F353906

General Info

Members Datasets Scaffolds Average Seq Length
241 184 482 310

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10013149|Ga0307516_100131498
Length 327
Sequence MVNERGGRKAALVCGSVAYDTILVFPDRFKSHLLPDKLHMLNVSFLVPEMRREFGGCAANIAYGLNLLGDLGLAMAAAGHDFAPYRERMVSKGIPVDYIKVIDETFTAQAFITTDLDDNQITAFHPGAMQYAHLNRVADAAGQGAVGRQGTEFDVVLGIVAPDGRQAMIEHAAQFKDAGIPFIFDPGQGLPMFGGEELARFIDQATWVAVNDYEWQMLQQKTGLTAAQVAEKVEALIVTRGAEGSIIYTKERTLTVPAVAPRAVVDPTGCGDAYRAGLIHGLLRGLDWETTGRIASLMGSIKIESRGPQNHDFTKAEFDRRYQDHFG

Samples

Sample ID Description Type Environment
1 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
81 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.07
Nodule 0
Rhizoplane 7.05
Rhizosphere 81.74
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307516_10013149 3300031730 Bacteria 8843
2 JGI24735J21928_10054168 3300002067 Bacteria 1156
3 JGI25406J46586_10016823 3300003203 Bacteria 3037
4 Ga0065707_10082066 3300005295 Bacteria 23099
5 Ga0070658_10046462 3300005327 Bacteria 3513
6 Ga0070676_10051231 3300005328 Bacteria 2423
7 Ga0070683_100000447 3300005329 Bacteria 28768
8 Ga0070683_100387015 3300005329 Bacteria 1333
9 Ga0070690_100050955 3300005330 Bacteria 2641
10 Ga0070670_100001931 3300005331 Bacteria 16973
11 Ga0068869_100171862 3300005334 Bacteria 1693
12 Ga0068869_100304651 3300005334 Bacteria 1287
13 Ga0070666_10036676 3300005335 Bacteria 3256
14 Ga0068868_100001015 3300005338 Bacteria 19169
15 Ga0068868_100271215 3300005338 Bacteria 1433
16 Ga0070660_100137502 3300005339 Bacteria 1958
17 Ga0070661_100000366 3300005344 Bacteria 35667
18 Ga0070675_100000296 3300005354 Bacteria 33297
19 Ga0070671_100000724 3300005355 Bacteria 23620
20 Ga0070671_100001203 3300005355 Bacteria 19368
21 Ga0070674_100040151 3300005356 Bacteria 3164
22 Ga0070673_100000095 3300005364 Bacteria 39351
23 Ga0070688_100203765 3300005365 Bacteria 1385
24 Ga0070667_100051027 3300005367 Bacteria 3487
25 Ga0070667_100152854 3300005367 Bacteria 2028
26 Ga0070709_10171442 3300005434 Bacteria 1516
27 Ga0070709_10188802 3300005434 Bacteria 1452
28 Ga0070714_100002342 3300005435 Bacteria 13933
29 Ga0070713_100002897 3300005436 Bacteria 11226
30 Ga0070711_100026982 3300005439 Bacteria 3767
31 Ga0070711_100156450 3300005439 Bacteria 1724
32 Ga0070700_100114456 3300005441 Bacteria 1798
33 Ga0070678_100000184 3300005456 Bacteria 27334
34 Ga0070678_100201949 3300005456 Bacteria 1641
35 Ga0070662_100136439 3300005457 Bacteria 1897
36 Ga0068867_100002439 3300005459 Bacteria 13068
37 Ga0068867_100170000 3300005459 Bacteria 1725
38 Ga0070685_10008470 3300005466 Bacteria 5287
39 Ga0070706_100124223 3300005467 Bacteria 2406
40 Ga0070684_100006035 3300005535 Bacteria 9334
41 Ga0068853_100598194 3300005539 Bacteria 1047
42 Ga0070672_100000230 3300005543 Bacteria 31233
