F353892

General Info

Members Datasets Scaffolds Average Seq Length
241 142 229 379

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10001527|Ga0265330_100015272
Length 418
Sequence MHGGDLEWCRASSLRNTRMFRTLTRYSFSHLGDCMVNVAILGSTGSIGRSSLEVIAAFPDRFRVTSLTAHRNIELLERQIERFHPALAAVASTGHVPARQIRSCGTTRILAGNDGLLEAATHPDVDLVINALVGFSGLIPTMRAIEAGKDIALANKESLVVGGDLIMRTARKHGVRILPIDSEHSAILQCLQGENMSQVARIILTASGGPFWNLAPHEFESITPKQALIHPTWRMGNKITIDSATMMNKGLEVIEAYWLFGLPPDRIDVVIHPQSIIHSLVEFVDGSMKAQMGKPDMRIPIQYALTFPDRCPSMSERLDLASLGTMTFFPPDVSRFRCLGLAYEALRAGGTVPAVLNAANEMAVHLFLKGCIAFTEIPSLIAEALSTHTSLQNPSLEDLIAIDGVTRKSVQQRVAPAA

Samples

Sample ID Description Type Environment
1 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
2 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738543023 Pedobacter sp. OK628 Isolate Unclassified
6 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
7 2818991436 Collimonas arenae 515 Isolate Unclassified
8 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
9 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
10 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
11 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
70 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
73 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
74 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
75 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
103 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
104 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
105 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
128 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
137 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
138 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
139 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
140 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
141 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
142 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.02
Metatranscriptomes 0
Isolates 4.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.3
Nodule 0
Rhizoplane 0
Rhizosphere 85.89
Stem 0
Stem Tuber 0
Unclassified 5.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000001 3300002737 Bacteria 740113
2 JGI25165J46597_1000001 3300003214 Bacteria 1111887
3 rootH1_10285448 3300003323 Bacteria 2641
4 Ga0055538_1000001 3300003751 Bacteria 1111887
5 Ga0055539_1000001 3300003752 Bacteria 1111887
6 Ga0055533_1000003 3300003756 Bacteria 1111887
7 Ga0055525_1000003 3300003759 Bacteria 962094
8 Ga0055541_1000001 3300003841 Bacteria 1111887
9 Ga0065714_10018851 3300005288 Bacteria 1425
10 Ga0065714_10066128 3300005288 Bacteria 7546
11 Ga0065714_10076491 3300005288 Bacteria 2752
12 Ga0065704_10000289 3300005289 Bacteria 49641
13 Ga0070703_10004348 3300005406 Bacteria 3991
14 Ga0070714_100000282 3300005435 Bacteria 39063
15 Ga0070714_100015881 3300005435 Bacteria 6069
16 Ga0070714_100162582 3300005435 Bacteria 2021
17 Ga0070713_100315923 3300005436 Bacteria 1441
18 Ga0070708_100000079 3300005445 Bacteria 62448
19 Ga0070708_100022839 3300005445 Bacteria 5311
20 Ga0070708_100026908 3300005445 Bacteria 4929
21 Ga0070708_100045260 3300005445 Bacteria 3876
22 Ga0070708_100070132 3300005445 Bacteria 3153
23 Ga0070708_100129825 3300005445 Bacteria 2331
24 Ga0070706_100000275 3300005467 Bacteria 62444
25 Ga0070706_100000368 3300005467 Bacteria 54308
26 Ga0070706_100000738 3300005467 Bacteria 36905
27 Ga0070707_100000177 3300005468 Bacteria 62444
28 Ga0070707_100001567 3300005468 Bacteria 22150
29 Ga0070707_100003329 3300005468 Bacteria 15175
30 Ga0070707_100006915 3300005468 Bacteria 10510
31 Ga0070707_100025563 3300005468 Bacteria 5603
32 Ga0070707_100204187 3300005468 Bacteria 1926
33 Ga0070698_100008857 3300005471 Bacteria 10818
34 Ga0070698_100037157 3300005471 Bacteria 5023
35 Ga0070698_100066805 3300005471 Bacteria 3617
36 Ga0070698_100075555 3300005471 Bacteria 3373
37 Ga0070699_100000331 3300005518 Bacteria 45844
38 Ga0070699_100000981 3300005518 Bacteria 26615
39 Ga0070699_100065591 3300005518 Bacteria 3151
40 Ga0070697_100000033 3300005536 Bacteria 102446
41 Ga0070697_100011164 3300005536 Bacteria 7020
42 Ga0070697_100067901 3300005536 Bacteria 2917
43 Ga0068853_100010301 3300005539 Bacteria 7562
44 Ga0070695_100014823 3300005545 Bacteria 4703
45 Ga0068852_100007582 3300005616 Bacteria 7931
46 Ga0070717_10000067 3300006028 Bacteria 86469
