F353000

General Info

Members Datasets Scaffolds Average Seq Length
240 171 240 387

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10023231|Ga0307405_100232313
Length 469
Sequence MAYEFKLPDIGEGVVEGEVVSWKVAVGERIVVDQPLVEIMTDKATVEIPSPRAGVVRMLGFKEGDICPVGAVLVVIEEGDKPSSSAGTTLDQAPSANLGRKRPASDDRPTLRMSMDGAVARERVKATPATRRLARELGVELGHVEPTGKRGRVTTDDVRRVVDTSPTQRGFEQPAATHQAPTQPVGPRPGTRPAAAQQAKAQHSDEPTLVTLRVPESAGPPAPVREHAPVAVASQGAEERIPFRGLRKRIADNMVRSRHTAAHFTYVEEVDMTDLVEVRDRARQRAADRGLKLTFLPFLIKAVVSGLKRWPQLNAALDETTQEIVRKKYYHIGIASQGPQGLMVTVLRDADRRSIFDLAAEIQRLAQAVQDGNVRREELTGSTFTITSLGKLGGVLATPILNFPEVGIIGVHEMKQRPAVHNGEIVIRWLMNLSISLDHRLVDGWDGAMFLQEVKSLLEDPTTMFLEMV

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
93 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
100 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
117 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
118 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
121 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
135 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
136 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
137 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
155 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
158 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
167 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
168 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
169 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
170 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0
Rhizoplane 0
Rhizosphere 92.5
Stem 0
Stem Tuber 0
Unclassified 5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10168151 3300003323 Bacteria 2805
2 Ga0070683_100053654 3300005329 Bacteria 3736
3 Ga0070690_100020334 3300005330 Bacteria 4044
4 Ga0070690_100021322 3300005330 Bacteria 3954
5 Ga0068869_100018482 3300005334 Bacteria 4746
6 Ga0068869_100075681 3300005334 Bacteria 2502
7 Ga0070680_100000519 3300005336 Bacteria 26424
8 Ga0070682_100046181 3300005337 Bacteria 2702
9 Ga0070660_100004537 3300005339 Bacteria 9597
10 Ga0070661_100004858 3300005344 Bacteria 9256
11 Ga0070669_100026734 3300005353 Bacteria 4152
12 Ga0070667_100005887 3300005367 Bacteria 10212
13 Ga0070701_10066562 3300005438 Bacteria 1915
14 Ga0070711_100049193 3300005439 Bacteria 2887
15 Ga0070700_100071851 3300005441 Bacteria 2210
16 Ga0070694_100083883 3300005444 Bacteria 2221
17 Ga0070681_10000619 3300005458 Bacteria 29107
18 Ga0070681_10050664 3300005458 Bacteria 4143
19 Ga0068867_100010388 3300005459 Bacteria 6569
20 Ga0070706_100000243 3300005467 Bacteria 66436
21 Ga0070698_100003104 3300005471 Bacteria 18306
22 Ga0070679_100001338 3300005530 Bacteria 21747
23 Ga0070679_100033607 3300005530 Bacteria 5079
24 Ga0070672_100023973 3300005543 Bacteria 4501
25 Ga0070672_100033926 3300005543 Bacteria 3868
26 Ga0070672_100102791 3300005543 Bacteria 2320
27 Ga0070696_100012964 3300005546 Bacteria 5596
28 Ga0070665_100105653 3300005548 Bacteria 2818
29 Ga0070665_100192107 3300005548 Bacteria 2042
30 Ga0068855_100005710 3300005563 Bacteria 15198
31 Ga0068855_100016169 3300005563 Bacteria 8970
32 Ga0068854_100096401 3300005578 Bacteria 2210
33 Ga0068856_100026601 3300005614 Bacteria 5642
34 Ga0068856_100183474 3300005614 Bacteria 2106
35 Ga0070702_100011612 3300005615 Bacteria 4386
36 Ga0068860_100053547 3300005843 Bacteria 3837
37 Ga0068862_100036432 3300005844 Bacteria 4170
38 Ga0081455_10002953 3300005937 Bacteria 19885
39 Ga0070717_10026048 3300006028 Bacteria 4660
40 Ga0070717_10034935 3300006028 Bacteria 4066
41 Ga0075430_100191782 3300006846 Bacteria 1698
42 Ga0075431_100169534 3300006847 Bacteria 2243
43 Ga0075429_100029302 3300006880 Bacteria 4781
44 Ga0068865_100001388 3300006881 Bacteria 14068
45 Ga0099794_10000078 3300007265 Bacteria 36028
46 Ga0105240_10000921 3300009093 Bacteria 52415
47 Ga0111539_10035202 3300009094 Bacteria 6064
48 Ga0111539_10066210 3300009094 Bacteria 4267
49 Ga0105245_10018884 3300009098 Bacteria 6033
50 Ga0114129_10129644 3300009147 Bacteria 3466
51 Ga0114129_10221385 3300009147 Bacteria 2553
52 Ga0105243_10013823 3300009148 Bacteria 6109
53 Ga0105242_10007443 3300009176 Bacteria 8430
54 Ga0105248_10053140 3300009177 Bacteria 4546
55 Ga0105249_10058566 3300009553 Bacteria 3530
56 Ga0105246_10004012 3300011119 Bacteria 8936
57 Ga0157370_10000715 3300013104 Bacteria 41556