43 Ga0070686_100029635 3300005544 Bacteria 3331
44 Ga0070695_100006403 3300005545 Bacteria 6959
45 Ga0070696_100029675 3300005546 Bacteria 3740
46 Ga0070696_100188442 3300005546 Bacteria 1534
47 Ga0070665_100001541 3300005548 Bacteria 26625
48 Ga0070665_100021477 3300005548 Bacteria 6492
49 Ga0070665_100046342 3300005548 Bacteria 4368
50 Ga0070665_100066241 3300005548 Bacteria 3623
51 Ga0070664_100000172 3300005564 Bacteria 45323
52 Ga0070664_100081772 3300005564 Bacteria 2784
53 Ga0068854_100002365 3300005578 Bacteria 11628
54 Ga0070702_100007611 3300005615 Bacteria 5191
55 Ga0068852_100001180 3300005616 Bacteria 17310
56 Ga0068859_100001570 3300005617 Bacteria 23292
57 Ga0068859_100295268 3300005617 Bacteria 1714
58 Ga0068864_100001436 3300005618 Bacteria 19650
59 Ga0068864_100203122 3300005618 Bacteria 1821
60 Ga0068866_10011925 3300005718 Bacteria 3776
61 Ga0068851_10000892 3300005834 Bacteria 12882
62 Ga0068863_100040403 3300005841 Bacteria 4435
63 Ga0068863_100339967 3300005841 Bacteria 1460
64 Ga0068858_100005606 3300005842 Bacteria 12275
65 Ga0068858_100403609 3300005842 Bacteria 1313
66 Ga0068860_100008738 3300005843 Bacteria 10087
67 Ga0081455_10000075 3300005937 Bacteria 106313
68 Ga0081539_10000045 3300005985 Bacteria 277027
69 Ga0070717_10045151 3300006028 Bacteria 3602
70 Ga0070712_100332782 3300006175 Bacteria 1238
71 Ga0097621_100000958 3300006237 Bacteria 20242
72 Ga0068871_100000297 3300006358 Bacteria 34596
73 Ga0075428_100002781 3300006844 Bacteria 19061
74 Ga0075428_100073032 3300006844 Bacteria 3746
75 Ga0075430_100020733 3300006846 Bacteria 5591
76 Ga0068865_100097689 3300006881 Bacteria 2144
77 Ga0097620_100001570 3300006931 Bacteria 23292
78 Ga0097620_100295262 3300006931 Bacteria 1714
79 Ga0099794_10062337 3300007265 Bacteria 1813
80 Ga0099795_10000307 3300007788 Bacteria 8831
81 Ga0105240_10030142 3300009093 Bacteria 7056
82 Ga0105240_10219381 3300009093 Bacteria 2217
83 Ga0105240_10264886 3300009093 Bacteria 1981
84 Ga0105240_10392287 3300009093 Bacteria 1565
85 Ga0105247_10003305 3300009101 Bacteria 10563
86 Ga0105247_10197783 3300009101 Bacteria 1349
87 Ga0105242_10525075 3300009176 Bacteria 1130
88 Ga0105248_10008148 3300009177 Bacteria 11507
89 Ga0105248_10079204 3300009177 Bacteria 3692
90 Ga0105237_10107222 3300009545 Bacteria 2785
91 Ga0105238_10247472 3300009551 Bacteria 1760
92 Ga0105249_10040217 3300009553 Bacteria 4246
93 Ga0099796_10003639 3300010159 Bacteria 3609
94 Ga0105246_10409674 3300011119 Bacteria 1128
95 Ga0157370_10380902 3300013104 Bacteria 1299
96 Ga0157374_10000531 3300013296 Bacteria 34119
97 Ga0157374_10164192 3300013296 Bacteria 2164
98 Ga0157378_10003226 3300013297 Bacteria 14510
99 Ga0163162_10004676 3300013306 Bacteria 13203
100 Ga0163162_10031932 3300013306 Bacteria 5226
101 Ga0157375_10000588 3300013308 Bacteria 32287
