F352900

General Info

Members Datasets Scaffolds Average Seq Length
240 202 173 327

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10023711|Ga0213874_100237112
Length 355
Sequence MRRSLMMTALLGSASLAGCAHHTPPEISYDDVPKPAVVEVDPPKPVQIVQVPQVLPLPGQLKXXXXARTAPPEPADPRTRVALANQAARMQPTRAGYLNAVQVYPFAEGALYQLYAAPGQVTDIALEAGEQLVGTGPVAAGDTVRWIIGDTESGTGATKRVHILVKPSRPDLMTNLVINTDRRTYHLEMRSTVGTYMASLSWSYPQDQLIALRRQNKTAAAAQPVASGVDLDALNFRYRIEGDTPPWRPLRAYDDGRQVFIEFPRGIAQGEMPPLWVIGHEGGAELVNYRVRGRYMIVDRLFAAAELRLGGEHQKMVRIVRTDGAERSGPFSWLRLSHGSERTKTAAAVGAGPAS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
4 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
5 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
6 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
7 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
8 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
9 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
10 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
11 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
12 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
13 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
14 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
15 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
16 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
17 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
18 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
19 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
20 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
21 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
22 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
23 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
24 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
25 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
26 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
27 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
28 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
29 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
30 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
31 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
32 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
33 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
34 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
35 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
36 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
37 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
38 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
39 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
40 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
41 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
42 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
43 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
44 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
45 2906610324
46 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
47 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
48 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
49 2922425934
50 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
51 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
52 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
53 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
54 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
55 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
56 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
57 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
58 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
59 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
60 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
61 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
62 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
63 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
64 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
65 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