47 Ga0070717_10012795 3300006028 Bacteria 6407
48 Ga0097621_100081163 3300006237 Bacteria 2699
49 Ga0075433_10013061 3300006852 Bacteria 6736
50 Ga0075433_10056576 3300006852 Bacteria 3426
51 Ga0075434_100028647 3300006871 Bacteria 5475
52 Ga0075434_100057467 3300006871 Bacteria 3866
53 Ga0075436_100005234 3300006914 Bacteria 8928
54 Ga0075436_100015905 3300006914 Bacteria 5149
55 Ga0075436_100016143 3300006914 Bacteria 5113
56 Ga0075436_100088987 3300006914 Bacteria 2145
57 Ga0075435_100052873 3300007076 Bacteria 3273
58 Ga0075435_100124982 3300007076 Bacteria 2149
59 Ga0114129_10243108 3300009147 Bacteria 2419
60 Ga0105237_10010619 3300009545 Bacteria 9780
61 Ga0105237_10211566 3300009545 Bacteria 1939
62 Ga0157373_10004329 3300013100 Bacteria 10688
63 Ga0157373_10012270 3300013100 Bacteria 6299
64 Ga0157371_10001161 3300013102 Bacteria 28350
65 Ga0157371_10004431 3300013102 Bacteria 12260
66 Ga0157371_10005398 3300013102 Bacteria 10794
67 Ga0157371_10009682 3300013102 Bacteria 7567
68 Ga0157371_10046452 3300013102 Bacteria 3089
69 Ga0157370_10001166 3300013104 Bacteria 32718
70 Ga0157370_10021599 3300013104 Bacteria 6414
71 Ga0157370_10033016 3300013104 Bacteria 5048
72 Ga0157370_10214471 3300013104 Bacteria 1784
73 Ga0157370_10304214 3300013104 Bacteria 1472
74 Ga0182008_10000008 3300014497 Bacteria 371823
75 Ga0182008_10000485 3300014497 Bacteria 30173
76 Ga0182006_1009230 3300015261 Bacteria 4431
77 Ga0182006_1011785 3300015261 Bacteria 3834
78 Ga0182006_1012003 3300015261 Bacteria 3794
79 Ga0182006_1022373 3300015261 Bacteria 2628
80 Ga0182007_10005189 3300015262 Bacteria 5758
81 Ga0182007_10015344 3300015262 Bacteria 2860
82 Ga0182007_10021301 3300015262 Bacteria 2304
83 Ga0182005_1000117 3300015265 Bacteria 57578
84 Ga0163161_10001930 3300017792 Bacteria 15128
85 Ga0163161_10002594 3300017792 Bacteria 12885
86 Ga0209784_100004 3300025224 Bacteria 1378156
87 Ga0209566_100004 3300025225 Bacteria 1531866
88 Ga0209674_100006 3300025226 Bacteria 1531866
89 Ga0209563_100009 3300025230 Bacteria 1378156
90 Ga0207427_101388 3300025231 Bacteria 8868
91 Ga0209437_100004 3300025233 Bacteria 1378156
92 Ga0209677_100005 3300025253 Bacteria 1378156
93 Ga0209233_1000005 3300025261 Bacteria 1531866
94 Ga0207653_10001208 3300025885 Bacteria 8439
95 Ga0207684_10000005 3300025910 Bacteria 736617
96 Ga0207684_10000014 3300025910 Bacteria 440027
97 Ga0207684_10000357 3300025910 Bacteria 62516
98 Ga0207684_10000385 3300025910 Bacteria 59603
99 Ga0207684_10002412 3300025910 Bacteria 18870
100 Ga0207684_10113256 3300025910 Bacteria 2322
101 Ga0207654_10100017 3300025911 Bacteria 1785
102 Ga0207671_10013566 3300025914 Bacteria 6486
103 Ga0207671_10106233 3300025914 Bacteria 2131
104 Ga0207646_10000113 3300025922 Bacteria 111264
105 Ga0207646_10000350 3300025922 Bacteria 62463
106 Ga0207646_10003134 3300025922 Bacteria 18958
107 Ga0207646_10007317 3300025922 Bacteria 11251
108 Ga0207646_10022499 3300025922 Bacteria 5807
109 Ga0207646_10025124 3300025922 Bacteria 5452
110 Ga0207646_10058866 3300025922 Bacteria 3431
111 Ga0207646_10064962 3300025922 Bacteria 3257
112 Ga0207646_10065329 3300025922 Bacteria 3248
113 Ga0207700_10060583 3300025928 Bacteria 2867
114 Ga0207664_10000026 3300025929 Bacteria 194571
115 Ga0207664_10052558 3300025929 Bacteria 3223
116 Ga0207665_10044372 3300025939 Bacteria 2975
117 Ga0207689_10026719 3300025942 Bacteria 4835
118 Ga0207639_10161206 3300026041 Bacteria 1890
119 Ga0207698_10008045 3300026142 Bacteria 6649
120 Ga0265337_1000650 3300028556 Bacteria 18327
121 Ga0265337_1021847 3300028556 Bacteria 1990
122 Ga0265326_10004610 3300028558 Bacteria 4400
123 Ga0265319_1001597 3300028563 Bacteria 13236
124 Ga0265319_1002482 3300028563 Bacteria 10042
125 Ga0265318_10000640 3300028577 Bacteria 24121
126 Ga0265318_10000822 3300028577 Bacteria 20500
127 Ga0265323_10000296 3300028653 Bacteria 28708
128 Ga0265323_10007211 3300028653 Bacteria 4635
129 Ga0265322_10013868 3300028654 Bacteria 2333
130 Ga0265336_10000869 3300028666 Bacteria 15607
131 Ga0307515_10041373 3300028794 Bacteria 7247
132 Ga0307515_10054226 3300028794 Bacteria 5891
133 Ga0265338_10000035 3300028800 Bacteria 243781
134 Ga0265338_10000254 3300028800 Bacteria 97300
135 Ga0265338_10006797 3300028800 Bacteria 14412
136 Ga0265324_10001290 3300029957 Bacteria 14716
137 Ga0265324_10010193 3300029957 Bacteria 3635
138 Ga0265330_10001527 3300031235 Bacteria 13354
