F353566

General Info

Members Datasets Scaffolds Average Seq Length
241 100 241 183

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100959442|Ga0070706_1009594421
Length 214
Sequence MRALRCSAAPSIRAADPPNLSAGPPAPPPLIDPVLRDAETKMAKSVDHFGGELATIRTGRANPALIDKVMVPYYGTPTPLNQLAQISAPEPRLLVVQVYDKSQIGAIEKALRSGDMGLNPANDGQVIRVPIPPLTEERRKEYVKLVRQKAEDARVAIRNVRRDELHQIDQMARQGEIAEDESKRAHTRLQKITEAQIEKVDALGARKETEVLEL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
51 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
54 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
55 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
56 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
57 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
58 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
72 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
73 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
74 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
75 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
76 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
85 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
86 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
87 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
88 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
89 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
90 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
91 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
92 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
93 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
94 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
95 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
96 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
97 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
98 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
99 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
100 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 1.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.41
Rhizosphere 99.17
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3105002 2162886007 Bacteria 2597
2 Ga0065704_10079492 3300005289 Bacteria 4148
3 Ga0070709_10000130 3300005434 Bacteria 49643
4 Ga0070714_100000035 3300005435 Bacteria 128012
5 Ga0070714_100003389 3300005435 Bacteria 11881
6 Ga0070714_100034074 3300005435 Bacteria 4263
7 Ga0070714_100265381 3300005435 Bacteria 1591
8 Ga0070714_100337122 3300005435 Bacteria 1413
9 Ga0070714_100437491 3300005435 Bacteria 1241
10 Ga0070714_100438792 3300005435 Bacteria 1239
11 Ga0070714_100503140 3300005435 Bacteria 1156
12 Ga0070714_100934207 3300005435 Bacteria 843
13 Ga0070714_101476421 3300005435 Bacteria 664
14 Ga0070713_100016153 3300005436 Bacteria 5609
15 Ga0070713_100520771 3300005436 Bacteria 1124
16 Ga0070710_10385355 3300005437 Bacteria 936
17 Ga0070705_100011513 3300005440 Bacteria 4464
18 Ga0070705_100053430 3300005440 Bacteria 2365
19 Ga0070694_100288156 3300005444 Bacteria 1254
20 Ga0070708_100000079 3300005445 Bacteria 62448
21 Ga0070708_100014936 3300005445 Bacteria 6402
22 Ga0070708_100026908 3300005445 Bacteria 4929
23 Ga0070708_100103057 3300005445 Bacteria 2615
24 Ga0070708_100144002 3300005445 Bacteria 2212
25 Ga0070708_100266582 3300005445 Bacteria 1610
26 Ga0070706_100000056 3300005467 Bacteria 137252
27 Ga0070706_100000275 3300005467 Bacteria 62444
28 Ga0070706_100000738 3300005467 Bacteria 36905
29 Ga0070706_100002544 3300005467 Bacteria 18334
30 Ga0070706_100150359 3300005467 Bacteria 2173
31 Ga0070706_100386762 3300005467 Bacteria 1302
32 Ga0070706_100411055 3300005467 Bacteria 1260
33 Ga0070706_100830919 3300005467 Bacteria 854
34 Ga0070706_100841616 3300005467 Bacteria 848
35 Ga0070706_100959442 3300005467 Bacteria 789