58 Ga0157369_10004931 3300013105 Bacteria 15632
59 Ga0157378_10111444 3300013297 Bacteria 2509
60 Ga0157377_10004622 3300014745 Bacteria 6366
61 Ga0157376_10101911 3300014969 Bacteria 2510
62 Ga0213876_10020546 3300021384 Bacteria 3490
63 Ga0207688_10004726 3300025901 Bacteria 7416
64 Ga0207645_10007343 3300025907 Bacteria 7791
65 Ga0207684_10000113 3300025910 Bacteria 150344
66 Ga0207707_10000038 3300025912 Bacteria 143359
67 Ga0207695_10023205 3300025913 Bacteria 7019
68 Ga0207660_10020331 3300025917 Bacteria 4452
69 Ga0207660_10045110 3300025917 Bacteria 3104
70 Ga0207657_10004620 3300025919 Bacteria 14541
71 Ga0207649_10007600 3300025920 Bacteria 5894
72 Ga0207652_10095000 3300025921 Bacteria 2625
73 Ga0207659_10012339 3300025926 Bacteria 5434
74 Ga0207687_10000230 3300025927 Bacteria 38174
75 Ga0207687_10006541 3300025927 Bacteria 7694
76 Ga0207690_10184531 3300025932 Bacteria 1573
77 Ga0207706_10000113 3300025933 Bacteria 87078
78 Ga0207709_10009860 3300025935 Bacteria 5257
79 Ga0207670_10016374 3300025936 Bacteria 4454
80 Ga0207669_10016129 3300025937 Bacteria 3787
81 Ga0207691_10007905 3300025940 Bacteria 10241
82 Ga0207691_10019282 3300025940 Bacteria 6456
83 Ga0207689_10044176 3300025942 Bacteria 3683
84 Ga0207689_10051271 3300025942 Bacteria 3401
85 Ga0207689_10223294 3300025942 Bacteria 1557
86 Ga0207661_10070751 3300025944 Bacteria 2849
87 Ga0207667_10005680 3300025949 Bacteria 15206
88 Ga0207667_10009653 3300025949 Bacteria 11352
89 Ga0207667_10009751 3300025949 Bacteria 11292
90 Ga0207668_10104093 3300025972 Bacteria 2115
91 Ga0207658_10041385 3300025986 Bacteria 3336
92 Ga0207708_10001185 3300026075 Bacteria 19625
93 Ga0207702_10058189 3300026078 Archaea 3288
94 Ga0207641_10042950 3300026088 Bacteria 3794
95 Ga0207641_10142095 3300026088 Bacteria 2167
96 Ga0207648_10001447 3300026089 Bacteria 26146
97 Ga0207674_10304547 3300026116 Bacteria 1543
98 Ga0207683_10078201 3300026121 Bacteria 2931
99 Ga0209973_1000524 3300027252 Bacteria 2930
100 Ga0209996_1000194 3300027395 Bacteria 7807
101 Ga0209995_1000281 3300027471 Bacteria 8022
102 Ga0209968_1000072 3300027526 Bacteria 18128
103 Ga0210002_1000340 3300027617 Bacteria 6387
104 Ga0209588_1000004 3300027671 Bacteria 228800
105 Ga0209971_1002518 3300027682 Bacteria 4394
106 Ga0209966_1000359 3300027695 Bacteria 13919
107 Ga0209998_10000602 3300027717 Bacteria 9649
108 Ga0209974_10001781 3300027876 Bacteria 7857
109 Ga0209974_10004701 3300027876 Bacteria 4849
110 Ga0207428_10031763 3300027907 Bacteria 4352
111 Ga0207428_10042234 3300027907 Bacteria 3687
112 Ga0268266_10006393 3300028379 Bacteria 10795
113 Ga0268264_10207186 3300028381 Bacteria 1798
114 Ga0265319_1000055 3300028563 Bacteria 89661
115 Ga0265319_1008365 3300028563 Bacteria 4545
116 Ga0265334_10039499 3300028573 Bacteria 1852
117 Ga0265318_10000027 3300028577 Bacteria 153682
118 Ga0265318_10000239 3300028577 Bacteria 47921
119 Ga0265318_10004507 3300028577 Bacteria 6737
120 Ga0307515_10015429 3300028794 Bacteria 14077
121 Ga0265338_10033063 3300028800 Bacteria 5028
122 Ga0265338_10137491 3300028800 Bacteria 1918
123 Ga0265330_10000036 3300031235 Bacteria 121416
124 Ga0265330_10000208 3300031235 Bacteria 45603
125 Ga0265330_10011004 3300031235 Bacteria 4247
126 Ga0265332_10000066 3300031238 Bacteria 89999
127 Ga0265332_10000399 3300031238 Bacteria 31504
128 Ga0265332_10001924 3300031238 Bacteria 10994
129 Ga0265332_10010188 3300031238 Bacteria 4184
130 Ga0265328_10004606 3300031239 Bacteria 5969
131 Ga0265320_10000018 3300031240 Bacteria 183411
132 Ga0265320_10000093 3300031240 Bacteria 74621
133 Ga0265320_10026780 3300031240 Bacteria 3013
134 Ga0265325_10000186 3300031241 Bacteria 44210
135 Ga0265329_10000009 3300031242 Bacteria 74040
136 Ga0265340_10000526 3300031247 Bacteria 21115
137 Ga0265340_10000607 3300031247 Bacteria 20008
138 Ga0265339_10005009 3300031249 Bacteria 8913
139 Ga0265339_10033945 3300031249 Bacteria 2870
140 Ga0265331_10000046 3300031250 Bacteria 183360
141 Ga0265331_10000467 3300031250 Bacteria 38771
142 Ga0265331_10003501 3300031250 Bacteria 10112
143 Ga0265316_10000154 3300031344 Bacteria 76008
144 Ga0265316_10000615 3300031344 Bacteria 39611
145 Ga0265316_10001871 3300031344 Bacteria 22114
146 Ga0265316_10010882 3300031344 Bacteria 8260
147 Ga0307513_10006138 3300031456 Bacteria 15767
148 Ga0307509_10000052 3300031507 Bacteria 164947
149 Ga0307509_10003287 3300031507 Bacteria 24839
