Bacteria 1672
202 Ga0501072_0234854 3300049588 Bacteria 1460
203 Ga0501075_0028261 3300049591 Bacteria 4139
204 Ga0501075_0557360 3300049591 Unclassified 875
205 Ga0501076_0115106 3300049592 Bacteria 2176
206 Ga0501076_0411862 3300049592 Bacteria 1112
207 Ga0501076_0665142 3300049592 Bacteria 860
208 Ga0501077_0578774 3300049593 Unclassified 721
209 Ga0501202_233367 3300049652 Archaea 513
210 Ga0501080_0388605 3300049742 Bacteria 1256
211 Ga0501083_0062538 3300049744 Bacteria 2483
212 Ga0501083_0079138 3300049744 Bacteria 2180
213 Ga0501044_0026937 3300049823 Bacteria 6082
214 Ga0501045_0041505 3300049824 Bacteria 3348
215 Ga0501045_0264519 3300049824 Bacteria 1280
216 nmdc:mga03n38_235408_c1 3300050490 Bacteria 961
217 nmdc:mga03n38_480436_c1 3300050490 Bacteria 695
218 nmdc:mga00v17_514769_c1 3300050491 Bacteria 775
219 nmdc:mga0yw44_245950_c1 3300050492 Bacteria 1190
220 nmdc:mga06z11_493886_c1 3300050494 Bacteria 741
221 nmdc:mga04h51_278900_c1 3300050495 Bacteria 676
222 nmdc:mga06r32_7046_c1 3300050510 Bacteria 10111
223 nmdc:mga06r32_795291_c1 3300050510 Bacteria 907
224 nmdc:mga08y16_493091_c1 3300050511 Bacteria 1245
225 Ga0495655_0053200 3300053083 Bacteria 1079
226 Ga0495619_0459615 3300053085 Bacteria 877
227 Ga0500556_0001141 3300053104 Bacteria 12970
228 Ga0500595_098392 3300053119 Bacteria 840
229 Ga0500616_0002554 3300053153 Bacteria 15005
230 Ga0500616_0177070 3300053153 Bacteria 963
231 Ga0501084_0057954 3300054114 Bacteria 3241
232 Ga0501084_0204114 3300054114 Bacteria 1668
233 Ga0501082_0325662 3300060353 Bacteria 1339
234 Ga0501082_2008483 3300060353 Bacteria 504

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046491 Ga0495584_0314685 Ga0495584_0314685_412_771 119
2 3300049584 Ga0501068_0019957 Ga0501068_0019957_2789_3229 127
3 3300031691 Ga0316579_10170585 Ga0316579_101705851 130
4 3300031727 Ga0316576_10004873 Ga0316576_100048734 130
5 3300035398 Ga0316574_0021336 Ga0316574_0021336_3089_3616 130
6 3300036647 Ga0316582_0075304 Ga0316582_0075304_1442_1969 130
7 3300036712 Ga0316584_0325231 Ga0316584_0325231_72_599 130
8 3300031995 Ga0307409_100384956 Ga0307409_1003849561 134
9 3300049162 Ga0501307_025050 Ga0501307_025050_352_759 135
10 3300009545 Ga0105237_10070497 Ga0105237_100704974 137
11 3300009551 Ga0105238_10417685 Ga0105238_104176852 137
12 3300010375 Ga0105239_10726644 Ga0105239_107266442 137
13 3300025914 Ga0207671_10321913 Ga0207671_103219132 137
14 3300048905 Ga0496102_0460659 Ga0496102_0460659_91_528 137
15 3300048906 Ga0496103_0017183 Ga0496103_0017183_2147_2584 137
16 3300005544 Ga0070686_100180542 Ga0070686_1001805423 139
17 3300041491 Ga0451833_1135700 Ga0451833_1135700_10_429 139
18 3300049652 Ga0501202_233367 Ga0501202_233367_11_433 139
19 3300005548 Ga0070665_100203762 Ga0070665_1002037623 140
20 3300005563 Ga0068855_100450704 Ga0068855_1004507043 140
21 3300006042 Ga0075368_10327670 Ga0075368_103276702 140
22 3300006048 Ga0075363_100586924 Ga0075363_1005869241 140