36 Ga0070707_100000177 3300005468 Bacteria 62444
37 Ga0070707_100001567 3300005468 Bacteria 22150
38 Ga0070707_100003329 3300005468 Bacteria 15175
39 Ga0070707_100006915 3300005468 Bacteria 10510
40 Ga0070707_100066107 3300005468 Bacteria 3474
41 Ga0070707_100079735 3300005468 Bacteria 3160
42 Ga0070707_100091420 3300005468 Bacteria 2946
43 Ga0070707_100112988 3300005468 Bacteria 2635
44 Ga0070707_100191991 3300005468 Bacteria 1991
45 Ga0070707_100428013 3300005468 Bacteria 1284
46 Ga0070707_100518988 3300005468 Bacteria 1153
47 Ga0070707_100564294 3300005468 Bacteria 1100
48 Ga0070707_100640577 3300005468 Bacteria 1025
49 Ga0070707_100651492 3300005468 Bacteria 1016
50 Ga0070707_100878691 3300005468 Bacteria 861
51 Ga0070707_101069754 3300005468 Unclassified 772
52 Ga0070698_100007481 3300005471 Bacteria 11819
53 Ga0070698_100008857 3300005471 Bacteria 10818
54 Ga0070698_100010710 3300005471 Bacteria 9765
55 Ga0070698_100075407 3300005471 Bacteria 3377
56 Ga0070698_100086059 3300005471 Bacteria 3129
57 Ga0070698_100128398 3300005471 Bacteria 2491
58 Ga0070698_100563746 3300005471 Bacteria 1079
59 Ga0070698_100832388 3300005471 Bacteria 867
60 Ga0070699_100000133 3300005518 Bacteria 68871
61 Ga0070699_100000981 3300005518 Bacteria 26615
62 Ga0070699_100020287 3300005518 Bacteria 5731
63 Ga0070699_100029922 3300005518 Bacteria 4697
64 Ga0070699_100057453 3300005518 Bacteria 3370
65 Ga0070699_100150715 3300005518 Bacteria 2057
66 Ga0070699_100327933 3300005518 Bacteria 1376
67 Ga0070699_100389827 3300005518 Bacteria 1258
68 Ga0070699_100524917 3300005518 Bacteria 1077
69 Ga0070699_100653780 3300005518 Bacteria 960
70 Ga0070699_100877070 3300005518 Bacteria 821
71 Ga0070699_100964364 3300005518 Bacteria 781
72 Ga0070697_100000033 3300005536 Bacteria 102446
73 Ga0070697_100023518 3300005536 Bacteria 4900
74 Ga0070697_100025216 3300005536 Bacteria 4741
75 Ga0070697_100047232 3300005536 Bacteria 3491
76 Ga0070697_100072982 3300005536 Bacteria 2817
77 Ga0070697_100079889 3300005536 Bacteria 2693
78 Ga0070697_100110273 3300005536 Bacteria 2292
79 Ga0070697_100176913 3300005536 Bacteria 1808
80 Ga0070697_100823031 3300005536 Bacteria 822
81 Ga0070697_100967522 3300005536 Bacteria 756
82 Ga0070695_100014823 3300005545 Bacteria 4703
83 Ga0070695_100188850 3300005545 Bacteria 1465
84 Ga0070695_100362189 3300005545 Bacteria 1089
85 Ga0070696_100587053 3300005546 Bacteria 897
86 Ga0070704_100029573 3300005549 Bacteria 3660
87 Ga0068863_101264922 3300005841 Bacteria 744
88 Ga0081538_10002450 3300005981 Bacteria 18146
89 Ga0081538_10021544 3300005981 Bacteria 4698
90 Ga0081538_10118930 3300005981 Bacteria 1275
91 Ga0081539_10000078 3300005985 Bacteria 226113
92 Ga0081539_10034652 3300005985 Bacteria 3047
93 Ga0081539_10143458 3300005985 Bacteria 1158
94 Ga0070717_10000067 3300006028 Bacteria 86469
95 Ga0070717_10000520 3300006028 Bacteria 24354
96 Ga0070717_10000997 3300006028 Bacteria 18946
97 Ga0070717_10012795 3300006028 Bacteria 6407
98 Ga0070717_10501404 3300006028 Bacteria 1097
99 Ga0070717_10782666 3300006028 Bacteria 868
100 Ga0075432_10052355 3300006058 Bacteria 1442
101 Ga0070716_100026128 3300006173 Bacteria 3124
102 Ga0070716_100026419 3300006173 Bacteria 3109
103 Ga0075428_100095097 3300006844 Bacteria 3248
104 Ga0075428_100378796 3300006844 Bacteria 1517
105 Ga0075428_100977133 3300006844 Bacteria 897
106 Ga0075433_10012576 3300006852 Bacteria 6844
107 Ga0075433_10378053 3300006852 Bacteria 1251
108 Ga0075434_100155083 3300006871 Bacteria 2310
109 Ga0075434_101060675 3300006871 Bacteria 824
110 Ga0075436_100005234 3300006914 Bacteria 8928
111 Ga0075436_100030091 3300006914 Bacteria 3736
112 Ga0075436_100038566 3300006914 Bacteria 3297
113 Ga0075436_100196915 3300006914 Bacteria 1426