102 Ga0163163_10014723 3300014325 Bacteria 7196
103 Ga0157377_10082009 3300014745 Bacteria 1887
104 Ga0157379_10092287 3300014968 Bacteria 2716
105 Ga0157376_10189894 3300014969 Bacteria 1883
106 Ga0163161_10069736 3300017792 Bacteria 2570
107 Ga0163161_10146112 3300017792 Bacteria 1794
108 Ga0213874_10063644 3300021377 Bacteria 1161
109 Ga0228598_1006167 3300024227 Bacteria 2485
110 Ga0207656_10000672 3300025321 Bacteria 11208
111 Ga0207642_10074331 3300025899 Bacteria 1628
112 Ga0207710_10000305 3300025900 Bacteria 38961
113 Ga0207680_10038501 3300025903 Bacteria 2768
114 Ga0207699_10002621 3300025906 Bacteria 8496
115 Ga0207645_10006565 3300025907 Bacteria 8322
116 Ga0207645_10103528 3300025907 Bacteria 1838
117 Ga0207707_10001982 3300025912 Bacteria 18598
118 Ga0207663_10345884 3300025916 Bacteria 1124
119 Ga0207662_10007962 3300025918 Bacteria 5775
120 Ga0207657_10148470 3300025919 Bacteria 1911
121 Ga0207649_10002695 3300025920 Bacteria 9841
122 Ga0207694_10386847 3300025924 Bacteria 1162
123 Ga0207650_10000698 3300025925 Bacteria 26244
124 Ga0207659_10001270 3300025926 Bacteria 15120
125 Ga0207700_10049126 3300025928 Bacteria 3137
126 Ga0207664_10029868 3300025929 Bacteria 4157
127 Ga0207644_10005694 3300025931 Bacteria 8111
128 Ga0207644_10012175 3300025931 Bacteria 5708
129 Ga0207644_10012832 3300025931 Bacteria 5572
130 Ga0207706_10085036 3300025933 Bacteria 2781
131 Ga0207706_10162720 3300025933 Bacteria 1961
132 Ga0207686_10180535 3300025934 Bacteria 1496
133 Ga0207709_10033312 3300025935 Bacteria 3024
134 Ga0207669_10091456 3300025937 Bacteria 1982
135 Ga0207691_10000530 3300025940 Bacteria 38079
136 Ga0207691_10070525 3300025940 Bacteria 3155
137 Ga0207689_10418507 3300025942 Bacteria 1118
138 Ga0207661_10000573 3300025944 Bacteria 23479
139 Ga0207679_10001715 3300025945 Bacteria 13650
140 Ga0207651_10000663 3300025960 Bacteria 14679
141 Ga0207712_10155142 3300025961 Bacteria 1773
142 Ga0207640_10010705 3300025981 Bacteria 5174
143 Ga0207658_10011059 3300025986 Bacteria 6145
144 Ga0207658_10161803 3300025986 Bacteria 1835
145 Ga0207677_10000490 3300026023 Bacteria 25685
146 Ga0207677_10022086 3300026023 Bacteria 3903
147 Ga0207677_10241459 3300026023 Bacteria 1462
148 Ga0207703_10017693 3300026035 Bacteria 5565
149 Ga0207639_10130054 3300026041 Bacteria 2083
150 Ga0207708_10055244 3300026075 Bacteria 3027
151 Ga0207641_10025838 3300026088 Bacteria 4843
152 Ga0207641_10048248 3300026088 Bacteria 3594
153 Ga0207648_10048748 3300026089 Bacteria 3708
154 Ga0207676_10018547 3300026095 Bacteria 5060
155 Ga0207676_10061219 3300026095 Bacteria 2980
156 Ga0207676_10187858 3300026095 Bacteria 1815
157 Ga0207674_10021761 3300026116 Bacteria 6900
158 Ga0207675_100022640 3300026118 Bacteria 5848
159 Ga0207675_100285613 3300026118 Bacteria 1604