150 Ga0307509_10061645 3300031507 Bacteria 3958
151 Ga0307509_10070482 3300031507 Bacteria 3650
152 Ga0265313_10000064 3300031595 Bacteria 103797
153 Ga0265313_10000287 3300031595 Bacteria 55386
154 Ga0265313_10001158 3300031595 Bacteria 25185
155 Ga0307508_10002985 3300031616 Bacteria 17449
156 Ga0265314_10000137 3300031711 Bacteria 109629
157 Ga0265314_10000184 3300031711 Bacteria 92453
158 Ga0265342_10000140 3300031712 Bacteria 80974
159 Ga0307516_10010319 3300031730 Bacteria 10281
160 Ga0307516_10014642 3300031730 Bacteria 8286
161 Ga0307405_10023231 3300031731 Bacteria 3521
162 Ga0307416_100245726 3300032002 Bacteria 1738
163 Ga0373950_0000003 3300034818 Bacteria 541085
164 Ga0373958_0004876 3300034819 Bacteria 2009
165 Ga0373949_0000309 3300035090 Bacteria 17527
166 Ga0373936_0000037 3300035113 Bacteria 98939
167 Ga0373941_0009736 3300035115 Bacteria 2428
168 Ga0373961_0000207 3300035241 Bacteria 27765
169 Ga0373931_0012165 3300035691 Bacteria 4166
170 Ga0373937_0132097 3300036401 Bacteria 2332
171 Ga0395899_0016756 3300037312 Bacteria 5587
172 Ga0395900_0006277 3300037418 Bacteria 12401
173 Ga0395905_0084378 3300037471 Bacteria 2976
174 Ga0395901_0096211 3300038443 Bacteria 3103
175 Ga0436365_1073667 3300039437 Bacteria 6786
176 Ga0439432_006759 3300042006 Bacteria 4084
177 Ga0451577_0033820 3300042876 Bacteria 4609
178 Ga0453683_0000453 3300044673 Bacteria 47152
179 Ga0453684_0015428 3300044712 Bacteria 12088
180 Ga0451576_0033937 3300045051 Bacteria 5421
181 Ga0451576_0113108 3300045051 Bacteria 2825
182 Ga0451576_0137532 3300045051 Bacteria 2548
183 Ga0451576_0140255 3300045051 Bacteria 2521
184 Ga0451576_0159376 3300045051 Bacteria 2354
185 Ga0501291_001272 3300049514 Bacteria 2919
186 Ga0501295_003738 3300049518 Bacteria 1905
187 Ga0501298_002373 3300049521 Bacteria 2841
188 Ga0501299_004815 3300049522 Bacteria 2042
189 Ga0501299_005215 3300049522 Bacteria 1986
190 Ga0501031_0001448 3300049568 Bacteria 14734
191 Ga0501031_0012122 3300049568 Bacteria 5620
192 Ga0501036_0026969 3300049572 Bacteria 4855
193 Ga0501036_0051160 3300049572 Bacteria 3498
194 Ga0501036_0083499 3300049572 Bacteria 2700
195 Ga0501036_0087197 3300049572 Bacteria 2638
196 Ga0501037_0013950 3300049573 Bacteria 5923
197 Ga0501037_0047609 3300049573 Bacteria 3141
198 Ga0501038_0022613 3300049574 Bacteria 5631
199 Ga0501038_0119635 3300049574 Bacteria 2174
200 Ga0501039_0012675 3300049575 Bacteria 6443
201 Ga0501039_0019062 3300049575 Bacteria 5263
202 Ga0501041_0002980 3300049577 Bacteria 9709
203 Ga0501041_0052754 3300049577 Bacteria 2479
204 Ga0501042_0002168 3300049578 Bacteria 11950
205 Ga0501042_0007594 3300049578 Bacteria 7113
206 Ga0501046_0028425 3300049580 Bacteria 4553
207 Ga0501046_0029261 3300049580 Bacteria 4478
208 Ga0501047_0025841 3300049581 Bacteria 5647
209 Ga0501048_0009389 3300049582 Bacteria 7344
210 Ga0501067_0000092 3300049583 Bacteria 52348
211 Ga0501070_0102158 3300049586 Bacteria 2371
212 Ga0501071_0069719 3300049587 Bacteria 2561
213 Ga0501071_0109116 3300049587 Unclassified 2044
214 Ga0501072_0065364 3300049588 Bacteria 2868
215 Ga0501073_0000088 3300049589 Bacteria 58271
216 Ga0501073_0115037 3300049589 Bacteria 1865
217 Ga0501076_0005596 3300049592 Bacteria 9051
218 Ga0501227_000512 3300049665 Bacteria 8324
219 Ga0501221_008108 3300049704 Bacteria 1819
220 Ga0501080_0402242 3300049742 Archaea 1232
221 Ga0501266_004078 3300049763 Bacteria 1807
222 Ga0501279_002936 3300049775 Bacteria 2220
223 Ga0501035_0038344 3300049822 Bacteria 4339
224 Ga0501035_0088021 3300049822 Bacteria 2737
225 Ga0501044_0007055 3300049823 Bacteria 12362
226 nmdc:mga09592_189590_c1 3300050508 Bacteria 1780
227 nmdc:mga09592_33367_c1 3300050508 Bacteria 4296
228 nmdc:mga09592_41240_c1 3300050508 Bacteria 3881
229 nmdc:mga0qj67_126089_c1 3300050509 Bacteria 2072
230 nmdc:mga0qj67_55806_c1 3300050509 Bacteria 3130
231 nmdc:mga08y16_68413_c1 3300050511 Bacteria 3703
232 nmdc:mga0rr50_18126_c1 3300050513 Bacteria 4721
233 nmdc:mga0a205_9713_c1 3300050515 Bacteria 8812
234 Ga0500640_000129 3300053095 Bacteria 14473
235 Ga0500572_002774 3300053111 Bacteria 4134
236 Ga0500595_001594 3300053119 Bacteria 11965
237 Ga0500614_000066 3300053123 Bacteria 22909
238 Ga0500568_0007991 3300053139 Bacteria 5137
239 Ga0500568_0016555 3300053139 Bacteria 3274
240 Ga0501084_0107073 3300054114 Bacteria 2349