139 Ga0265330_10002075 3300031235 Bacteria 11063
140 Ga0265330_10024435 3300031235 Bacteria 2741
141 Ga0265332_10001637 3300031238 Bacteria 12232
142 Ga0265332_10002256 3300031238 Bacteria 9887
143 Ga0265332_10016979 3300031238 Bacteria 3211
144 Ga0265332_10020821 3300031238 Bacteria 2897
145 Ga0265328_10014743 3300031239 Bacteria 3072
146 Ga0265328_10035504 3300031239 Bacteria 1843
147 Ga0265320_10003229 3300031240 Bacteria 11024
148 Ga0265320_10005280 3300031240 Bacteria 8322
149 Ga0265320_10020168 3300031240 Bacteria 3622
150 Ga0265325_10013469 3300031241 Bacteria 4656
151 Ga0265325_10027551 3300031241 Bacteria 3071
152 Ga0265325_10049259 3300031241 Bacteria 2175
153 Ga0265329_10001259 3300031242 Bacteria 12382
154 Ga0265339_10002799 3300031249 Bacteria 12382
155 Ga0265339_10007757 3300031249 Bacteria 6900
156 Ga0265331_10000593 3300031250 Bacteria 32186
157 Ga0265331_10001195 3300031250 Bacteria 19627
158 Ga0265331_10029367 3300031250 Bacteria 2744
159 Ga0265327_10003449 3300031251 Bacteria 15063
160 Ga0265316_10001008 3300031344 Bacteria 30578
161 Ga0265316_10004090 3300031344 Bacteria 14602
162 Ga0265316_10005187 3300031344 Bacteria 12748
163 Ga0265316_10008893 3300031344 Bacteria 9272
164 Ga0265316_10113706 3300031344 Bacteria 2048
165 Ga0307513_10026429 3300031456 Bacteria 6692
166 Ga0265313_10004049 3300031595 Bacteria 11420
167 Ga0265313_10052555 3300031595 Bacteria 1944
168 Ga0316579_10022327 3300031691 Bacteria 2829
169 Ga0265314_10000500 3300031711 Bacteria 50661
170 Ga0265314_10003200 3300031711 Bacteria 16041
171 Ga0265342_10001027 3300031712 Bacteria 27423
172 Ga0265342_10001779 3300031712 Bacteria 19637
173 Ga0265342_10002938 3300031712 Bacteria 14331
174 Ga0316578_10136711 3300031728 Bacteria 1476
175 Ga0307412_10000023 3300031911 Bacteria 237005
176 Ga0307414_10000322 3300032004 Bacteria 27336
177 Ga0307414_10002230 3300032004 Bacteria 10111
178 Ga0316585_10017363 3300032137 Bacteria 2176
179 Ga0373937_0059143 3300036401 Bacteria 3522
180 Ga0316582_0005490 3300036647 Bacteria 6539
181 Ga0316584_0063082 3300036712 Bacteria 2774
182 Ga0395901_0063953 3300038443 Bacteria 3829
183 Ga0439439_0007372 3300041406 Bacteria 2571
184 Ga0439433_0001955 3300041999 Bacteria 4316
185 Ga0439449_0000070 3300042007 Bacteria 32061
186 Ga0439462_0000390 3300042015 Bacteria 8443
187 Ga0451577_0000182 3300042876 Bacteria 133479
188 Ga0453684_0000038 3300044712 Bacteria 706970
189 Ga0453684_0000234 3300044712 Bacteria 239734
190 Ga0495592_0110744 3300046454 Bacteria 1943
191 Ga0495651_0031483 3300046462 Bacteria 4136
192 Ga0495653_0018071 3300046463 Bacteria 5732
193 Ga0495608_0003485 3300046511 Bacteria 11272
194 Ga0495618_0002094 3300046514 Bacteria 13070
195 Ga0495628_0009907 3300046516 Bacteria 8114
196 Ga0495643_0005671 3300046522 Bacteria 8366
197 Ga0495642_0002650 3300046528 Bacteria 7209
198 Ga0495652_0007716 3300046529 Bacteria 9908
199 Ga0495634_0096345 3300046642 Bacteria 1916
200 Ga0495661_0003851 3300046665 Bacteria 10971
201 Ga0495657_0030109 3300046675 Bacteria 3803
202 Ga0495599_0001173 3300046678 Bacteria 14856
203 Ga0495623_0003819 3300046679 Bacteria 9934
204 Ga0495646_0008911 3300046680 Bacteria 6371
205 Ga0495624_0008209 3300046690 Bacteria 7301
206 Ga0495624_0022420 3300046690 Bacteria 4174
207 Ga0495600_0056245 3300046809 Bacteria 2570
208 Ga0495604_0221764 3300047317 Bacteria 1301
209 Ga0495687_002164 3300047443 Bacteria 16384
210 Ga0496122_0001208 3300048925 Bacteria 43998
211 Ga0496123_0003230 3300048926 Bacteria 18546
212 Ga0496125_0011566 3300048928 Bacteria 8817
213 Ga0496126_0095992 3300048929 Bacteria 2600
214 Ga0501241_002606 3300049758 Bacteria 3477
215 nmdc:mga0n895_161620_c1 3300050512 Bacteria 2271
216 nmdc:mga0n895_33968_c1 3300050512 Bacteria 4906
217 nmdc:mga0rr50_4431_c1 3300050513 Bacteria 8257
218 nmdc:mga08x19_29930_c1 3300050514 Bacteria 3418
219 nmdc:mga08x19_64679_c1 3300050514 Bacteria 2375
220 nmdc:mga08x19_8835_c1 3300050514 Bacteria 6011
221 nmdc:mga0a205_104837_c1 3300050515 Unclassified 2726
222 nmdc:mga0a205_36740_c1 3300050515 Bacteria 4708
223 nmdc:mga0a205_56606_c1 3300050515 Bacteria 3786
224 Ga0495601_0004306 3300053077 Bacteria 8220
225 Ga0500651_0000084 3300053093 Bacteria 60127
226 Ga0500562_013463 3300053108 Bacteria 2089
227 Ga0500595_006451 3300053119 Bacteria 4974
228 Ga0500619_000188 3300053154 Bacteria 14568
229 Ga0500622_0000003 3300053156 Bacteria 613483