160 Ga0207683_10001233 3300026121 Bacteria 23243
161 Ga0207683_10149448 3300026121 Bacteria 2108
162 Ga0207698_10012522 3300026142 Bacteria 5556
163 Ga0209588_1071683 3300027671 Bacteria 1119
164 Ga0265354_1002464 3300028016 Bacteria 2281
165 Ga0268266_10000512 3300028379 Bacteria 54629
166 Ga0268266_10000572 3300028379 Bacteria 50809
167 Ga0268264_10014096 3300028381 Bacteria 6572
168 Ga0268264_10501416 3300028381 Bacteria 1184
169 Ga0265338_10305988 3300028800 Bacteria 1154
170 Ga0265762_1013084 3300030760 Bacteria 1493
171 Ga0265770_1000206 3300030878 Bacteria 7841
172 Ga0307513_10008401 3300031456 Bacteria 13219
173 Ga0307509_10004109 3300031507 Bacteria 21308
174 Ga0307407_10259176 3300031903 Bacteria 1195
175 Ga0307411_10146080 3300032005 Bacteria 1751
176 Ga0307510_10000003 3300033180 Bacteria 756654
177 Ga0373936_0007597 3300035113 Bacteria 4075
178 Ga0373955_0108738 3300035172 Bacteria 1601
179 Ga0373924_0128135 3300035410 Bacteria 1104
180 Ga0373933_0048426 3300035724 Bacteria 2531
181 Ga0373933_0282411 3300035724 Bacteria 1073
182 Ga0373937_0018523 3300036401 Bacteria 6220
183 Ga0316582_0157382 3300036647 Bacteria 1538
184 Ga0395898_0209328 3300037466 Bacteria 1860
185 Ga0436365_1056344 3300039437 Bacteria 1137
186 Ga0436365_1088570 3300039437 Bacteria 5113
187 Ga0436360_0140670 3300039438 Bacteria 1794
188 Ga0436361_1127270 3300039447 Bacteria 1209
189 Ga0436363_1661953 3300039450 Bacteria 3974
190 Ga0436362_0323630 3300039453 Bacteria 4241
191 Ga0436362_1120880 3300039453 Bacteria 1128
192 Ga0451577_0036082 3300042876 Bacteria 4452
193 Ga0466972_0022475 3300044658 Bacteria 3141
194 Ga0466966_0118444 3300044684 Bacteria 1628
195 Ga0453684_0090105 3300044712 Unclassified 3790
196 Ga0466968_0063553 3300044735 Bacteria 1596
197 Ga0451576_0051045 3300045051 Bacteria 4337
198 Ga0495603_0203436 3300046455 Bacteria 1144
199 Ga0495650_0025001 3300046471 Bacteria 2810
200 Ga0495580_0073161 3300046472 Bacteria 2393
201 Ga0495580_0281022 3300046472 Bacteria 1135
202 Ga0495587_0033439 3300046536 Bacteria 3105
203 Ga0495623_0123298 3300046679 Bacteria 1558
204 Ga0495613_0308529 3300046689 Bacteria 1094
205 Ga0495671_0053336 3300046692 Bacteria 2007
206 Ga0496101_0060235 3300048904 Bacteria 2754
207 Ga0496101_0115385 3300048904 Bacteria 2025
208 Ga0496102_0002343 3300048905 Bacteria 16159
209 Ga0496102_0007225 3300048905 Bacteria 9480
210 Ga0496103_0127637 3300048906 Bacteria 1622
211 Ga0496104_0602817 3300048907 Bacteria 1008
212 Ga0496107_0040622 3300048910 Bacteria 3339
213 Ga0496108_0001128 3300048911 Bacteria 20893
214 Ga0496109_0010127 3300048912 Bacteria 8044
215 Ga0496109_0465840 3300048912 Bacteria 1193
216 Ga0496110_0001483 3300048913 Bacteria 17008
217 Ga0496111_0054360 3300048914 Bacteria 2894
218 Ga0496112_0001690 3300048915 Bacteria 17198