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_0107073 Ga0501084_0107073_1001_2323 321
2 3300049578 Ga0501042_0002168 Ga0501042_0002168_6295_7716 325
3 3300045051 Ga0451576_0113108 Ga0451576_0113108_607_2037 326
4 3300049568 Ga0501031_0012122 Ga0501031_0012122_475_1896 326
5 3300049572 Ga0501036_0051160 Ga0501036_0051160_647_2068 326
6 3300049573 Ga0501037_0013950 Ga0501037_0013950_1670_3091 326
7 3300049574 Ga0501038_0022613 Ga0501038_0022613_503_1924 326
8 3300049577 Ga0501041_0002980 Ga0501041_0002980_4534_5955 326
9 3300049580 Ga0501046_0029261 Ga0501046_0029261_1182_2603 326
10 3300049588 Ga0501072_0065364 Ga0501072_0065364_169_1590 326
11 3300049822 Ga0501035_0038344 Ga0501035_0038344_1397_2818 326
12 3300049582 Ga0501048_0009389 Ga0501048_0009389_2002_3423 328
13 3300049592 Ga0501076_0005596 Ga0501076_0005596_3705_5126 328
14 3300028573 Ga0265334_10039499 Ga0265334_100394992 330
15 3300031235 Ga0265330_10011004 Ga0265330_100110044 330
16 3300031238 Ga0265332_10000399 Ga0265332_100003995 330
17 3300031239 Ga0265328_10004606 Ga0265328_100046062 330
18 3300031249 Ga0265339_10033945 Ga0265339_100339452 330
19 3300031250 Ga0265331_10003501 Ga0265331_100035014 330
20 3300031344 Ga0265316_10010882 Ga0265316_100108825 330
21 3300005439 Ga0070711_100049193 Ga0070711_1000491932 331
22 3300005330 Ga0070690_100021322 Ga0070690_1000213222 332
23 3300005353 Ga0070669_100026734 Ga0070669_1000267342 332
24 3300005441 Ga0070700_100071851 Ga0070700_1000718512 332
25 3300005458 Ga0070681_10050664 Ga0070681_100506642 332
26 3300005459 Ga0068867_100010388 Ga0068867_1000103881 332
27 3300005546 Ga0070696_100012964 Ga0070696_1000129642 332
28 3300005548 Ga0070665_100105653 Ga0070665_1001056532 332
29 3300005578 Ga0068854_100096401 Ga0068854_1000964012 332
30 3300005843 Ga0068860_100053547 Ga0068860_1000535472 332
31 3300005844 Ga0068862_100036432 Ga0068862_1000364322 332
32 3300006881 Ga0068865_100001388 Ga0068865_10000138813 332
33 3300011119 Ga0105246_10004012 Ga0105246_100040129 332
34 3300013297 Ga0157378_10111444 Ga0157378_101114442 332
35 3300025933 Ga0207706_10000113 Ga0207706_1000011367 332
36 3300025937 Ga0207669_10016129 Ga0207669_100161292 332
37 3300026089 Ga0207648_10001447 Ga0207648_1000144712 332
38 3300027252 Ga0209973_1000524 Ga0209973_10005242 332
39 3300027617 Ga0210002_1000340 Ga0210002_10003406 332
40 3300027695 Ga0209966_1000359 Ga0209966_10003597 332
41 3300027717 Ga0209998_10000602 Ga0209998_100006027 332
42 3300027876 Ga0209974_10001781 Ga0209974_100017818 332
43 3300034819 Ga0373958_0004876 Ga0373958_0004876_231_1661 332
44 3300035691 Ga0373931_0012165 Ga0373931_0012165_1190_2620 332
45 3300005530 Ga0070679_100033607 Ga0070679_1000336072 334
46 3300005543 Ga0070672_100102791 Ga0070672_1001027911 334
47 3300006847 Ga0075431_100169534 Ga0075431_1001695342 334
48 3300014745 Ga0157377_10004622 Ga0157377_100046226 334
49 3300025901 Ga0207688_10004726 Ga0207688_100047267 334
50 3300025921 Ga0207652_10095000 Ga0207652_100950002 334
51 3300025942 Ga0207689_10044176 Ga0207689_100441762 334
52 3300027395 Ga0209996_1000194 Ga0209996_10001942 334
53 3300027471 Ga0209995_1000281 Ga0209995_10002812 334
54 3300027526 Ga0209968_1000072 Ga0209968_100007211 334
55 3300027682 Ga0209971_1002518 Ga0209971_10025182 334
56 3300027907 Ga0207428_10031763 Ga0207428_100317632 334
57 3300045051 Ga0451576_0159376 Ga0451576_0159376_588_2018 334
58 3300049572 Ga0501036_0083499 Ga0501036_0083499_404_1720 334
59 3300049572 Ga0501036_0087197 Ga0501036_0087197_735_2090 334
60 3300049574 Ga0501038_0119635 Ga0501038_0119635_77_1432 334
61 3300049575 Ga0501039_0012675 Ga0501039_0012675_1134_2489 334