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006914 Ga0075436_100005234 Ga0075436_1000052342 330
2 3300050514 nmdc:mga08x19_64679_c1 nmdc:mga08x19_64679_c1_424_1539 330
3 3300049758 Ga0501241_002606 Ga0501241_002606_21_1016 331
4 3300005436 Ga0070713_100315923 Ga0070713_1003159231 340
5 3300005468 Ga0070707_100003329 Ga0070707_10000332912 340
6 3300005471 Ga0070698_100008857 Ga0070698_1000088577 340
7 3300005471 Ga0070698_100037157 Ga0070698_1000371574 340
8 3300005518 Ga0070699_100065591 Ga0070699_1000655912 340
9 3300006852 Ga0075433_10013061 Ga0075433_100130613 340
10 3300006852 Ga0075433_10056576 Ga0075433_100565762 340
11 3300006871 Ga0075434_100028647 Ga0075434_1000286473 340
12 3300006871 Ga0075434_100057467 Ga0075434_1000574673 340
13 3300006914 Ga0075436_100015905 Ga0075436_1000159053 340
14 3300006914 Ga0075436_100016143 Ga0075436_1000161433 340
15 3300007076 Ga0075435_100052873 Ga0075435_1000528732 340
16 3300007076 Ga0075435_100124982 Ga0075435_1001249822 340
17 3300009147 Ga0114129_10243108 Ga0114129_102431082 340
18 3300025922 Ga0207646_10000113 Ga0207646_1000011337 340
19 3300025922 Ga0207646_10025124 Ga0207646_100251244 340
20 3300025928 Ga0207700_10060583 Ga0207700_100605833 340
21 3300025939 Ga0207665_10044372 Ga0207665_100443723 340
22 3300050512 nmdc:mga0n895_161620_c1 nmdc:mga0n895_161620_c1_398_1480 340
23 3300050512 nmdc:mga0n895_33968_c1 nmdc:mga0n895_33968_c1_2108_3202 340
24 3300050513 nmdc:mga0rr50_4431_c1 nmdc:mga0rr50_4431_c1_7109_8203 340
25 3300050514 nmdc:mga08x19_29930_c1 nmdc:mga08x19_29930_c1_1793_2887 340
26 3300050514 nmdc:mga08x19_8835_c1 nmdc:mga08x19_8835_c1_1192_2286 340
27 3300050515 nmdc:mga0a205_104837_c1 nmdc:mga0a205_104837_c1_772_1854 340
28 3300050515 nmdc:mga0a205_36740_c1 nmdc:mga0a205_36740_c1_1645_2739 340
29 3300050515 nmdc:mga0a205_56606_c1 nmdc:mga0a205_56606_c1_1286_2380 340
30 3300005406 Ga0070703_10004348 Ga0070703_100043483 341
31 3300005445 Ga0070708_100000079 Ga0070708_10000007970 341
32 3300005445 Ga0070708_100022839 Ga0070708_1000228394 341
33 3300005445 Ga0070708_100026908 Ga0070708_1000269086 341
34 3300005445 Ga0070708_100045260 Ga0070708_1000452605 341
35 3300005445 Ga0070708_100070132 Ga0070708_1000701323 341
36 3300005445 Ga0070708_100129825 Ga0070708_1001298252 341
37 3300005467 Ga0070706_100000275 Ga0070706_10000027570 341
38 3300005467 Ga0070706_100000368 Ga0070706_1000003685 341
39 3300005467 Ga0070706_100000738 Ga0070706_10000073825 341
40 3300005468 Ga0070707_100000177 Ga0070707_1000001774 341
41 3300005468 Ga0070707_100001567 Ga0070707_10000156717 341
42 3300005468 Ga0070707_100025563 Ga0070707_1000255634 341
43 3300005468 Ga0070707_100204187 Ga0070707_1002041872 341
44 3300005471 Ga0070698_100066805 Ga0070698_1000668053 341
45 3300005471 Ga0070698_100075555 Ga0070698_1000755552 341
46 3300005518 Ga0070699_100000331 Ga0070699_1000003315 341
47 3300005518 Ga0070699_100000981 Ga0070699_10000098124 341
48 3300005536 Ga0070697_100000033 Ga0070697_10000003340 341
49 3300005536 Ga0070697_100067901 Ga0070697_1000679012 341
50 3300005545 Ga0070695_100014823 Ga0070695_1000148234 341
51 3300006028 Ga0070717_10000067 Ga0070717_100000677 341
52 3300006914 Ga0075436_100088987 Ga0075436_1000889872 341
53 3300025885 Ga0207653_10001208 Ga0207653_100012085 341
54 3300025910 Ga0207684_10000005 Ga0207684_1000000572 341
55 3300025910 Ga0207684_10000014 Ga0207684_1000001476 341
56 3300025910 Ga0207684_10000357 Ga0207684_100003574 341
57 3300025910 Ga0207684_10000385 Ga0207684_1000038550 341
58 3300025910 Ga0207684_10002412 Ga0207684_100024129 341