23 3300006051 Ga0075364_10560139 Ga0075364_105601392 140
24 3300006178 Ga0075367_10408679 Ga0075367_104086792 140
25 3300009545 Ga0105237_10916056 Ga0105237_109160562 140
26 3300010375 Ga0105239_10043147 Ga0105239_100431477 140
27 3300025914 Ga0207671_10602523 Ga0207671_106025232 140
28 3300025949 Ga0207667_11001995 Ga0207667_110019952 140
29 3300025972 Ga0207668_11424491 Ga0207668_114244911 140
30 3300037466 Ga0395898_0395514 Ga0395898_0395514_645_1067 140
31 3300037471 Ga0395905_1183936 Ga0395905_1183936_53_475 140
32 3300038443 Ga0395901_1239824 Ga0395901_1239824_147_569 140
33 3300048917 Ga0496114_0839264 Ga0496114_0839264_190_618 140
34 3300048921 Ga0496118_0245900 Ga0496118_0245900_353_781 140
35 3300048922 Ga0496119_0045428 Ga0496119_0045428_1733_2161 140
36 3300048923 Ga0496120_0001229 Ga0496120_0001229_4324_4752 140
37 3300048924 Ga0496121_0088796 Ga0496121_0088796_811_1239 140
38 3300048924 Ga0496121_0326338 Ga0496121_0326338_276_704 140
39 3300048924 Ga0496121_0343145 Ga0496121_0343145_203_631 140
40 3300048928 Ga0496125_0047244 Ga0496125_0047244_1152_1580 140
41 3300049581 Ga0501047_0045401 Ga0501047_0045401_373_810 140
42 3300049742 Ga0501080_0388605 Ga0501080_0388605_415_852 140
43 3300049744 Ga0501083_0062538 Ga0501083_0062538_906_1343 140
44 3300049823 Ga0501044_0026937 Ga0501044_0026937_4373_4810 140
45 3300050490 nmdc:mga03n38_480436_c1 nmdc:mga03n38_480436_c1_129_569 140
46 3300050491 nmdc:mga00v17_514769_c1 nmdc:mga00v17_514769_c1_145_585 140
47 3300050494 nmdc:mga06z11_493886_c1 nmdc:mga06z11_493886_c1_20_460 140
48 3300050495 nmdc:mga04h51_278900_c1 nmdc:mga04h51_278900_c1_149_589 140
49 3300053119 Ga0500595_098392 Ga0500595_098392_364_792 140
50 3300060353 Ga0501082_0325662 Ga0501082_0325662_535_972 140
51 iso_pu_bacteria 2887478801 2887479326 141
52 3300048914 Ga0496111_0417849 Ga0496111_0417849_548_979 142
53 3300049539 Ga0501323_018117 Ga0501323_018117_47_502 142
54 iso_pu_bacteria 2643221694 2644526264 142
55 iso_pu_bacteria 2643221722 2644670939 142
56 iso_pu_bacteria 2738541272 2738696821 142
57 iso_pu_bacteria 2738543027 2739324562 142
58 3300005338 Ga0068868_100700743 Ga0068868_1007007431 143
59 3300005344 Ga0070661_101670503 Ga0070661_1016705031 143
60 3300005356 Ga0070674_100241333 Ga0070674_1002413331 143
61 3300005441 Ga0070700_100005815 Ga0070700_1000058154 143
62 3300005535 Ga0070684_101251596 Ga0070684_1012515961 143
63 3300005564 Ga0070664_100398032 Ga0070664_1003980322 143
64 3300005719 Ga0068861_100204140 Ga0068861_1002041402 143
65 3300005937 Ga0081455_10435335 Ga0081455_104353352 143
66 3300006038 Ga0075365_10005647 Ga0075365_100056476 143
67 3300006051 Ga0075364_10191501 Ga0075364_101915012 143
68 3300006051 Ga0075364_10594241 Ga0075364_105942411 143
69 3300009148 Ga0105243_10146478 Ga0105243_101464783 143
70 3300025938 Ga0207704_11158562 Ga0207704_111585622 143
71 3300025981 Ga0207640_10630417 Ga0207640_106304172 143
72 3300026075 Ga0207708_10029533 Ga0207708_100295332 143
73 3300026089 Ga0207648_10739522 Ga0207648_107395221 143