114 Ga0075436_100278130 3300006914 Bacteria 1196
115 Ga0075436_100856227 3300006914 Bacteria 679
116 Ga0075435_100054330 3300007076 Bacteria 3232
117 Ga0075435_100420850 3300007076 Bacteria 1150
118 Ga0099794_10000904 3300007265 Bacteria 9992
119 Ga0105240_10194920 3300009093 Bacteria 2380
120 Ga0114129_10673692 3300009147 Bacteria 1332
121 Ga0105237_10577706 3300009545 Bacteria 1131
122 Ga0099796_10011942 3300010159 Bacteria 2437
123 Ga0182008_10185010 3300014497 Bacteria 1055
124 Ga0206350_10341234 3300020080 Bacteria 665
125 Ga0206350_10353207 3300020080 Bacteria 771
126 Ga0224712_10050124 3300022467 Bacteria 1620
127 Ga0207653_10003156 3300025885 Bacteria 5206
128 Ga0207699_10000030 3300025906 Bacteria 138384
129 Ga0207699_10323663 3300025906 Bacteria 1082
130 Ga0207684_10000014 3300025910 Bacteria 440027
131 Ga0207684_10000166 3300025910 Bacteria 111380
132 Ga0207684_10000357 3300025910 Bacteria 62516
133 Ga0207684_10000385 3300025910 Bacteria 59603
134 Ga0207684_10002412 3300025910 Bacteria 18870
135 Ga0207684_10056372 3300025910 Bacteria 3333
136 Ga0207684_10108456 3300025910 Bacteria 2376
137 Ga0207684_10185519 3300025910 Bacteria 1794
138 Ga0207646_10000113 3300025922 Bacteria 111264
139 Ga0207646_10000350 3300025922 Bacteria 62463
140 Ga0207646_10002921 3300025922 Bacteria 19822
141 Ga0207646_10006673 3300025922 Bacteria 11899
142 Ga0207646_10019971 3300025922 Bacteria 6216
143 Ga0207646_10026495 3300025922 Bacteria 5289
144 Ga0207646_10029454 3300025922 Bacteria 4989
145 Ga0207646_10035070 3300025922 Bacteria 4533
146 Ga0207646_10051042 3300025922 Bacteria 3701
147 Ga0207646_10051369 3300025922 Bacteria 3689
148 Ga0207646_10065040 3300025922 Bacteria 3255
149 Ga0207646_10076949 3300025922 Bacteria 2982
150 Ga0207646_10131350 3300025922 Bacteria 2254
151 Ga0207646_10466344 3300025922 Bacteria 1139
152 Ga0207700_10011655 3300025928 Bacteria 5619
153 Ga0207700_10182208 3300025928 Bacteria 1759
154 Ga0207664_10000005 3300025929 Bacteria 485048
155 Ga0207664_10013810 3300025929 Bacteria 5813
156 Ga0207664_10035932 3300025929 Bacteria 3826
157 Ga0207664_10075091 3300025929 Bacteria 2732
158 Ga0207664_10310042 3300025929 Bacteria 1390
159 Ga0207664_10383335 3300025929 Bacteria 1248
160 Ga0207664_10394801 3300025929 Bacteria 1229
161 Ga0207664_10793738 3300025929 Bacteria 852
162 Ga0207665_10031466 3300025939 Bacteria 3511
163 Ga0207665_10040428 3300025939 Bacteria 3111
164 Ga0207641_10757288 3300026088 Bacteria 959
165 Ga0209969_1030840 3300027360 Bacteria 819
166 Ga0209967_1009293 3300027364 Bacteria 1362
167 Ga0209984_1030537 3300027424 Bacteria 761
168 Ga0209588_1004228 3300027671 Bacteria 4038
169 Ga0209971_1009037 3300027682 Bacteria 2364
170 Ga0209974_10000912 3300027876 Bacteria 10297
171 Ga0316182_1333290 3300030745 Bacteria 2590
172 Ga0307408_100098176 3300031548 Bacteria 2226
173 Ga0316575_10197767 3300031665 Bacteria 837
174 Ga0316579_10074908 3300031691 Bacteria 1607
175 Ga0316576_10005175 3300031727 Bacteria 7925
176 Ga0307405_10406192 3300031731 Bacteria 1068
177 Ga0307405_10455525 3300031731 Bacteria 1015
178 Ga0316577_10027765 3300031733 Bacteria 3155
179 Ga0307410_10033481 3300031852 Bacteria 3318
180 Ga0307410_10207327 3300031852 Bacteria 1500
181 Ga0307406_10254934 3300031901 Bacteria 1324
182 Ga0307407_10015496 3300031903 Bacteria 3771
183 Ga0307412_10397280 3300031911 Bacteria 1121
184 Ga0307409_100242367 3300031995 Bacteria 1642
185 Ga0307409_100847153 3300031995 Bacteria 925
186 Ga0307409_100924141 3300031995 Bacteria 887
187 Ga0307416_100062918 3300032002 Bacteria 3036
188 Ga0307416_100255099 3300032002 Bacteria 1710
189 Ga0307416_100270337 3300032002 Bacteria 1668
190 Ga0307414_10734302 3300032004 Unclassified 896
191 Ga0307414_10769395 3300032004 Bacteria 876