219 Ga0496112_0031904 3300048915 Bacteria 5113
220 Ga0496113_0093604 3300048916 Bacteria 2320
221 Ga0496114_0007388 3300048917 Bacteria 8682
222 Ga0496115_0018842 3300048918 Bacteria 5306
223 Ga0496116_0021210 3300048919 Bacteria 4906
224 Ga0496117_0000095 3300048920 Bacteria 198731
225 Ga0496118_0000003 3300048921 Bacteria 773148
226 Ga0496118_0062765 3300048921 Bacteria 2739
227 Ga0496119_0006933 3300048922 Bacteria 10334
228 Ga0496119_0020385 3300048922 Bacteria 4839
229 Ga0496120_0000693 3300048923 Bacteria 49436
230 Ga0496121_0002744 3300048924 Bacteria 26189
231 Ga0496121_0097606 3300048924 Bacteria 2276
232 Ga0496124_0041466 3300048927 Bacteria 3971
233 Ga0496125_0011101 3300048928 Bacteria 9036
234 Ga0496126_0003350 3300048929 Bacteria 20338
235 Ga0496126_0018083 3300048929 Bacteria 7000
236 Ga0496126_0279118 3300048929 Bacteria 1384
237 nmdc:mga0k408_199141_c1 3300050493 Bacteria 1195
238 Ga0500556_0001489 3300053104 Bacteria 9718
239 Ga0500616_0000030 3300053153 Bacteria 415224
240 Ga0500616_0010537 3300053153 Bacteria 5524
241 Ga0500639_053560 3300053163 Bacteria 2099
242 Ga0307516_10013149
243 JGI24735J21928_10054168
244 JGI25406J46586_10016823
245 Ga0065707_10082066
246 Ga0070658_10046462
247 Ga0070676_10051231
248 Ga0070683_100000447
249 Ga0070683_100387015
250 Ga0070690_100050955
251 Ga0070670_100001931
252 Ga0068869_100171862
253 Ga0068869_100304651
254 Ga0070666_10036676
255 Ga0068868_100001015
256 Ga0068868_100271215
257 Ga0070660_100137502
258 Ga0070661_100000366
259 Ga0070675_100000296
260 Ga0070671_100000724
261 Ga0070671_100001203
262 Ga0070674_100040151
263 Ga0070673_100000095
264 Ga0070688_100203765
265 Ga0070667_100051027
266 Ga0070667_100152854
267 Ga0070709_10171442
268 Ga0070709_10188802
269 Ga0070714_100002342
270 Ga0070713_100002897
271 Ga0070711_100026982
272 Ga0070711_100156450
273 Ga0070700_100114456
274 Ga0070678_100000184
275 Ga0070678_100201949
276 Ga0070662_100136439
277 Ga0068867_100002439
278 Ga0068867_100170000
279 Ga0070685_10008470
280 Ga0070706_100124223
281 Ga0070684_100006035
282 Ga0068853_100598194
283 Ga0070672_100000230
284 Ga0070686_100029635
285 Ga0070695_100006403
286 Ga0070696_100029675
287 Ga0070696_100188442
288 Ga0070665_100001541
289 Ga0070665_100021477
290 Ga0070665_100046342
291 Ga0070665_100066241
292 Ga0070664_100000172
293 Ga0070664_100081772
294 Ga0068854_100002365
295 Ga0070702_100007611
296 Ga0068852_100001180
297 Ga0068859_100001570
298 Ga0068859_100295268
299 Ga0068864_100001436
300 Ga0068864_100203122
301 Ga0068866_10011925
302 Ga0068851_10000892
303 Ga0068863_100040403
304 Ga0068863_100339967
305 Ga0068858_100005606
306 Ga0068858_100403609
307 Ga0068860_100008738
308 Ga0081455_10000075
309 Ga0081539_10000045
310 Ga0070717_10045151
311 Ga0070712_100332782
312 Ga0097621_100000958