62 3300049577 Ga0501041_0052754 Ga0501041_0052754_76_1392 334
63 3300049587 Ga0501071_0069719 Ga0501071_0069719_950_2305 334
64 3300049587 Ga0501071_0109116 Ga0501071_0109116_73_1389 334
65 3300049589 Ga0501073_0115037 Ga0501073_0115037_462_1778 334
66 3300049822 Ga0501035_0088021 Ga0501035_0088021_1145_2500 334
67 3300050508 nmdc:mga09592_189590_c1 nmdc:mga09592_189590_c1_176_1606 334
68 3300050513 nmdc:mga0rr50_18126_c1 nmdc:mga0rr50_18126_c1_522_1952 334
69 3300050515 nmdc:mga0a205_9713_c1 nmdc:mga0a205_9713_c1_4087_5517 334
70 3300025907 Ga0207645_10007343 Ga0207645_100073439 335
71 3300005334 Ga0068869_100018482 Ga0068869_1000184822 337
72 3300005344 Ga0070661_100004858 Ga0070661_1000048583 337
73 3300005367 Ga0070667_100005887 Ga0070667_1000058878 337
74 3300005444 Ga0070694_100083883 Ga0070694_1000838832 337
75 3300005543 Ga0070672_100033926 Ga0070672_1000339263 337
76 3300005615 Ga0070702_100011612 Ga0070702_1000116124 337
77 3300006846 Ga0075430_100191782 Ga0075430_1001917821 337
78 3300009098 Ga0105245_10018884 Ga0105245_100188845 337
79 3300009148 Ga0105243_10013823 Ga0105243_100138232 337
80 3300009176 Ga0105242_10007443 Ga0105242_100074432 337
81 3300009553 Ga0105249_10058566 Ga0105249_100585663 337
82 3300025920 Ga0207649_10007600 Ga0207649_100076004 337
83 3300025926 Ga0207659_10012339 Ga0207659_100123394 337
84 3300025932 Ga0207690_10184531 Ga0207690_101845312 337
85 3300025935 Ga0207709_10009860 Ga0207709_100098602 337
86 3300025940 Ga0207691_10019282 Ga0207691_100192822 337
87 3300025944 Ga0207661_10070751 Ga0207661_100707512 337
88 3300025986 Ga0207658_10041385 Ga0207658_100413852 337
89 3300026075 Ga0207708_10001185 Ga0207708_100011857 337
90 3300045051 Ga0451576_0137532 Ga0451576_0137532_1073_2446 337
91 3300050509 nmdc:mga0qj67_55806_c1 nmdc:mga0qj67_55806_c1_1521_2951 337
92 3300009147 Ga0114129_10221385 Ga0114129_102213852 338
93 3300005937 Ga0081455_10002953 Ga0081455_100029539 339
94 3300009147 Ga0114129_10129644 Ga0114129_101296441 339
95 3300049742 Ga0501080_0402242 Ga0501080_0402242_28_1215 339
96 3300045051 Ga0451576_0033937 Ga0451576_0033937_3238_4653 342
97 3300049573 Ga0501037_0047609 Ga0501037_0047609_1462_2901 342
98 3300005339 Ga0070660_100004537 Ga0070660_1000045376 344
99 3300025919 Ga0207657_10004620 Ga0207657_100046207 344
100 3300049522 Ga0501299_005215 Ga0501299_005215_16_1479 345
101 3300049775 Ga0501279_002936 Ga0501279_002936_250_1713 345
102 3300049521 Ga0501298_002373 Ga0501298_002373_461_1924 346
103 3300049704 Ga0501221_008108 Ga0501221_008108_323_1786 346
104 3300049763 Ga0501266_004078 Ga0501266_004078_235_1698 346
105 3300042006 Ga0439432_006759 Ga0439432_006759_1259_2722 347
106 3300049518 Ga0501295_003738 Ga0501295_003738_21_1484 347
107 3300027876 Ga0209974_10004701 Ga0209974_100047012 348
108 3300049568 Ga0501031_0001448 Ga0501031_0001448_8339_9778 348
109 3300049572 Ga0501036_0026969 Ga0501036_0026969_1151_2590 348
110 3300049575 Ga0501039_0019062 Ga0501039_0019062_2499_3938 348
111 3300049578 Ga0501042_0007594 Ga0501042_0007594_132_1571 348
112 3300049580 Ga0501046_0028425 Ga0501046_0028425_551_1990 348
113 3300025917 Ga0207660_10045110 Ga0207660_100451103 354
114 3300042876 Ga0451577_0033820 Ga0451577_0033820_2875_4023 355
115 3300044712 Ga0453684_0015428 Ga0453684_0015428_5495_6643 355
116 3300053095 Ga0500640_000129 Ga0500640_000129_5764_7086 359
117 3300053111 Ga0500572_002774 Ga0500572_002774_1125_2447 359
118 3300053119 Ga0500595_001594 Ga0500595_001594_5712_7034 359
119 3300053123 Ga0500614_000066 Ga0500614_000066_11196_12518 359
120 3300031240 Ga0265320_10026780 Ga0265320_100267802 361