192 Ga0307411_10459527 3300032005 Bacteria 1067
193 Ga0307415_100010312 3300032126 Bacteria 5285
194 Ga0307415_100147302 3300032126 Bacteria 1807
195 Ga0316593_10005405 3300032168 Bacteria 3366
196 Ga0316574_0000055 3300035398 Bacteria 29301
197 Ga0316582_0006472 3300036647 Bacteria 6153
198 Ga0316584_0023511 3300036712 Bacteria 4502
199 Ga0316584_0195901 3300036712 Bacteria 1492
200 Ga0436364_0625359 3300037853 Bacteria 2013
201 Ga0242420_026755 3300038996 Bacteria 1054
202 Ga0436360_0852207 3300039438 Bacteria 2614
203 Ga0451577_0001334 3300042876 Bacteria 33535
204 Ga0466969_0004201 3300044656 Bacteria 7644
205 Ga0453683_0000145 3300044673 Bacteria 104430
206 Ga0453683_0085475 3300044673 Bacteria 1977
207 Ga0453684_0000004 3300044712 Bacteria 1469893
208 Ga0453684_0000424 3300044712 Bacteria 172336
209 Ga0466968_0058430 3300044735 Bacteria 1660
210 Ga0451576_0044612 3300045051 Bacteria 4673
211 Ga0451576_0237797 3300045051 Bacteria 1902
212 Ga0466958_0447888 3300045836 Bacteria 836
213 Ga0495667_0736699 3300046559 Bacteria 610
214 Ga0496100_0339721 3300048903 Bacteria 1132
215 Ga0501070_0782579 3300049586 Bacteria 750
216 Ga0501073_0346821 3300049589 Bacteria 1025
217 Ga0501074_0093526 3300049590 Bacteria 2153
218 Ga0501235_125162 3300049669 Unclassified 646
219 Ga0501248_031995 3300049678 Bacteria 605
220 Ga0501253_003129 3300049683 Bacteria 1950
221 Ga0501221_036153 3300049704 Bacteria 1057
222 Ga0501225_0044801 3300049705 Bacteria 1224
223 Ga0501080_0387089 3300049742 Bacteria 1259
224 nmdc:mga0qj67_325542_c1 3300050509 Bacteria 1244
225 nmdc:mga0n895_190521_c1 3300050512 Bacteria 2082
226 nmdc:mga0n895_789494_c1 3300050512 Bacteria 941
227 nmdc:mga0rr50_52127_c1 3300050513 Bacteria 3039
228 nmdc:mga0rr50_96994_c1 3300050513 Bacteria 2308
229 nmdc:mga08x19_145154_c1 3300050514 Bacteria 1605
230 nmdc:mga08x19_211235_c1 3300050514 Bacteria 1332
231 nmdc:mga08x19_33629_c1 3300050514 Bacteria 3236
232 nmdc:mga08x19_82444_c1 3300050514 Bacteria 2113
233 nmdc:mga08x19_9494_c1 3300050514 Bacteria 5827
234 nmdc:mga0a205_13645_c1 3300050515 Bacteria 7569
235 nmdc:mga0a205_261688_c1 3300050515 Bacteria 1607
236 nmdc:mga0a205_386331_c1 3300050515 Bacteria 1265
237 Ga0495612_0134481 3300053078 Bacteria 1070
238 Ga0495619_0160295 3300053085 Bacteria 1554
239 Ga0590071_025999 3300059421 Bacteria 1388
240 Ga0590071_033821 3300059421 Bacteria 1222
241 Ga0590077_000986 3300059426 Bacteria 7238

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300059421 Ga0590071_025999 Ga0590071_025999_432_992 159
2 3300059426 Ga0590077_000986 Ga0590077_000986_4215_4775 159
3 3300005985 Ga0081539_10034652 Ga0081539_100346524 161
4 3300006844 Ga0075428_100977133 Ga0075428_1009771331 161
5 3300030745 Ga0316182_1333290 Ga0316182_13332902 161
6 3300032002 Ga0307416_100270337 Ga0307416_1002703372 161
7 3300005981 Ga0081538_10021544 Ga0081538_100215445 163
8 3300031995 Ga0307409_100924141 Ga0307409_1009241412 166
9 3300046559 Ga0495667_0736699 Ga0495667_0736699_11_511 166
10 3300005435 Ga0070714_100265381 Ga0070714_1002653812 173
11 3300005435 Ga0070714_101476421 Ga0070714_1014764211 173
12 3300005445 Ga0070708_100144002 Ga0070708_1001440024 173
13 3300005518 Ga0070699_100877070 Ga0070699_1008770701 173
14 3300005536 Ga0070697_100025216 Ga0070697_1000252164 173
15 3300025922 Ga0207646_10035070 Ga0207646_100350705 173
16 3300027360 Ga0209969_1030840 Ga0209969_10308402 173
17 3300027364 Ga0209967_1009293 Ga0209967_10092932 173
18 3300027424 Ga0209984_1030537 Ga0209984_10305372 173
19 3300027682 Ga0209971_1009037 Ga0209971_10090373 173
20 3300027876 Ga0209974_10000912 Ga0209974_100009126 173
21 3300042876 Ga0451577_0001334 Ga0451577_0001334_22623_23144 173
22 3300044712 Ga0453684_0000004 Ga0453684_0000004_300684_301205 173