91 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
95 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
118 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
119 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
135 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
136 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
173 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
180 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
181 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
182 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
183 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
184 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
185 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
186 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
187 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
188 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
189 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
190 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
191 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
194 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
195 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
196 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
197 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
198 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
199 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
200 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
201 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
202 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.69
Metatranscriptomes 0
Isolates 27.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.83
Nodule 16.67
Rhizoplane 0.42
Rhizosphere 47.08
Stem 0
Stem Tuber 0.42
Unclassified 19.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_84769 2162886007 Bacteria 26687
2 JGI24739J22299_10000915 3300001989 Bacteria 10950
3 JGI24739J22299_10001906 3300001989 Bacteria 7975
4 JGI25151J46595_10047302 3300003187 Bacteria 1498
5 JGI25153J46596_10000109 3300003215 Bacteria 93661
6 rootH2_10018136 3300003320 Bacteria 3727
7 Ga0055530_10017339 3300003791 Bacteria 2262
8 Ga0055531_10000216 3300003794 Bacteria 63247
9 Ga0065165_1002289 3300005262 Bacteria 16803
10 Ga0065704_10070242 3300005289 Bacteria 50451
11 Ga0070668_100000040 3300005347 Bacteria 78926
12 Ga0070668_100351886 3300005347 Bacteria 1247
13 Ga0070711_100010473 3300005439 Bacteria 5741
14 Ga0070711_100101491 3300005439 Bacteria 2094
15 Ga0070681_10386537 3300005458 Bacteria 1310
16 Ga0070706_100325159 3300005467 Bacteria 1434
17 Ga0068855_100198787 3300005563 Bacteria 2258
18 Ga0068859_100003753 3300005617 Bacteria 15492
19 Ga0068861_100000017 3300005719 Bacteria 78362
20 Ga0075365_10011285 3300006038 Bacteria 5248
21 Ga0075365_10027707 3300006038 Bacteria 3608
22 Ga0070716_100019115 3300006173 Bacteria 3578
23 Ga0070712_100022211 3300006175 Bacteria 4176
24 Ga0075369_10030912 3300006186 Bacteria 2257
25 Ga0075428_100089057 3300006844 Bacteria 3366
26 Ga0097620_100003753 3300006931 Bacteria 15492
27 Ga0099826_10000056 3300006948 Bacteria 70004
28 Ga0105240_10128516 3300009093 Bacteria 3042
29 Ga0105243_10160782 3300009148 Bacteria 1936
30 Ga0105248_10001759 3300009177 Bacteria 24104
31 Ga0105238_10210828 3300009551 Bacteria 1919
32 Ga0105239_10155430 3300010375 Bacteria 2554
33 Ga0157373_10183600 3300013100 Bacteria 1473
34 Ga0157371_10000346 3300013102 Bacteria 59564
35 Ga0157369_10071236 3300013105 Bacteria 3732
36 Ga0163162_10134391 3300013306 Bacteria 2584
37 Ga0157379_10095085 3300014968 Bacteria 2674
38 Ga0214544_1009140 3300021320 Bacteria 15797
39 Ga0213874_10023711 3300021377 Bacteria 1715
40 Ga0213874_10028509 3300021377 Bacteria 1596
41 Ga0213875_10005899 3300021388 Bacteria 6509
42 Ga0209147_100397 3300025229 Bacteria 29730
43 Ga0207425_1000073 3300025245 Bacteria 113233
44 Ga0209677_101696 3300025253 Bacteria 9195
45 Ga0209129_1000352 3300025258 Bacteria 38789