121 3300009177 Ga0105248_10053140 Ga0105248_100531403 364
122 3300044673 Ga0453683_0000453 Ga0453683_0000453_21158_22306 365
123 3300045051 Ga0451576_0140255 Ga0451576_0140255_276_1577 365
124 3300049514 Ga0501291_001272 Ga0501291_001272_876_2321 365
125 3300006028 Ga0070717_10034935 Ga0070717_100349352 366
126 3300028381 Ga0268264_10207186 Ga0268264_102071862 368
127 3300031507 Ga0307509_10000052 Ga0307509_1000005237 368
128 3300028563 Ga0265319_1008365 Ga0265319_10083653 369
129 3300032002 Ga0307416_100245726 Ga0307416_1002457261 369
130 3300053139 Ga0500568_0016555 Ga0500568_0016555_92_1336 369
131 3300036401 Ga0373937_0132097 Ga0373937_0132097_26_1258 371
132 3300037312 Ga0395899_0016756 Ga0395899_0016756_3946_5187 371
133 3300037418 Ga0395900_0006277 Ga0395900_0006277_1638_2879 371
134 3300038443 Ga0395901_0096211 Ga0395901_0096211_951_2192 371
135 3300035090 Ga0373949_0000309 Ga0373949_0000309_3724_5214 372
136 3300035113 Ga0373936_0000037 Ga0373936_0000037_43603_45009 372
137 3300026088 Ga0207641_10042950 Ga0207641_100429502 374
138 3300031507 Ga0307509_10003287 Ga0307509_1000328725 375
139 3300037471 Ga0395905_0084378 Ga0395905_0084378_150_1469 375
140 3300050508 nmdc:mga09592_33367_c1 nmdc:mga09592_33367_c1_542_1810 375
141 3300005330 Ga0070690_100020334 Ga0070690_1000203343 376
142 3300025972 Ga0207668_10104093 Ga0207668_101040932 376
143 3300028577 Ga0265318_10000027 Ga0265318_1000002795 377
144 3300028800 Ga0265338_10033063 Ga0265338_100330635 377
145 3300031235 Ga0265330_10000036 Ga0265330_1000003611 377
146 3300031238 Ga0265332_10001924 Ga0265332_100019243 377
147 3300031240 Ga0265320_10000018 Ga0265320_1000001868 377
148 3300031250 Ga0265331_10000046 Ga0265331_1000004667 377
149 3300031344 Ga0265316_10001871 Ga0265316_1000187110 377
150 3300031595 Ga0265313_10001158 Ga0265313_1000115810 377
151 3300031711 Ga0265314_10000137 Ga0265314_1000013795 377
152 3300049522 Ga0501299_004815 Ga0501299_004815_535_1836 377
153 3300049665 Ga0501227_000512 Ga0501227_000512_6217_7518 377
154 3300005334 Ga0068869_100075681 Ga0068869_1000756812 378
155 3300005438 Ga0070701_10066562 Ga0070701_100665622 378
156 3300007265 Ga0099794_10000078 Ga0099794_1000007816 378
157 3300025936 Ga0207670_10016374 Ga0207670_100163742 378
158 3300025942 Ga0207689_10051271 Ga0207689_100512712 378
159 3300027671 Ga0209588_1000004 Ga0209588_1000004129 378
160 3300005614 Ga0068856_100026601 Ga0068856_1000266014 379
161 3300026078 Ga0207702_10058189 Ga0207702_100581892 379
162 3300005548 Ga0070665_100192107 Ga0070665_1001921071 380
163 3300028379 Ga0268266_10006393 Ga0268266_100063937 380
164 3300034818 Ga0373950_0000003 Ga0373950_0000003_205511_206812 381
165 3300049583 Ga0501067_0000092 Ga0501067_0000092_8764_10065 381
166 3300049589 Ga0501073_0000088 Ga0501073_0000088_48081_49382 381
167 3300005563 Ga0068855_100016169 Ga0068855_1000161697 382
168 3300025949 Ga0207667_10009751 Ga0207667_1000975110 382
169 3300026088 Ga0207641_10142095 Ga0207641_101420952 382
170 3300035241 Ga0373961_0000207 Ga0373961_0000207_22348_23703 382
171 3300006028 Ga0070717_10026048 Ga0070717_100260483 383
172 3300031238 Ga0265332_10010188 Ga0265332_100101883 383
173 3300005563 Ga0068855_100005710 Ga0068855_1000057102 384
174 3300025949 Ga0207667_10005680 Ga0207667_1000568015 384
175 3300026121 Ga0207683_10078201 Ga0207683_100782013 384
176 3300005336 Ga0070680_100000519 Ga0070680_1000005197 385
177 3300005337 Ga0070682_100046181 Ga0070682_1000461813 385
178 3300005458 Ga0070681_10000619 Ga0070681_1000061928 385
179 3300005471 Ga0070698_100003104 Ga0070698_10000310412 385