23 3300050514 nmdc:mga08x19_145154_c1 nmdc:mga08x19_145154_c1_19_540 173
24 3300053078 Ga0495612_0134481 Ga0495612_0134481_456_977 173
25 3300053085 Ga0495619_0160295 Ga0495619_0160295_701_1222 173
26 3300049678 Ga0501248_031995 Ga0501248_031995_22_579 174
27 3300005981 Ga0081538_10002450 Ga0081538_1000245011 175
28 3300005981 Ga0081538_10118930 Ga0081538_101189301 175
29 3300031548 Ga0307408_100098176 Ga0307408_1000981762 175
30 3300031731 Ga0307405_10455525 Ga0307405_104555252 175
31 3300031852 Ga0307410_10033481 Ga0307410_100334812 175
32 3300031852 Ga0307410_10207327 Ga0307410_102073272 175
33 3300031903 Ga0307407_10015496 Ga0307407_100154964 175
34 3300031911 Ga0307412_10397280 Ga0307412_103972802 175
35 3300031995 Ga0307409_100242367 Ga0307409_1002423672 175
36 3300032002 Ga0307416_100062918 Ga0307416_1000629184 175
37 3300032004 Ga0307414_10734302 Ga0307414_107343021 175
38 3300032005 Ga0307411_10459527 Ga0307411_104595272 175
39 3300032126 Ga0307415_100010312 Ga0307415_1000103126 175
40 3300032126 Ga0307415_100147302 Ga0307415_1001473022 175
41 3300049669 Ga0501235_125162 Ga0501235_125162_63_623 175
42 3300049683 Ga0501253_003129 Ga0501253_003129_214_774 175
43 3300049705 Ga0501225_0044801 Ga0501225_0044801_152_712 175
44 3300031995 Ga0307409_100847153 Ga0307409_1008471532 177
45 3300032004 Ga0307414_10769395 Ga0307414_107693952 177
46 3300025922 Ga0207646_10466344 Ga0207646_104663441 178
47 3300005467 Ga0070706_100411055 Ga0070706_1004110552 180
48 3300005468 Ga0070707_100003329 Ga0070707_1000033299 180
49 3300005468 Ga0070707_100066107 Ga0070707_1000661072 180
50 3300005471 Ga0070698_100075407 Ga0070698_1000754073 180
51 3300005518 Ga0070699_100020287 Ga0070699_1000202875 180
52 3300005536 Ga0070697_100072982 Ga0070697_1000729824 180
53 3300025910 Ga0207684_10108456 Ga0207684_101084563 180
54 3300025922 Ga0207646_10051042 Ga0207646_100510424 180
55 3300005985 Ga0081539_10000078 Ga0081539_10000078127 183
56 3300005985 Ga0081539_10143458 Ga0081539_101434582 183
57 3300014497 Ga0182008_10185010 Ga0182008_101850102 183
58 3300031731 Ga0307405_10406192 Ga0307405_104061921 183
59 3300031901 Ga0307406_10254934 Ga0307406_102549342 183
60 3300032002 Ga0307416_100255099 Ga0307416_1002550992 183
61 3300037853 Ga0436364_0625359 Ga0436364_0625359_649_1209 183
62 3300049704 Ga0501221_036153 Ga0501221_036153_273_833 183
63 3300059421 Ga0590071_033821 Ga0590071_033821_241_801 183
64 2162886007 SwRhRL2b_contig_3105002 SwRhRL2b_0366.00004150 184
65 3300005289 Ga0065704_10079492 Ga0065704_100794924 184
66 3300005434 Ga0070709_10000130 Ga0070709_1000013043 184
67 3300005435 Ga0070714_100000035 Ga0070714_100000035114 184
68 3300005435 Ga0070714_100003389 Ga0070714_1000033893 184
69 3300005435 Ga0070714_100034074 Ga0070714_1000340744 184
70 3300005435 Ga0070714_100337122 Ga0070714_1003371222 184
71 3300005435 Ga0070714_100437491 Ga0070714_1004374912 184
72 3300005435 Ga0070714_100438792 Ga0070714_1004387922 184
73 3300005435 Ga0070714_100503140 Ga0070714_1005031402 184
74 3300005435 Ga0070714_100934207 Ga0070714_1009342071 184
75 3300005436 Ga0070713_100016153 Ga0070713_1000161537 184
76 3300005436 Ga0070713_100520771 Ga0070713_1005207712 184
77 3300005437 Ga0070710_10385355 Ga0070710_103853552 184
78 3300005440 Ga0070705_100011513 Ga0070705_1000115133 184
79 3300005440 Ga0070705_100053430 Ga0070705_1000534303 184
80 3300005444 Ga0070694_100288156 Ga0070694_1002881562 184
81 3300005445 Ga0070708_100000079 Ga0070708_10000007967 184
82 3300005445 Ga0070708_100014936 Ga0070708_1000149367 184
83 3300005445 Ga0070708_100026908 Ga0070708_1000269083 184
84 3300005445 Ga0070708_100103057 Ga0070708_1001030571 184
85 3300005445 Ga0070708_100266582 Ga0070708_1002665823 184
86 3300005467 Ga0070706_100000056 Ga0070706_10000005660 184