313 Ga0068871_100000297
314 Ga0075428_100002781
315 Ga0075428_100073032
316 Ga0075430_100020733
317 Ga0068865_100097689
318 Ga0097620_100001570
319 Ga0097620_100295262
320 Ga0099794_10062337
321 Ga0099795_10000307
322 Ga0105240_10030142
323 Ga0105240_10219381
324 Ga0105240_10264886
325 Ga0105240_10392287
326 Ga0105247_10003305
327 Ga0105247_10197783
328 Ga0105242_10525075
329 Ga0105248_10008148
330 Ga0105248_10079204
331 Ga0105237_10107222
332 Ga0105238_10247472
333 Ga0105249_10040217
334 Ga0099796_10003639
335 Ga0105246_10409674
336 Ga0157370_10380902
337 Ga0157374_10000531
338 Ga0157374_10164192
339 Ga0157378_10003226
340 Ga0163162_10004676
341 Ga0163162_10031932
342 Ga0157375_10000588
343 Ga0163163_10014723
344 Ga0157377_10082009
345 Ga0157379_10092287
346 Ga0157376_10189894
347 Ga0163161_10069736
348 Ga0163161_10146112
349 Ga0213874_10063644
350 Ga0228598_1006167
351 Ga0207656_10000672
352 Ga0207642_10074331
353 Ga0207710_10000305
354 Ga0207680_10038501
355 Ga0207699_10002621
356 Ga0207645_10006565
357 Ga0207645_10103528
358 Ga0207707_10001982
359 Ga0207663_10345884
360 Ga0207662_10007962
361 Ga0207657_10148470
362 Ga0207649_10002695
363 Ga0207694_10386847
364 Ga0207650_10000698
365 Ga0207659_10001270
366 Ga0207700_10049126
367 Ga0207664_10029868
368 Ga0207644_10005694
369 Ga0207644_10012175
370 Ga0207644_10012832
371 Ga0207706_10085036
372 Ga0207706_10162720
373 Ga0207686_10180535
374 Ga0207709_10033312
375 Ga0207669_10091456
376 Ga0207691_10000530
377 Ga0207691_10070525
378 Ga0207689_10418507
379 Ga0207661_10000573
380 Ga0207679_10001715
381 Ga0207651_10000663
382 Ga0207712_10155142
383 Ga0207640_10010705
384 Ga0207658_10011059
385 Ga0207658_10161803
386 Ga0207677_10000490
387 Ga0207677_10022086
388 Ga0207677_10241459
389 Ga0207703_10017693
390 Ga0207639_10130054
391 Ga0207708_10055244
392 Ga0207641_10025838
393 Ga0207641_10048248
394 Ga0207648_10048748
395 Ga0207676_10018547
396 Ga0207676_10061219
397 Ga0207676_10187858
398 Ga0207674_10021761
399 Ga0207675_100022640
400 Ga0207675_100285613
401 Ga0207683_10001233
402 Ga0207683_10149448
403 Ga0207698_10012522
404 Ga0209588_1071683
405 Ga0265354_1002464
406 Ga0268266_10000512
407 Ga0268266_10000572
408 Ga0268264_10014096
409 Ga0268264_10501416
410 Ga0265338_10305988
411 Ga0265762_1013084
412 Ga0265770_1000206
413 Ga0307513_10008401
414 Ga0307509_10004109
415 Ga0307407_10259176
416 Ga0307411_10146080
417 Ga0307510_10000003
418 Ga0373936_0007597
419 Ga0373955_0108738
420 Ga0373924_0128135
421 Ga0373933_0048426
422 Ga0373933_0282411
423 Ga0373937_0018523
424 Ga0316582_0157382
425 Ga0395898_0209328
426 Ga0436365_1056344
427 Ga0436365_1088570
428 Ga0436360_0140670
429 Ga0436361_1127270
430 Ga0436363_1661953
431 Ga0436362_0323630
432 Ga0436362_1120880
433 Ga0451577_0036082
434 Ga0466972_0022475
435 Ga0466966_0118444