46 Ga0209676_1000823 3300025292 Bacteria 40357
47 Ga0209025_1000202 3300025294 Bacteria 145750
48 Ga0209025_1038629 3300025294 Bacteria 2096
49 Ga0209758_1000242 3300025297 Bacteria 113233
50 Ga0209758_1001401 3300025297 Bacteria 28591
51 Ga0209758_1002266 3300025297 Bacteria 19939
52 Ga0209050_1000725 3300025298 Bacteria 48200
53 Ga0207426_1037465 3300025302 Bacteria 1534
54 Ga0209051_1005620 3300025303 Bacteria 7267
55 Ga0209257_1000337 3300025304 Bacteria 97941
56 Ga0207707_10108499 3300025912 Bacteria 2427
57 Ga0207695_10027314 3300025913 Bacteria 6358
58 Ga0207695_10218715 3300025913 Bacteria 1813
59 Ga0207693_10057903 3300025915 Bacteria 3036
60 Ga0207663_10067542 3300025916 Bacteria 2293
61 Ga0207652_10107448 3300025921 Bacteria 2472
62 Ga0207665_10032922 3300025939 Bacteria 3433
63 Ga0207711_10028349 3300025941 Bacteria 4711
64 Ga0207668_10000069 3300025972 Bacteria 79827
65 Ga0207668_10226803 3300025972 Bacteria 1504
66 Ga0207675_100000462 3300026118 Bacteria 39560
67 Ga0209282_1000084 3300027666 Bacteria 70012
68 Ga0265334_10001476 3300028573 Bacteria 11327
69 Ga0307515_10004166 3300028794 Bacteria 30091
70 Ga0265338_10033865 3300028800 Bacteria 4950
71 Ga0265338_10033913 3300028800 Bacteria 4945
72 Ga0265324_10014843 3300029957 Bacteria 2871
73 Ga0265332_10033847 3300031238 Bacteria 2223
74 Ga0265328_10000098 3300031239 Bacteria 42728
75 Ga0265325_10049606 3300031241 Bacteria 2165
76 Ga0265329_10004766 3300031242 Bacteria 5577
77 Ga0265340_10039541 3300031247 Bacteria 2327
78 Ga0265339_10023486 3300031249 Bacteria 3563
79 Ga0265331_10001163 3300031250 Bacteria 20063
80 Ga0265316_10059776 3300031344 Bacteria 2963
81 Ga0307513_10060422 3300031456 Bacteria 4018
82 Ga0307513_10103638 3300031456 Bacteria 2861
83 Ga0307509_10000816 3300031507 Bacteria 53561
84 Ga0307509_10040807 3300031507 Bacteria 5044
85 Ga0307408_100000230 3300031548 Bacteria 58926
86 Ga0265313_10016781 3300031595 Bacteria 4198
87 Ga0265313_10031031 3300031595 Bacteria 2743
88 Ga0265314_10004967 3300031711 Bacteria 12128
89 Ga0265314_10054417 3300031711 Bacteria 2770
90 Ga0307406_10000956 3300031901 Bacteria 16157
91 Ga0307406_10130614 3300031901 Bacteria 1763
92 Ga0315914_1000129 3300031967 Bacteria 70013
93 Ga0307510_10234932 3300033180 Bacteria 1333
94 Ga0315913_1000034 3300033430 Bacteria 70013
95 Ga0315911_1000002 3300033442 Bacteria 926833
96 Ga0315915_1000066 3300033464 Bacteria 70010
97 Ga0373936_0012252 3300035113 Bacteria 3260
98 Ga0373943_0025255 3300035170 Bacteria 2777
99 Ga0395905_0084949 3300037471 Bacteria 2966
100 Ga0436364_0167314 3300037853 Bacteria 105007
101 Ga0436364_0181534 3300037853 Bacteria 2310
102 Ga0436364_0226891 3300037853 Bacteria 40228
103 Ga0436361_0162404 3300039447 Bacteria 2648
104 Ga0436361_0902026 3300039447 Bacteria 3853
105 Ga0436363_0423630 3300039450 Bacteria 1601
106 Ga0436363_1443113 3300039450 Bacteria 4153
107 Ga0466966_0004295 3300044684 Bacteria 9398
108 Ga0466963_0159106 3300044694 Bacteria 1572
109 Ga0495638_0000029 3300046460 Bacteria 330201
110 Ga0495638_0000720 3300046460 Bacteria 35702
111 Ga0495632_0000006 3300046519 Bacteria 345883
112 Ga0495632_0000890 3300046519 Bacteria 26220
113 Ga0495643_0000007 3300046522 Bacteria 383435
114 Ga0495643_0009112 3300046522 Bacteria 6215
115 Ga0495648_0025289 3300046524 Bacteria 4022
116 Ga0495633_0000218 3300046558 Bacteria 71266
117 Ga0495633_0001507 3300046558 Bacteria 18018
118 Ga0495633_0003846 3300046558 Bacteria 9814
119 Ga0495633_0107632 3300046558 Bacteria 1293
120 Ga0495611_0068629 3300046648 Bacteria 1618
121 Ga0495625_0002308 3300046660 Bacteria 20866
122 Ga0495671_0000071 3300046692 Bacteria 97337
123 Ga0495660_0037947 3300046810 Bacteria 2682
124 Ga0495676_0186669 3300047321 Bacteria 1449
125 Ga0495687_000136 3300047443 Bacteria 113298
126 Ga0495686_0034305 3300047472 Bacteria 3269
127 Ga0496116_0068909 3300048919 Bacteria 2252
128 Ga0496119_0030392 3300048922 Bacteria 3643
129 Ga0496120_0016717 3300048923 Bacteria 4786
130 Ga0496121_0010656 3300048924 Bacteria 10321