74 3300026118 Ga0207675_100170616 Ga0207675_1001706162 143
75 3300026121 Ga0207683_10219591 Ga0207683_102195913 143
76 3300031727 Ga0316576_10091199 Ga0316576_100911993 143
77 3300031727 Ga0316576_10299331 Ga0316576_102993311 143
78 3300031852 Ga0307410_10514682 Ga0307410_105146821 143
79 3300032139 Ga0316580_10185442 Ga0316580_101854421 143
80 3300036712 Ga0316584_0033204 Ga0316584_0033204_2389_2823 143
81 3300050492 nmdc:mga0yw44_245950_c1 nmdc:mga0yw44_245950_c1_572_1012 143
82 iso_pu_bacteria 2643221690 2644503943 143
83 3300005614 Ga0068856_101922941 Ga0068856_1019229411 144
84 3300005618 Ga0068864_101379681 Ga0068864_1013796811 144
85 3300009094 Ga0111539_11074348 Ga0111539_110743482 144
86 3300014325 Ga0163163_10309627 Ga0163163_103096273 144
87 3300020070 Ga0206356_10291529 Ga0206356_102915292 144
88 3300020080 Ga0206350_10812950 Ga0206350_108129502 144
89 3300026067 Ga0207678_10248902 Ga0207678_102489023 144
90 3300026095 Ga0207676_11885418 Ga0207676_118854181 144
91 3300031548 Ga0307408_100606077 Ga0307408_1006060772 144
92 3300031824 Ga0307413_10113827 Ga0307413_101138274 144
93 3300031852 Ga0307410_10156630 Ga0307410_101566302 144
94 3300031901 Ga0307406_10230170 Ga0307406_102301702 144
95 3300031903 Ga0307407_10254815 Ga0307407_102548151 144
96 3300031911 Ga0307412_10789726 Ga0307412_107897262 144
97 3300031995 Ga0307409_100026000 Ga0307409_1000260003 144
98 3300032002 Ga0307416_100665273 Ga0307416_1006652732 144
99 3300032004 Ga0307414_10399044 Ga0307414_103990443 144
100 3300032005 Ga0307411_10534506 Ga0307411_105345062 144
101 3300032126 Ga0307415_100568749 Ga0307415_1005687492 144
102 3300046513 Ga0495616_0305598 Ga0495616_0305598_174_641 144
103 3300046674 Ga0495588_0341478 Ga0495588_0341478_125_571 144
104 3300048911 Ga0496108_0163050 Ga0496108_0163050_301_738 144
105 3300048912 Ga0496109_0115323 Ga0496109_0115323_12_449 144
106 3300048915 Ga0496112_0042887 Ga0496112_0042887_3449_3886 144
107 3300048916 Ga0496113_0238771 Ga0496113_0238771_642_1079 144
108 3300048917 Ga0496114_1655655 Ga0496114_1655655_63_506 144
109 3300048923 Ga0496120_0344435 Ga0496120_0344435_78_533 144
110 3300049571 Ga0501034_0269961 Ga0501034_0269961_241_675 144
111 3300049581 Ga0501047_0333169 Ga0501047_0333169_363_800 144
112 3300049744 Ga0501083_0079138 Ga0501083_0079138_1413_1850 144
113 3300006051 Ga0075364_10863728 Ga0075364_108637281 145
114 3300014325 Ga0163163_11094882 Ga0163163_110948822 145
115 3300020075 Ga0206349_1967475 Ga0206349_19674751 145
116 3300046513 Ga0495616_0401903 Ga0495616_0401903_85_525 145
117 3300047472 Ga0495686_0004478 Ga0495686_0004478_5591_6031 145
118 3300048911 Ga0496108_1159403 Ga0496108_1159403_38_478 145
119 3300048913 Ga0496110_0911940 Ga0496110_0911940_292_732 145
120 3300049571 Ga0501034_0008714 Ga0501034_0008714_5944_6384 145
121 3300050490 nmdc:mga03n38_235408_c1 nmdc:mga03n38_235408_c1_481_918 145
122 3300005356 Ga0070674_100810272 Ga0070674_1008102722 146