59 3300025910 Ga0207684_10113256 Ga0207684_101132562 341
60 3300025922 Ga0207646_10000350 Ga0207646_100003504 341
61 3300025922 Ga0207646_10007317 Ga0207646_100073173 341
62 3300025922 Ga0207646_10022499 Ga0207646_100224994 341
63 3300025922 Ga0207646_10058866 Ga0207646_100588663 341
64 3300025922 Ga0207646_10064962 Ga0207646_100649623 341
65 3300025922 Ga0207646_10065329 Ga0207646_100653292 341
66 3300005435 Ga0070714_100162582 Ga0070714_1001625821 342
67 3300005536 Ga0070697_100011164 Ga0070697_1000111642 342
68 3300025929 Ga0207664_10052558 Ga0207664_100525583 342
69 3300028794 Ga0307515_10054226 Ga0307515_100542263 342
70 3300031456 Ga0307513_10026429 Ga0307513_100264293 342
71 3300005468 Ga0070707_100006915 Ga0070707_1000069151 343
72 3300006028 Ga0070717_10012795 Ga0070717_100127953 343
73 3300025922 Ga0207646_10003134 Ga0207646_100031344 343
74 3300031238 Ga0265332_10016979 Ga0265332_100169792 343
75 3300031344 Ga0265316_10004090 Ga0265316_100040909 343
76 3300031712 Ga0265342_10001027 Ga0265342_100010275 343
77 3300038443 Ga0395901_0063953 Ga0395901_0063953_1647_2822 353
78 3300005435 Ga0070714_100015881 Ga0070714_1000158815 355
79 3300013104 Ga0157370_10021599 Ga0157370_100215992 355
80 3300025914 Ga0207671_10106233 Ga0207671_101062332 358
81 3300009545 Ga0105237_10211566 Ga0105237_102115661 360
82 3300013102 Ga0157371_10001161 Ga0157371_1000116120 360
83 3300015261 Ga0182006_1012003 Ga0182006_10120032 360
84 3300015262 Ga0182007_10015344 Ga0182007_100153442 360
85 3300025942 Ga0207689_10026719 Ga0207689_100267192 360
86 3300013104 Ga0157370_10033016 Ga0157370_100330164 361
87 3300009545 Ga0105237_10010619 Ga0105237_100106195 367
88 3300013104 Ga0157370_10001166 Ga0157370_1000116621 367
89 3300015261 Ga0182006_1011785 Ga0182006_10117852 367
90 3300017792 Ga0163161_10001930 Ga0163161_100019309 367
91 3300025914 Ga0207671_10013566 Ga0207671_100135662 367
92 3300048925 Ga0496122_0001208 Ga0496122_0001208_33320_34501 367
93 3300048926 Ga0496123_0003230 Ga0496123_0003230_9651_10832 367
94 3300048928 Ga0496125_0011566 Ga0496125_0011566_290_1471 367
95 3300014497 Ga0182008_10000485 Ga0182008_100004857 368
96 3300048929 Ga0496126_0095992 Ga0496126_0095992_208_1386 372
97 iso_pu_bacteria 2524023129 2524186327 375
98 3300017792 Ga0163161_10002594 Ga0163161_1000259410 376
99 iso_pu_bacteria 8022948649 8022949454 376
100 3300042876 Ga0451577_0000182 Ga0451577_0000182_26087_27223 377
101 3300044712 Ga0453684_0000038 Ga0453684_0000038_636568_637704 377
102 3300028653 Ga0265323_10007211 Ga0265323_100072114 379
103 3300041406 Ga0439439_0007372 Ga0439439_0007372_294_1502 379
104 3300041999 Ga0439433_0001955 Ga0439433_0001955_1953_3092 379
105 3300042007 Ga0439449_0000070 Ga0439449_0000070_26587_27795 379
106 3300042015 Ga0439462_0000390 Ga0439462_0000390_2147_3355 379
107 iso_pu_bacteria 2738541284 2738760419 379
108 iso_pu_bacteria 2738543023 2739302569 379
109 iso_pu_bacteria 2775506987 2776612472 379
110 iso_pu_bacteria 2852627209 2852630384 379
111 iso_pu_bacteria 2919186247 2919189675 379
112 iso_pu_bacteria 2939664404 2939667901 379
113 iso_pu_bacteria 2896317667 2896318678 380
114 3300028556 Ga0265337_1000650 Ga0265337_10006505 381
115 3300028556 Ga0265337_1021847 Ga0265337_10218472 381
116 3300028558 Ga0265326_10004610 Ga0265326_100046102 381
117 3300028563 Ga0265319_1001597 Ga0265319_10015977 381
118 3300028563 Ga0265319_1002482 Ga0265319_10024826 381
119 3300028577 Ga0265318_10000822 Ga0265318_1000082215 381
120 3300028653 Ga0265323_10000296 Ga0265323_1000029616 381
121 3300028654 Ga0265322_10013868 Ga0265322_100138682 381