131 Ga0496126_0023544 3300048929 Bacteria 5967
132 Ga0496126_0044525 3300048929 Bacteria 4086
133 Ga0495678_000216 3300049459 Bacteria 66661
134 Ga0501033_0000437 3300049570 Bacteria 39928
135 Ga0501034_0014107 3300049571 Bacteria 8233
136 Ga0501034_0039999 3300049571 Bacteria 4748
137 Ga0501038_0412023 3300049574 Bacteria 1044
138 Ga0501039_0026962 3300049575 Bacteria 4417
139 Ga0501043_0352468 3300049579 Bacteria 1118
140 Ga0501047_0001569 3300049581 Bacteria 22336
141 Ga0501047_0182988 3300049581 Bacteria 1961
142 Ga0501069_0168250 3300049585 Bacteria 1264
143 Ga0501070_0018116 3300049586 Bacteria 5908
144 Ga0501072_0280789 3300049588 Bacteria 1325
145 Ga0501198_005646 3300049649 Bacteria 1766
146 Ga0501249_000034 3300049679 Bacteria 72400
147 Ga0501080_0109880 3300049742 Bacteria 2555
148 Ga0501080_0404367 3300049742 Bacteria 1228
149 Ga0501035_0003323 3300049822 Bacteria 15404
150 Ga0501035_0006702 3300049822 Bacteria 10765
151 Ga0501035_0065536 3300049822 Bacteria 3225
152 Ga0501044_0019264 3300049823 Bacteria 7303
153 Ga0501044_0062120 3300049823 Bacteria 3819
154 Ga0501044_0084067 3300049823 Bacteria 3217
155 Ga0501204_000079 3300049850 Bacteria 6867
156 nmdc:mga0yw44_13134_c1 3300050492 Bacteria 4348
157 nmdc:mga0yw44_8299_c2 3300050492 Bacteria 2553
158 Ga0500647_0084823 3300053091 Bacteria 1519
159 Ga0500566_0000136 3300053094 Bacteria 37754
160 Ga0500556_0003117 3300053104 Bacteria 4948
161 Ga0500572_000800 3300053111 Bacteria 10049
162 Ga0500594_0090928 3300053118 Bacteria 927
163 Ga0500595_011286 3300053119 Bacteria 3505
164 Ga0500614_001414 3300053123 Bacteria 5755
165 Ga0500573_0086907 3300053140 Bacteria 1771
166 Ga0500603_001545 3300053150 Bacteria 5229
167 Ga0500616_0000170 3300053153 Bacteria 108126
168 Ga0500630_001358 3300053159 Bacteria 11534
169 Ga0500639_000068 3300053163 Bacteria 47207
170 Ga0500639_000710 3300053163 Bacteria 16832
171 Ga0500596_008869 3300053735 Bacteria 1590
172 Ga0501082_0022192 3300060353 Bacteria 5471
173 Ga0530510_0024440 3300061734 Bacteria 4311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_10160782 Ga0105243_101607822 242
2 3300028794 Ga0307515_10004166 Ga0307515_1000416618 256
3 3300053118 Ga0500594_0090928 Ga0500594_0090928_30_827 256
4 3300025303 Ga0209051_1005620 Ga0209051_10056205 264
5 3300031548 Ga0307408_100000230 Ga0307408_10000023049 268
6 3300031901 Ga0307406_10000956 Ga0307406_100009563 268
7 3300025302 Ga0207426_1037465 Ga0207426_10374652 273
8 3300031711 Ga0265314_10054417 Ga0265314_100544174 274
9 3300021388 Ga0213875_10005899 Ga0213875_100058992 276
10 3300037853 Ga0436364_0226891 Ga0436364_0226891_29850_30836 276
11 iso_pu_bacteria 2841966195 2841967852 278
12 iso_pu_bacteria 2841974524 2841982691 278
13 3300047472 Ga0495686_0034305 Ga0495686_0034305_1160_2167 280
14 3300053091 Ga0500647_0084823 Ga0500647_0084823_10_891 280
15 3300006844 Ga0075428_100089057 Ga0075428_1000890573 283
16 3300049649 Ga0501198_005646 Ga0501198_005646_471_1391 283
17 3300013100 Ga0157373_10183600 Ga0157373_101836002 286
18 3300049679 Ga0501249_000034 Ga0501249_000034_47122_48123 286
19 3300049850 Ga0501204_000079 Ga0501204_000079_2709_3710 286
20 3300025253 Ga0209677_101696 Ga0209677_10169610 287
21 3300046519 Ga0495632_0000890 Ga0495632_0000890_5987_6955 289
22 3300005458 Ga0070681_10386537 Ga0070681_103865372 290
23 3300005563 Ga0068855_100198787 Ga0068855_1001987873 290
24 3300009093 Ga0105240_10128516 Ga0105240_101285162 290
25 3300013105 Ga0157369_10071236 Ga0157369_100712362 290
26 3300025912 Ga0207707_10108499 Ga0207707_101084991 290
27 3300025913 Ga0207695_10027314 Ga0207695_100273146 290
28 3300025921 Ga0207652_10107448 Ga0207652_101074482 290
29 3300044694 Ga0466963_0159106 Ga0466963_0159106_264_1250 290
30 3300049571 Ga0501034_0014107 Ga0501034_0014107_6996_8024 290
31 3300049574 Ga0501038_0412023 Ga0501038_0412023_59_1033 290
32 3300035113 Ga0373936_0012252 Ga0373936_0012252_1986_2972 291
33 3300047321 Ga0495676_0186669 Ga0495676_0186669_429_1415 291