87 3300005467 Ga0070706_100000275 Ga0070706_10000027567 184
88 3300005467 Ga0070706_100000738 Ga0070706_10000073822 184
89 3300005467 Ga0070706_100002544 Ga0070706_10000254413 184
90 3300005467 Ga0070706_100150359 Ga0070706_1001503593 184
91 3300005467 Ga0070706_100386762 Ga0070706_1003867622 184
92 3300005467 Ga0070706_100830919 Ga0070706_1008309191 184
93 3300005467 Ga0070706_100841616 Ga0070706_1008416162 184
94 3300005467 Ga0070706_100959442 Ga0070706_1009594421 184
95 3300005468 Ga0070707_100000177 Ga0070707_1000001777 184
96 3300005468 Ga0070707_100001567 Ga0070707_10000156714 184
97 3300005468 Ga0070707_100006915 Ga0070707_1000069154 184
98 3300005468 Ga0070707_100079735 Ga0070707_1000797354 184
99 3300005468 Ga0070707_100091420 Ga0070707_1000914204 184
100 3300005468 Ga0070707_100112988 Ga0070707_1001129883 184
101 3300005468 Ga0070707_100191991 Ga0070707_1001919911 184
102 3300005468 Ga0070707_100428013 Ga0070707_1004280132 184
103 3300005468 Ga0070707_100518988 Ga0070707_1005189882 184
104 3300005468 Ga0070707_100564294 Ga0070707_1005642942 184
105 3300005468 Ga0070707_100640577 Ga0070707_1006405772 184
106 3300005468 Ga0070707_100651492 Ga0070707_1006514922 184
107 3300005468 Ga0070707_100878691 Ga0070707_1008786912 184
108 3300005468 Ga0070707_101069754 Ga0070707_1010697541 184
109 3300005471 Ga0070698_100007481 Ga0070698_1000074819 184
110 3300005471 Ga0070698_100008857 Ga0070698_1000088574 184
111 3300005471 Ga0070698_100010710 Ga0070698_1000107107 184
112 3300005471 Ga0070698_100086059 Ga0070698_1000860593 184
113 3300005471 Ga0070698_100128398 Ga0070698_1001283984 184
114 3300005471 Ga0070698_100563746 Ga0070698_1005637462 184
115 3300005471 Ga0070698_100832388 Ga0070698_1008323881 184
116 3300005518 Ga0070699_100000133 Ga0070699_10000013364 184
117 3300005518 Ga0070699_100000981 Ga0070699_10000098121 184
118 3300005518 Ga0070699_100029922 Ga0070699_1000299221 184
119 3300005518 Ga0070699_100057453 Ga0070699_1000574533 184
120 3300005518 Ga0070699_100150715 Ga0070699_1001507152 184
121 3300005518 Ga0070699_100327933 Ga0070699_1003279332 184
122 3300005518 Ga0070699_100389827 Ga0070699_1003898272 184
123 3300005518 Ga0070699_100524917 Ga0070699_1005249171 184
124 3300005518 Ga0070699_100653780 Ga0070699_1006537801 184
125 3300005518 Ga0070699_100964364 Ga0070699_1009643642 184
126 3300005536 Ga0070697_100000033 Ga0070697_10000003343 184
127 3300005536 Ga0070697_100023518 Ga0070697_1000235181 184
128 3300005536 Ga0070697_100047232 Ga0070697_1000472324 184
129 3300005536 Ga0070697_100079889 Ga0070697_1000798893 184
130 3300005536 Ga0070697_100110273 Ga0070697_1001102731 184
131 3300005536 Ga0070697_100176913 Ga0070697_1001769132 184
132 3300005536 Ga0070697_100823031 Ga0070697_1008230312 184
133 3300005536 Ga0070697_100967522 Ga0070697_1009675221 184
134 3300005545 Ga0070695_100014823 Ga0070695_1000148231 184
135 3300005545 Ga0070695_100188850 Ga0070695_1001888502 184
136 3300005545 Ga0070695_100362189 Ga0070695_1003621892 184
137 3300005546 Ga0070696_100587053 Ga0070696_1005870531 184
138 3300005549 Ga0070704_100029573 Ga0070704_1000295733 184
139 3300005841 Ga0068863_101264922 Ga0068863_1012649221 184
140 3300006028 Ga0070717_10000067 Ga0070717_100000674 184
141 3300006028 Ga0070717_10000520 Ga0070717_1000052013 184
142 3300006028 Ga0070717_10000997 Ga0070717_100009978 184
143 3300006028 Ga0070717_10012795 Ga0070717_100127956 184
144 3300006028 Ga0070717_10501404 Ga0070717_105014041 184
145 3300006028 Ga0070717_10782666 Ga0070717_107826662 184
146 3300006058 Ga0075432_10052355 Ga0075432_100523552 184
147 3300006173 Ga0070716_100026128 Ga0070716_1000261284 184
148 3300006173 Ga0070716_100026419 Ga0070716_1000264192 184
149 3300006844 Ga0075428_100095097 Ga0075428_1000950975 184