123 3300005365 Ga0070688_101192470 Ga0070688_1011924701 146
124 3300005535 Ga0070684_101526204 Ga0070684_1015262041 146
125 3300005985 Ga0081539_10001832 Ga0081539_1000183212 146
126 3300006844 Ga0075428_100281608 Ga0075428_1002816082 146
127 3300006847 Ga0075431_100013833 Ga0075431_1000138337 146
128 3300006847 Ga0075431_101021433 Ga0075431_1010214332 146
129 3300009094 Ga0111539_10786352 Ga0111539_107863521 146
130 3300009094 Ga0111539_13160272 Ga0111539_131602721 146
131 3300013308 Ga0157375_10385949 Ga0157375_103859493 146
132 3300014497 Ga0182008_10092238 Ga0182008_100922382 146
133 3300031548 Ga0307408_100378549 Ga0307408_1003785492 146
134 3300031731 Ga0307405_10379237 Ga0307405_103792372 146
135 3300031731 Ga0307405_10625433 Ga0307405_106254331 146
136 3300031824 Ga0307413_10529442 Ga0307413_105294422 146
137 3300031824 Ga0307413_11513957 Ga0307413_115139572 146
138 3300031852 Ga0307410_10100719 Ga0307410_101007195 146
139 3300031852 Ga0307410_10176366 Ga0307410_101763662 146
140 3300031852 Ga0307410_10538195 Ga0307410_105381952 146
141 3300031901 Ga0307406_10026568 Ga0307406_100265681 146
142 3300031901 Ga0307406_10082604 Ga0307406_100826043 146
143 3300031903 Ga0307407_10244771 Ga0307407_102447712 146
144 3300031903 Ga0307407_10632486 Ga0307407_106324861 146
145 3300031911 Ga0307412_10079202 Ga0307412_100792021 146
146 3300031911 Ga0307412_10609547 Ga0307412_106095471 146
147 3300031995 Ga0307409_100128329 Ga0307409_1001283293 146
148 3300031995 Ga0307409_100219818 Ga0307409_1002198182 146
149 3300031995 Ga0307409_100359367 Ga0307409_1003593672 146
150 3300031995 Ga0307409_101309078 Ga0307409_1013090782 146
151 3300032002 Ga0307416_100090707 Ga0307416_1000907073 146
152 3300032002 Ga0307416_100097892 Ga0307416_1000978925 146
153 3300032002 Ga0307416_100767673 Ga0307416_1007676732 146
154 3300032004 Ga0307414_10475478 Ga0307414_104754782 146
155 3300032004 Ga0307414_10522387 Ga0307414_105223872 146
156 3300032126 Ga0307415_100102813 Ga0307415_1001028133 146
157 3300032126 Ga0307415_100429236 Ga0307415_1004292362 146
158 3300032126 Ga0307415_100864131 Ga0307415_1008641312 146
159 3300041494 Ga0451837_1856688 Ga0451837_1856688_1107_1589 146
160 3300046461 Ga0495641_0253778 Ga0495641_0253778_278_721 146
161 3300046533 Ga0495640_0029305 Ga0495640_0029305_1770_2213 146
162 3300046642 Ga0495634_0017000 Ga0495634_0017000_2448_2891 146
163 3300046681 Ga0495647_0000046 Ga0495647_0000046_14513_14956 146
164 3300047322 Ga0495680_0661492 Ga0495680_0661492_223_666 146
165 3300047471 Ga0495684_0523798 Ga0495684_0523798_292_741 146
166 3300048905 Ga0496102_0509511 Ga0496102_0509511_304_747 146
167 3300049568 Ga0501031_0021612 Ga0501031_0021612_1823_2272 146
168 3300049570 Ga0501033_0898999 Ga0501033_0898999_45_494 146
169 3300049572 Ga0501036_0269542 Ga0501036_0269542_793_1242 146
170 3300049573 Ga0501037_0269345 Ga0501037_0269345_720_1169 146
171 3300049574 Ga0501038_0124161 Ga0501038_0124161_879_1328 146
172 3300049575 Ga0501039_0003946 Ga0501039_0003946_5401_5850 146