122 3300028666 Ga0265336_10000869 Ga0265336_100008694 381
123 3300028794 Ga0307515_10041373 Ga0307515_100413735 381
124 3300028800 Ga0265338_10000254 Ga0265338_1000025412 381
125 3300028800 Ga0265338_10006797 Ga0265338_100067974 381
126 3300029957 Ga0265324_10001290 Ga0265324_100012905 381
127 3300031235 Ga0265330_10002075 Ga0265330_100020754 381
128 3300031238 Ga0265332_10001637 Ga0265332_100016379 381
129 3300031238 Ga0265332_10020821 Ga0265332_100208212 381
130 3300031239 Ga0265328_10014743 Ga0265328_100147432 381
131 3300031240 Ga0265320_10003229 Ga0265320_100032295 381
132 3300031240 Ga0265320_10005280 Ga0265320_100052803 381
133 3300031241 Ga0265325_10013469 Ga0265325_100134692 381
134 3300031241 Ga0265325_10049259 Ga0265325_100492592 381
135 3300031242 Ga0265329_10001259 Ga0265329_100012594 381
136 3300031249 Ga0265339_10002799 Ga0265339_100027994 381
137 3300031250 Ga0265331_10001195 Ga0265331_1000119513 381
138 3300031344 Ga0265316_10005187 Ga0265316_100051875 381
139 3300031595 Ga0265313_10004049 Ga0265313_100040499 381
140 3300031595 Ga0265313_10052555 Ga0265313_100525552 381
141 3300031711 Ga0265314_10000500 Ga0265314_100005004 381
142 3300031712 Ga0265342_10002938 Ga0265342_100029387 381
143 3300028800 Ga0265338_10000035 Ga0265338_1000003528 382
144 3300029957 Ga0265324_10010193 Ga0265324_100101933 382
145 3300031235 Ga0265330_10001527 Ga0265330_100015272 382
146 3300031344 Ga0265316_10008893 Ga0265316_100088936 382
147 3300031344 Ga0265316_10113706 Ga0265316_101137062 382
148 3300036401 Ga0373937_0059143 Ga0373937_0059143_388_1551 382
149 3300044712 Ga0453684_0000234 Ga0453684_0000234_158571_159722 382
150 3300053108 Ga0500562_013463 Ga0500562_013463_600_1763 382
151 3300053156 Ga0500622_0000003 Ga0500622_0000003_535214_536425 382
152 3300003323 rootH1_10285448 rootH1_102854482 383
153 3300005288 Ga0065714_10018851 Ga0065714_100188512 383
154 3300005288 Ga0065714_10066128 Ga0065714_100661286 383
155 3300005288 Ga0065714_10076491 Ga0065714_100764912 383
156 3300005289 Ga0065704_10000289 Ga0065704_1000028918 383
157 3300013100 Ga0157373_10004329 Ga0157373_100043292 383
158 3300013100 Ga0157373_10012270 Ga0157373_100122705 383
159 3300013102 Ga0157371_10004431 Ga0157371_100044311 383
160 3300013102 Ga0157371_10009682 Ga0157371_100096822 383
161 3300013104 Ga0157370_10214471 Ga0157370_102144712 383
162 3300013104 Ga0157370_10304214 Ga0157370_103042142 383
163 3300014497 Ga0182008_10000008 Ga0182008_10000008305 383
164 3300015261 Ga0182006_1022373 Ga0182006_10223732 383
165 3300015262 Ga0182007_10021301 Ga0182007_100213012 383
166 3300028577 Ga0265318_10000640 Ga0265318_100006402 383
167 3300031235 Ga0265330_10024435 Ga0265330_100244351 383
168 3300031238 Ga0265332_10002256 Ga0265332_100022564 383
169 3300031240 Ga0265320_10020168 Ga0265320_100201681 383
170 3300031241 Ga0265325_10027551 Ga0265325_100275512 383
171 3300031249 Ga0265339_10007757 Ga0265339_100077575 383
172 3300031250 Ga0265331_10000593 Ga0265331_1000059315 383
173 3300031344 Ga0265316_10001008 Ga0265316_100010087 383
174 3300031711 Ga0265314_10003200 Ga0265314_100032002 383
175 3300031712 Ga0265342_10001779 Ga0265342_100017795 383
176 3300031911 Ga0307412_10000023 Ga0307412_1000002315 383
177 3300032004 Ga0307414_10000322 Ga0307414_1000032218 383
178 3300032004 Ga0307414_10002230 Ga0307414_100022303 383
179 3300053093 Ga0500651_0000084 Ga0500651_0000084_36232_37383 383
180 iso_pu_bacteria 2687453341 2688395215 383
181 iso_pu_bacteria 2738541283 2738757083 383
182 3300031691 Ga0316579_10022327 Ga0316579_100223272 384