150 3300006844 Ga0075428_100378796 Ga0075428_1003787962 184
151 3300006852 Ga0075433_10012576 Ga0075433_100125762 184
152 3300006852 Ga0075433_10378053 Ga0075433_103780531 184
153 3300006871 Ga0075434_100155083 Ga0075434_1001550833 184
154 3300006871 Ga0075434_101060675 Ga0075434_1010606752 184
155 3300006914 Ga0075436_100005234 Ga0075436_1000052345 184
156 3300006914 Ga0075436_100030091 Ga0075436_1000300912 184
157 3300006914 Ga0075436_100038566 Ga0075436_1000385661 184
158 3300006914 Ga0075436_100196915 Ga0075436_1001969152 184
159 3300006914 Ga0075436_100278130 Ga0075436_1002781302 184
160 3300006914 Ga0075436_100856227 Ga0075436_1008562271 184
161 3300007076 Ga0075435_100054330 Ga0075435_1000543303 184
162 3300007076 Ga0075435_100420850 Ga0075435_1004208502 184
163 3300007265 Ga0099794_10000904 Ga0099794_100009046 184
164 3300009093 Ga0105240_10194920 Ga0105240_101949203 184
165 3300009147 Ga0114129_10673692 Ga0114129_106736921 184
166 3300009545 Ga0105237_10577706 Ga0105237_105777062 184
167 3300010159 Ga0099796_10011942 Ga0099796_100119422 184
168 3300020080 Ga0206350_10341234 Ga0206350_103412341 184
169 3300020080 Ga0206350_10353207 Ga0206350_103532072 184
170 3300022467 Ga0224712_10050124 Ga0224712_100501241 184
171 3300025885 Ga0207653_10003156 Ga0207653_100031565 184
172 3300025906 Ga0207699_10000030 Ga0207699_100000305 184
173 3300025906 Ga0207699_10323663 Ga0207699_103236632 184
174 3300025910 Ga0207684_10000014 Ga0207684_1000001473 184
175 3300025910 Ga0207684_10000166 Ga0207684_1000016659 184
176 3300025910 Ga0207684_10000357 Ga0207684_100003577 184
177 3300025910 Ga0207684_10000385 Ga0207684_1000038553 184
178 3300025910 Ga0207684_10002412 Ga0207684_100024126 184
179 3300025910 Ga0207684_10056372 Ga0207684_100563723 184
180 3300025910 Ga0207684_10185519 Ga0207684_101855192 184
181 3300025922 Ga0207646_10000113 Ga0207646_1000011334 184
182 3300025922 Ga0207646_10000350 Ga0207646_100003507 184
183 3300025922 Ga0207646_10002921 Ga0207646_100029211 184
184 3300025922 Ga0207646_10006673 Ga0207646_100066732 184
185 3300025922 Ga0207646_10019971 Ga0207646_100199715 184
186 3300025922 Ga0207646_10026495 Ga0207646_100264951 184
187 3300025922 Ga0207646_10029454 Ga0207646_100294543 184
188 3300025922 Ga0207646_10051369 Ga0207646_100513692 184
189 3300025922 Ga0207646_10065040 Ga0207646_100650404 184
190 3300025922 Ga0207646_10076949 Ga0207646_100769494 184
191 3300025922 Ga0207646_10131350 Ga0207646_101313502 184
192 3300025928 Ga0207700_10011655 Ga0207700_100116557 184
193 3300025928 Ga0207700_10182208 Ga0207700_101822082 184
194 3300025929 Ga0207664_10000005 Ga0207664_10000005344 184
195 3300025929 Ga0207664_10013810 Ga0207664_100138105 184
196 3300025929 Ga0207664_10035932 Ga0207664_100359324 184
197 3300025929 Ga0207664_10075091 Ga0207664_100750912 184
198 3300025929 Ga0207664_10310042 Ga0207664_103100422 184
199 3300025929 Ga0207664_10383335 Ga0207664_103833352 184
200 3300025929 Ga0207664_10394801 Ga0207664_103948012 184
201 3300025929 Ga0207664_10793738 Ga0207664_107937381 184
202 3300025939 Ga0207665_10031466 Ga0207665_100314662 184
203 3300025939 Ga0207665_10040428 Ga0207665_100404282 184
204 3300026088 Ga0207641_10757288 Ga0207641_107572881 184
205 3300027671 Ga0209588_1004228 Ga0209588_10042284 184
206 3300031665 Ga0316575_10197767 Ga0316575_101977672 184
207 3300031691 Ga0316579_10074908 Ga0316579_100749082 184
208 3300031727 Ga0316576_10005175 Ga0316576_100051756 184
209 3300031733 Ga0316577_10027765 Ga0316577_100277653 184
210 3300032168 Ga0316593_10005405 Ga0316593_100054054 184
211 3300035398 Ga0316574_0000055 Ga0316574_0000055_12794_13351 184
212 3300036647 Ga0316582_0006472 Ga0316582_0006472_2727_3284 184
213 3300036712 Ga0316584_0023511 Ga0316584_0023511_165_722 184