173 3300049576 Ga0501040_0130053 Ga0501040_0130053_371_823 146
174 3300049579 Ga0501043_0254237 Ga0501043_0254237_622_1071 146
175 3300049587 Ga0501071_0096016 Ga0501071_0096016_592_1041 146
176 3300049588 Ga0501072_0234854 Ga0501072_0234854_890_1339 146
177 3300049591 Ga0501075_0028261 Ga0501075_0028261_806_1255 146
178 3300050510 nmdc:mga06r32_7046_c1 nmdc:mga06r32_7046_c1_2352_2792 146
179 3300050510 nmdc:mga06r32_795291_c1 nmdc:mga06r32_795291_c1_95_538 146
180 3300050511 nmdc:mga08y16_493091_c1 nmdc:mga08y16_493091_c1_749_1195 146
181 3300053083 Ga0495655_0053200 Ga0495655_0053200_531_1031 146
182 3300054114 Ga0501084_0057954 Ga0501084_0057954_1122_1571 146
183 3300005530 Ga0070679_100287170 Ga0070679_1002871703 147
184 3300005618 Ga0068864_101356253 Ga0068864_1013562532 147
185 3300006914 Ga0075436_100063224 Ga0075436_1000632242 147
186 3300009092 Ga0105250_10129507 Ga0105250_101295072 147
187 3300013296 Ga0157374_10114156 Ga0157374_101141563 147
188 3300014325 Ga0163163_10384645 Ga0163163_103846452 147
189 3300020081 Ga0206354_10784667 Ga0206354_107846671 147
190 3300026067 Ga0207678_10238720 Ga0207678_102387202 147
191 3300031852 Ga0307410_10414340 Ga0307410_104143402 147
192 3300031995 Ga0307409_100328598 Ga0307409_1003285982 147
193 3300035692 Ga0373935_0009190 Ga0373935_0009190_4921_5367 147
194 3300037312 Ga0395899_0091381 Ga0395899_0091381_264_725 147
195 3300037418 Ga0395900_0037421 Ga0395900_0037421_3069_3530 147
196 3300037466 Ga0395898_0011821 Ga0395898_0011821_6448_6909 147
197 3300037471 Ga0395905_0032745 Ga0395905_0032745_3448_3909 147
198 3300038443 Ga0395901_0005278 Ga0395901_0005278_10809_11270 147
199 3300046471 Ga0495650_0000079 Ga0495650_0000079_224149_224595 147
200 3300048907 Ga0496104_0092675 Ga0496104_0092675_2041_2508 147
201 3300048911 Ga0496108_0144153 Ga0496108_0144153_414_881 147
202 3300048912 Ga0496109_0062833 Ga0496109_0062833_650_1117 147
203 3300048913 Ga0496110_0010408 Ga0496110_0010408_5522_5989 147
204 3300048916 Ga0496113_0074344 Ga0496113_0074344_1571_2038 147
205 3300049582 Ga0501048_0176737 Ga0501048_0176737_745_1191 147
206 3300049593 Ga0501077_0578774 Ga0501077_0578774_223_699 147
207 3300049824 Ga0501045_0264519 Ga0501045_0264519_128_580 147
208 3300053104 Ga0500556_0001141 Ga0500556_0001141_12350_12799 147
209 3300053153 Ga0500616_0002554 Ga0500616_0002554_9551_10000 147
210 3300053153 Ga0500616_0177070 Ga0500616_0177070_441_887 147
211 3300060353 Ga0501082_2008483 Ga0501082_2008483_41_487 147
212 3300009094 Ga0111539_10969215 Ga0111539_109692152 148
213 3300031903 Ga0307407_11231339 Ga0307407_112313391 148
214 3300036401 Ga0373937_0231360 Ga0373937_0231360_187_705 148
215 3300041413 Ga0439465_0259323 Ga0439465_0259323_77_535 148
216 3300046559 Ga0495667_0262816 Ga0495667_0262816_150_668 148
217 3300049576 Ga0501040_0337773 Ga0501040_0337773_50_511 148
218 3300049582 Ga0501048_0288235 Ga0501048_0288235_341_802 148
219 3300049587 Ga0501071_1019568 Ga0501071_1019568_122_583 148