180 3300005530 Ga0070679_100001338 Ga0070679_10000133811 385
181 3300005614 Ga0068856_100183474 Ga0068856_1001834741 385
182 3300009093 Ga0105240_10000921 Ga0105240_1000092115 385
183 3300013104 Ga0157370_10000715 Ga0157370_1000071528 385
184 3300013105 Ga0157369_10004931 Ga0157369_100049319 385
185 3300014969 Ga0157376_10101911 Ga0157376_101019112 385
186 3300025912 Ga0207707_10000038 Ga0207707_1000003868 385
187 3300025913 Ga0207695_10023205 Ga0207695_100232056 385
188 3300025917 Ga0207660_10020331 Ga0207660_100203313 385
189 3300025927 Ga0207687_10000230 Ga0207687_1000023027 385
190 3300025949 Ga0207667_10009653 Ga0207667_1000965312 385
191 3300028563 Ga0265319_1000055 Ga0265319_100005537 385
192 3300028577 Ga0265318_10000239 Ga0265318_1000023910 385
193 3300031235 Ga0265330_10000208 Ga0265330_1000020836 385
194 3300031238 Ga0265332_10000066 Ga0265332_1000006629 385
195 3300031240 Ga0265320_10000093 Ga0265320_1000009327 385
196 3300031242 Ga0265329_10000009 Ga0265329_1000000936 385
197 3300031247 Ga0265340_10000526 Ga0265340_100005267 385
198 3300031249 Ga0265339_10005009 Ga0265339_100050092 385
199 3300031250 Ga0265331_10000467 Ga0265331_1000046710 385
200 3300031344 Ga0265316_10000615 Ga0265316_1000061525 385
201 3300031595 Ga0265313_10000064 Ga0265313_1000006437 385
202 3300031711 Ga0265314_10000184 Ga0265314_1000018439 385
203 3300031712 Ga0265342_10000140 Ga0265342_1000014021 385
204 3300049581 Ga0501047_0025841 Ga0501047_0025841_3866_5167 385
205 3300049586 Ga0501070_0102158 Ga0501070_0102158_167_1468 385
206 3300049823 Ga0501044_0007055 Ga0501044_0007055_7974_9275 385
207 3300005329 Ga0070683_100053654 Ga0070683_1000536544 386
208 3300006880 Ga0075429_100029302 Ga0075429_1000293023 386
209 3300025927 Ga0207687_10006541 Ga0207687_100065414 386
210 3300025942 Ga0207689_10223294 Ga0207689_102232942 386
211 3300026116 Ga0207674_10304547 Ga0207674_103045471 386
212 3300031730 Ga0307516_10010319 Ga0307516_100103195 386
213 3300021384 Ga0213876_10020546 Ga0213876_100205462 387
214 3300039437 Ga0436365_1073667 Ga0436365_1073667_1248_2561 387
215 3300050508 nmdc:mga09592_41240_c1 nmdc:mga09592_41240_c1_667_1992 387
216 3300050509 nmdc:mga0qj67_126089_c1 nmdc:mga0qj67_126089_c1_269_1594 387
217 3300028794 Ga0307515_10015429 Ga0307515_100154297 388
218 3300031507 Ga0307509_10061645 Ga0307509_100616453 388
219 3300031730 Ga0307516_10014642 Ga0307516_100146429 389
220 3300009094 Ga0111539_10035202 Ga0111539_100352025 391
221 3300031456 Ga0307513_10006138 Ga0307513_100061385 391
222 3300035115 Ga0373941_0009736 Ga0373941_0009736_1014_2417 392
223 3300005543 Ga0070672_100023973 Ga0070672_1000239733 393
224 3300025940 Ga0207691_10007905 Ga0207691_100079053 393
225 3300031731 Ga0307405_10023231 Ga0307405_100232313 393
226 3300053139 Ga0500568_0007991 Ga0500568_0007991_1168_2451 393
227 3300031616 Ga0307508_10002985 Ga0307508_100029852 394
228 3300005467 Ga0070706_100000243 Ga0070706_10000024335 395
229 3300009094 Ga0111539_10066210 Ga0111539_100662102 395
230 3300025910 Ga0207684_10000113 Ga0207684_1000011398 395
231 3300031507 Ga0307509_10070482 Ga0307509_100704823 395
232 3300028577 Ga0265318_10004507 Ga0265318_100045074 396
233 3300028800 Ga0265338_10137491 Ga0265338_101374911 396
234 3300031241 Ga0265325_10000186 Ga0265325_100001867 396
235 3300031247 Ga0265340_10000607 Ga0265340_100006077 396
236 3300031344 Ga0265316_10000154 Ga0265316_1000015446 396
237 3300031595 Ga0265313_10000287 Ga0265313_1000028722 396
238 3300027907 Ga0207428_10042234 Ga0207428_100422342 397
239 3300050511 nmdc:mga08y16_68413_c1 nmdc:mga08y16_68413_c1_1207_2559 397
240 3300003323 rootH1_10168151 rootH1_101681512 405