214 3300036712 Ga0316584_0195901 Ga0316584_0195901_710_1267 184
215 3300038996 Ga0242420_026755 Ga0242420_026755_376_933 184
216 3300039438 Ga0436360_0852207 Ga0436360_0852207_1836_2432 184
217 3300044656 Ga0466969_0004201 Ga0466969_0004201_5755_6351 184
218 3300044673 Ga0453683_0000145 Ga0453683_0000145_50447_51007 184
219 3300044673 Ga0453683_0085475 Ga0453683_0085475_140_697 184
220 3300044712 Ga0453684_0000424 Ga0453684_0000424_131336_131896 184
221 3300044735 Ga0466968_0058430 Ga0466968_0058430_746_1303 184
222 3300045051 Ga0451576_0044612 Ga0451576_0044612_3702_4262 184
223 3300045051 Ga0451576_0237797 Ga0451576_0237797_257_814 184
224 3300045836 Ga0466958_0447888 Ga0466958_0447888_168_725 184
225 3300048903 Ga0496100_0339721 Ga0496100_0339721_97_654 184
226 3300049586 Ga0501070_0782579 Ga0501070_0782579_70_642 184
227 3300049589 Ga0501073_0346821 Ga0501073_0346821_345_917 184
228 3300049590 Ga0501074_0093526 Ga0501074_0093526_113_685 184
229 3300049742 Ga0501080_0387089 Ga0501080_0387089_345_917 184
230 3300050509 nmdc:mga0qj67_325542_c1 nmdc:mga0qj67_325542_c1_623_1180 184
231 3300050512 nmdc:mga0n895_190521_c1 nmdc:mga0n895_190521_c1_360_920 184
232 3300050512 nmdc:mga0n895_789494_c1 nmdc:mga0n895_789494_c1_274_831 184
233 3300050513 nmdc:mga0rr50_52127_c1 nmdc:mga0rr50_52127_c1_298_855 184
234 3300050513 nmdc:mga0rr50_96994_c1 nmdc:mga0rr50_96994_c1_174_731 184
235 3300050514 nmdc:mga08x19_211235_c1 nmdc:mga08x19_211235_c1_331_888 184
236 3300050514 nmdc:mga08x19_33629_c1 nmdc:mga08x19_33629_c1_2003_2560 184
237 3300050514 nmdc:mga08x19_82444_c1 nmdc:mga08x19_82444_c1_666_1223 184
238 3300050514 nmdc:mga08x19_9494_c1 nmdc:mga08x19_9494_c1_4263_4820 184
239 3300050515 nmdc:mga0a205_13645_c1 nmdc:mga0a205_13645_c1_154_711 184
240 3300050515 nmdc:mga0a205_261688_c1 nmdc:mga0a205_261688_c1_667_1224 184
241 3300050515 nmdc:mga0a205_386331_c1 nmdc:mga0a205_386331_c1_200_757 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01765

RRF

Ribosome recycling factor

49

212

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lhp-assembly2.cif.gz_T crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex 0.9569 104 182
6vud-assembly1.cif.gz_B crystal structure of a ribosome recycling factor from ehrlichia chaffeensis 0.9468 3 182
3lf9-assembly1.cif.gz_A crystal structure of hiv epitope-scaffold 4e10_d0_1is1a_001_c 0.9299 1 184
5wp3-assembly1.cif.gz_B crystal structure of eed in complex with eb22 0.9286 1 181
4woi-assembly1.cif.gz_AV 4,5-linked aminoglycoside antibiotics regulate the bacterial ribosome by targeting dynamic conformational processes within intersubunit bridge b2 0.9274 2 182
ID Description Score Start End Superfamily
4gd1Y01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9848 105 182 1.10.132.20
af_P9WGY1_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9689 30 104 3.30.1360.40
1wqhA01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9689 1 182 1.10.132.20
4kc6A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9678 1 178 1.10.132.20
1ek8A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9668 1 184 1.10.132.20
ID Description Score Start End GO Terms
AF-A0A7C6N339-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9839 3 184 GO:0005737
GO:0006415
GO:0043023
AF-A0A1J0U034-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9803 3 184 GO:0005737
GO:0006415
GO:0043023
AF-A0A7S3ZZ80-F1-model_v4 Ribosome recycling factor domain-containing protein 0.978 4 184 GO:0005739
GO:0006412
GO:0043023
AF-A0A287HR89-F1-model_v4 deleted 0.9753 13 184
AF-A0A250XKF6-F1-model_v4 Ribosome-recycling factor, chloroplastic (Ribosome-releasing factor, chloroplastic) 0.974 3 184 GO:0005739
GO:0006412
GO:0043023

Feature Viewer

pLDDT pTM Quality
83.66 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map