220 3300049588 Ga0501072_0182832 Ga0501072_0182832_482_943 148
221 3300049591 Ga0501075_0557360 Ga0501075_0557360_395_856 148
222 3300049592 Ga0501076_0115106 Ga0501076_0115106_19_480 148
223 3300049592 Ga0501076_0411862 Ga0501076_0411862_647_1102 148
224 3300053085 Ga0495619_0459615 Ga0495619_0459615_304_822 148
225 3300054114 Ga0501084_0204114 Ga0501084_0204114_626_1087 148
226 3300005338 Ga0068868_100286270 Ga0068868_1002862702 149
227 3300005577 Ga0068857_100886033 Ga0068857_1008860332 149
228 3300011119 Ga0105246_11506175 Ga0105246_115061752 149
229 3300025937 Ga0207669_10237140 Ga0207669_102371402 149
230 3300026116 Ga0207674_10637078 Ga0207674_106370782 149
231 3300031456 Ga0307513_10320977 Ga0307513_103209771 149
232 3300031995 Ga0307409_101229564 Ga0307409_1012295641 149
233 3300032126 Ga0307415_100090479 Ga0307415_1000904794 149
234 3300046531 Ga0495665_0203364 Ga0495665_0203364_234_701 149
235 3300048904 Ga0496101_0170029 Ga0496101_0170029_614_1093 149
236 3300049575 Ga0501039_0013406 Ga0501039_0013406_1828_2280 149
237 3300049578 Ga0501042_0178863 Ga0501042_0178863_720_1172 149
238 3300049580 Ga0501046_0829967 Ga0501046_0829967_122_574 149
239 3300049592 Ga0501076_0665142 Ga0501076_0665142_326_778 149
240 3300049824 Ga0501045_0041505 Ga0501045_0041505_2356_2808 149
241 iso_pu_bacteria 2622736605 2623500137 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19850

DUF6325

Family of unknown function (DUF6325)

31

170

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gs0-assembly2.cif.gz_L crystal structure of the complex of tlr3 and bi-specific diabody 0.6107 38 59
1iyj-assembly2.cif.gz_D structure of a brca2-dss1 complex 0.605 40 68
1y7p-assembly2.cif.gz_B 1.9 a crystal structure of a protein of unknown function af1403 from archaeoglobus fulgidus, probable metabolic regulator 0.5965 10 120
3lou-assembly1.cif.gz_B crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.5851 10 121
1miu-assembly1.cif.gz_A structure of a brca2-dss1 complex 0.5704 41 77
ID Description Score Start End Superfamily
3zjvA04 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.6735 45 63 2.20.28.290
5eb9A00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6356 41 59 2.60.40.10
1iyjD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.605 40 68 2.40.50.140
af_Q4DNW3_439_1030_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6011 9 59 2.40.50.140
af_E9AHB1_473_560_2.60.40.1910 Mainly Beta;Sandwich;Immunoglobulin-like; 0.5951 41 59 2.60.40.1910
ID Description Score Start End GO Terms
AF-A0A2U1EDB8-F1-model_v4 Putative hydrophobic protein (TIGR00271 family) 0.937 6 142 GO:0016020
AF-A0A0F4ISE6-F1-model_v4 EF-hand domain-containing protein 0.9204 8 87
AF-K4QWD9-F1-model_v4 DUF1269 domain-containing protein 0.9058 2 144
AF-A0A853A5B7-F1-model_v4 deleted 0.9052 7 147
AF-A0A0F4ISE6-F1-model_v4 EF-hand domain-containing protein 0.8996 8 87

Feature Viewer

pLDDT pTM Quality
87.07 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map