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00198

2-oxoacid_dh

2-oxoacid dehydrogenases acyltransferase (catalytic domain)

235

466

0.99

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

3

76

0.98

PF02817

E3_binding

e3 binding domain

124

159

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y8n-assembly1.cif.gz_B-2 crystal structure of the pdk3-l2 complex 0.9582 3 77
1w88-assembly1.cif.gz_I the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 0.958 108 145
2d5d-assembly1.cif.gz_A structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form ii 0.9577 5 78
1y8p-assembly1.cif.gz_B crystal structure of the pdk3-l2 complex 0.9576 1 78
3rnm-assembly1.cif.gz_E the crystal structure of the subunit binding of human dihydrolipoamide transacylase (e2b) bound to human dihydrolipoamide dehydrogenase (e3) 0.9564 110 145
ID Description Score Start End Superfamily
af_B6TJY4_106_181_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 1.002 4 79 2.40.50.100
af_Q9VXY3_38_114_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9983 4 79 2.40.50.100
af_Q54TR7_75_160_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9922 1 78 2.40.50.100
af_B6TJY4_106_181_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9893 4 79 2.40.50.100
af_P9WIS7_123_196_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9867 7 78 2.40.50.100
ID Description Score Start End GO Terms
AF-T1BEM6-F1-model_v4 Biotin/lipoyl attachment domain protein 0.9871 4 78 GO:0005737
GO:0016407
GO:0031405
AF-A0A1V5BXX3-F1-model_v4 Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12) 0.9867 4 79 GO:0004742
GO:0005737
GO:0031405
AF-A0A3G9M7X5-F1-model_v4 deleted 0.9851 3 77
AF-A0A6J4TNW2-F1-model_v4 Lipoyl-binding domain-containing protein 0.9783 2 78 GO:0006086
GO:0045254
AF-D8RJG0-F1-model_v4 Lipoyl-binding domain-containing protein 0.9773 2 77 GO:0006086
GO:0045254

Feature Viewer

pLDDT pTM Quality
78.92 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map