183 3300032137 Ga0316585_10017363 Ga0316585_100173631 384
184 3300036647 Ga0316582_0005490 Ga0316582_0005490_4011_5183 384
185 3300036712 Ga0316584_0063082 Ga0316584_0063082_1494_2735 384
186 iso_pu_bacteria 2818991436 2819542861 386
187 3300005435 Ga0070714_100000282 Ga0070714_10000028226 388
188 3300005539 Ga0068853_100010301 Ga0068853_1000103017 388
189 3300006237 Ga0097621_100081163 Ga0097621_1000811632 388
190 3300013102 Ga0157371_10005398 Ga0157371_100053987 388
191 3300013102 Ga0157371_10046452 Ga0157371_100464521 388
192 3300025929 Ga0207664_10000026 Ga0207664_10000026167 388
193 3300026041 Ga0207639_10161206 Ga0207639_101612062 388
194 3300015262 Ga0182007_10005189 Ga0182007_100051895 389
195 3300025911 Ga0207654_10100017 Ga0207654_101000172 389
196 3300046462 Ga0495651_0031483 Ga0495651_0031483_1638_2807 389
197 3300046516 Ga0495628_0009907 Ga0495628_0009907_2684_3853 389
198 3300046529 Ga0495652_0007716 Ga0495652_0007716_5451_6620 389
199 3300046679 Ga0495623_0003819 Ga0495623_0003819_1771_2940 389
200 3300046680 Ga0495646_0008911 Ga0495646_0008911_2060_3229 389
201 3300046690 Ga0495624_0022420 Ga0495624_0022420_1463_2632 389
202 3300002737 JGI25162J39368_1000001 JGI25162J39368_1000001380 390
203 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001371 390
204 3300003751 Ga0055538_1000001 Ga0055538_1000001661 390
205 3300003752 Ga0055539_1000001 Ga0055539_1000001661 390
206 3300003756 Ga0055533_1000003 Ga0055533_1000003371 390
207 3300003759 Ga0055525_1000003 Ga0055525_1000003371 390
208 3300003841 Ga0055541_1000001 Ga0055541_1000001371 390
209 3300005616 Ga0068852_100007582 Ga0068852_1000075825 390
210 3300015261 Ga0182006_1009230 Ga0182006_10092302 390
211 3300015265 Ga0182005_1000117 Ga0182005_100011718 390
212 3300025224 Ga0209784_100004 Ga0209784_100004372 390
213 3300025225 Ga0209566_100004 Ga0209566_100004529 390
214 3300025226 Ga0209674_100006 Ga0209674_100006529 390
215 3300025230 Ga0209563_100009 Ga0209563_100009372 390
216 3300025231 Ga0207427_101388 Ga0207427_1013882 390
217 3300025233 Ga0209437_100004 Ga0209437_100004372 390
218 3300025253 Ga0209677_100005 Ga0209677_100005372 390
219 3300025261 Ga0209233_1000005 Ga0209233_1000005529 390
220 3300026142 Ga0207698_10008045 Ga0207698_100080453 390
221 3300031239 Ga0265328_10035504 Ga0265328_100355042 390
222 3300031250 Ga0265331_10029367 Ga0265331_100293672 390
223 3300031251 Ga0265327_10003449 Ga0265327_1000344915 390
224 3300031728 Ga0316578_10136711 Ga0316578_101367112 390
225 3300046454 Ga0495592_0110744 Ga0495592_0110744_522_1694 390
226 3300046463 Ga0495653_0018071 Ga0495653_0018071_3561_4733 390
227 3300046511 Ga0495608_0003485 Ga0495608_0003485_8723_9895 390
228 3300046514 Ga0495618_0002094 Ga0495618_0002094_244_1416 390
229 3300046522 Ga0495643_0005671 Ga0495643_0005671_1638_2810 390
230 3300046528 Ga0495642_0002650 Ga0495642_0002650_2692_3864 390
231 3300046642 Ga0495634_0096345 Ga0495634_0096345_300_1472 390
232 3300046665 Ga0495661_0003851 Ga0495661_0003851_4510_5682 390
233 3300046675 Ga0495657_0030109 Ga0495657_0030109_169_1341 390
234 3300046678 Ga0495599_0001173 Ga0495599_0001173_1827_2999 390
235 3300046690 Ga0495624_0008209 Ga0495624_0008209_1125_2297 390
236 3300046809 Ga0495600_0056245 Ga0495600_0056245_1240_2412 390
237 3300047317 Ga0495604_0221764 Ga0495604_0221764_116_1288 390
238 3300047443 Ga0495687_002164 Ga0495687_002164_10643_11815 390
239 3300053077 Ga0495601_0004306 Ga0495601_0004306_2463_3635 390
240 3300053119 Ga0500595_006451 Ga0500595_006451_1869_3041 390
241 3300053154 Ga0500619_000188 Ga0500619_000188_1783_2955 390