436 Ga0453684_0090105
437 Ga0466968_0063553
438 Ga0451576_0051045
439 Ga0495603_0203436
440 Ga0495650_0025001
441 Ga0495580_0073161
442 Ga0495580_0281022
443 Ga0495587_0033439
444 Ga0495623_0123298
445 Ga0495613_0308529
446 Ga0495671_0053336
447 Ga0496101_0060235
448 Ga0496101_0115385
449 Ga0496102_0002343
450 Ga0496102_0007225
451 Ga0496103_0127637
452 Ga0496104_0602817
453 Ga0496107_0040622
454 Ga0496108_0001128
455 Ga0496109_0010127
456 Ga0496109_0465840
457 Ga0496110_0001483
458 Ga0496111_0054360
459 Ga0496112_0001690
460 Ga0496112_0031904
461 Ga0496113_0093604
462 Ga0496114_0007388
463 Ga0496115_0018842
464 Ga0496116_0021210
465 Ga0496117_0000095
466 Ga0496118_0000003
467 Ga0496118_0062765
468 Ga0496119_0006933
469 Ga0496119_0020385
470 Ga0496120_0000693
471 Ga0496121_0002744
472 Ga0496121_0097606
473 Ga0496124_0041466
474 Ga0496125_0011101
475 Ga0496126_0003350
476 Ga0496126_0018083
477 Ga0496126_0279118
478 nmdc:mga0k408_199141_c1
479 Ga0500556_0001489
480 Ga0500616_0000030
481 Ga0500616_0010537
482 Ga0500639_053560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

16

315

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c9r-assembly1.cif.gz_B mycobacterium tuberculosis adenosine kinase bound to (2r,3s,4r,5r)-2-(hydroxymethyl)-5-(6-(thiophen-3-yl)-9h-purin-9-yl)tetrahydrofuran-3,4-diol 0.9766 2 322
6c9n-assembly1.cif.gz_A mycobacterium tuberculosis adenosine kinase bound to sangivamycin 0.9737 2 321
6c9n-assembly1.cif.gz_A mycobacterium tuberculosis adenosine kinase bound to sangivamycin 0.9706 2 321
6c9p-assembly1.cif.gz_B mycobacterium tuberculosis adenosine kinase bound to 6-methylmercaptopurine riboside 0.9701 2 321
6c9s-assembly1.cif.gz_B mycobacterium tuberculosis adenosine kinase bound to (2r,3r,4s,5r)-2-(6-([1,1'-biphenyl]-4-ylethynyl)-9h-purin-9-yl)-5-(hydroxymethyl)tetrahydrofuran-3,4-diol 0.9677 2 321
ID Description Score Start End Superfamily
3b1rD00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9113 2 311 3.40.1190.20
3b1rD00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9029 2 311 3.40.1190.20
3bf5B01 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8959 48 287 3.40.1190.20
2pknA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.877 1 321 3.40.1190.20
2c4eA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8747 2 307 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A4Q4D0Q9-F1-model_v4 Carbohydrate kinase family protein 0.9773 183 321 GO:0006796
GO:0016301
AF-A0A1V5IW08-F1-model_v4 deleted 0.9511 200 323
AF-A0A4Q4D0Q9-F1-model_v4 Carbohydrate kinase family protein 0.9504 183 321 GO:0006796
GO:0016301
AF-A0A3C1NAS9-F1-model_v4 Carbohydrate kinase family protein 0.95 49 313 GO:0006796
GO:0016301
AF-A0A3N5UPF5-F1-model_v4 Carbohydrate kinase family protein 0.9477 80 317 GO:0006796
GO:0016301

Map