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08436

DXP_redisom_C

1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain

177

260

0.99

PF02670

DXP_reductoisom

1-deoxy-D-xylulose 5-phosphate reductoisomerase

38

163

0.97

PF13288

DXPR_C

DXP reductoisomerase C-terminal domain

292

409

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kry-assembly1.cif.gz_B 1-deoxy-d-xylulose 5-phosphate reductoisomerase from vibrio vulnificus 0.9751 1 389
1jvs-assembly1.cif.gz_B crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase; a target enzyme for antimalarial drugs 0.9736 1 388
1r0k-assembly2.cif.gz_C crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis 0.9724 2 389
1r0k-assembly2.cif.gz_D crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis 0.9718 2 390
1q0h-assembly1.cif.gz_A crystal structure of selenomethionine-labelled dxr in complex with fosmidomycin 0.9707 1 388
ID Description Score Start End Superfamily
4zn6B03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9962 308 389 1.10.1740.10
2eghA03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9868 309 388 1.10.1740.10
1t1rA03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.982 309 388 1.10.1740.10
5kqoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9801 1 150 3.40.50.720
1onpB03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9792 309 388 1.10.1740.10
ID Description Score Start End GO Terms
AF-A0A836THJ0-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase (EC 1.1.1.267) 0.9976 230 389 GO:0016853
GO:0030145
GO:0030604
GO:0051484
GO:0070402
AF-A0A6A5LDV6-F1-model_v4 deleted 0.9974 1 389
AF-A0A3C0YNP7-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase (EC 1.1.1.267) 0.9959 169 389 GO:0016853
GO:0030145
GO:0030604
GO:0051484
GO:0070402
AF-A0A352SB32-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase (EC 1.1.1.267) 0.9955 229 355 GO:0016853
GO:0030145
GO:0030604
GO:0051484
GO:0070402
AF-W2D208-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase (EC 1.1.1.267) 0.9953 172 343 GO:0030145
GO:0030604
GO:0051484
GO:0070402

Feature Viewer

pLDDT pTM Quality
95.43 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map