34 3300001989 JGI24739J22299_10000915 JGI24739J22299_1000091512 292
35 3300025294 Ga0209025_1038629 Ga0209025_10386292 292
36 3300005467 Ga0070706_100325159 Ga0070706_1003251592 293
37 iso_pu_bacteria 2824679649 2824680113 294
38 iso_pu_bacteria 2906610324 2906617050 294
39 3300005617 Ga0068859_100003753 Ga0068859_10000375311 295
40 3300005719 Ga0068861_100000017 Ga0068861_10000001757 295
41 3300006931 Ga0097620_100003753 Ga0097620_10000375310 295
42 3300009177 Ga0105248_10001759 Ga0105248_1000175918 295
43 3300014968 Ga0157379_10095085 Ga0157379_100950851 295
44 3300021377 Ga0213874_10028509 Ga0213874_100285092 295
45 3300025941 Ga0207711_10028349 Ga0207711_100283495 295
46 3300026118 Ga0207675_100000462 Ga0207675_1000004623 295
47 3300039450 Ga0436363_1443113 Ga0436363_1443113_969_1961 295
48 3300049581 Ga0501047_0001569 Ga0501047_0001569_12979_13989 295
49 3300049585 Ga0501069_0168250 Ga0501069_0168250_155_1165 295
50 3300049586 Ga0501070_0018116 Ga0501070_0018116_1964_2974 295
51 3300049588 Ga0501072_0280789 Ga0501072_0280789_213_1202 295
52 3300049742 Ga0501080_0404367 Ga0501080_0404367_75_1085 295
53 3300049822 Ga0501035_0003323 Ga0501035_0003323_4792_5802 295
54 3300049823 Ga0501044_0062120 Ga0501044_0062120_1176_2186 295
55 3300061734 Ga0530510_0024440 Ga0530510_0024440_3057_4046 295
56 3300013102 Ga0157371_10000346 Ga0157371_1000034650 296
57 3300029957 Ga0265324_10014843 Ga0265324_100148432 296
58 3300031238 Ga0265332_10033847 Ga0265332_100338472 296
59 3300031241 Ga0265325_10049606 Ga0265325_100496062 296
60 3300031242 Ga0265329_10004766 Ga0265329_100047665 296
61 3300031247 Ga0265340_10039541 Ga0265340_100395412 296
62 3300031249 Ga0265339_10023486 Ga0265339_100234863 296
63 3300031250 Ga0265331_10001163 Ga0265331_1000116321 296
64 3300031344 Ga0265316_10059776 Ga0265316_100597764 296
65 3300031595 Ga0265313_10016781 Ga0265313_100167813 296
66 3300031711 Ga0265314_10004967 Ga0265314_100049673 296
67 3300005347 Ga0070668_100000040 Ga0070668_10000004021 297
68 3300025972 Ga0207668_10000069 Ga0207668_1000006921 297
69 3300048924 Ga0496121_0010656 Ga0496121_0010656_6967_7995 297
70 3300003320 rootH2_10018136 rootH2_100181362 299
71 3300046558 Ga0495633_0003846 Ga0495633_0003846_7726_8706 299
72 3300053163 Ga0500639_000710 Ga0500639_000710_7435_8424 300
73 3300025229 Ga0209147_100397 Ga0209147_10039723 301
74 3300025913 Ga0207695_10218715 Ga0207695_102187152 301
75 3300028573 Ga0265334_10001476 Ga0265334_1000147612 301
76 3300028800 Ga0265338_10033913 Ga0265338_100339132 301
77 3300031595 Ga0265313_10031031 Ga0265313_100310312 301
78 iso_pu_bacteria 2524023205 2524441927 301
79 iso_pu_bacteria 2874604998 2874605684 301
80 3300005262 Ga0065165_1002289 Ga0065165_10022893 302
81 3300005347 Ga0070668_100351886 Ga0070668_1003518861 302
82 3300005439 Ga0070711_100010473 Ga0070711_1000104733 302
83 3300005439 Ga0070711_100101491 Ga0070711_1001014912 302
84 3300006038 Ga0075365_10011285 Ga0075365_100112855 302
85 3300006038 Ga0075365_10027707 Ga0075365_100277072 302
86 3300006173 Ga0070716_100019115 Ga0070716_1000191154 302
87 3300006175 Ga0070712_100022211 Ga0070712_1000222114 302
88 3300006186 Ga0075369_10030912 Ga0075369_100309121 302
89 3300009551 Ga0105238_10210828 Ga0105238_102108282 302
90 3300010375 Ga0105239_10155430 Ga0105239_101554302 302
91 3300013306 Ga0163162_10134391 Ga0163162_101343913 302
92 3300021320 Ga0214544_1009140 Ga0214544_100914013 302
93 3300025297 Ga0209758_1001401 Ga0209758_100140122 302
94 3300025915 Ga0207693_10057903 Ga0207693_100579034 302
95 3300025916 Ga0207663_10067542 Ga0207663_100675422 302
96 3300025939 Ga0207665_10032922 Ga0207665_100329222 302
97 3300025972 Ga0207668_10226803 Ga0207668_102268031 302
98 3300031456 Ga0307513_10103638 Ga0307513_101036382 302
99 3300031507 Ga0307509_10000816 Ga0307509_1000081633 302
100 3300031507 Ga0307509_10040807 Ga0307509_100408073 302
101 3300031901 Ga0307406_10130614 Ga0307406_101306142 302
102 3300033180 Ga0307510_10234932 Ga0307510_102349322 302
103 3300033442 Ga0315911_1000002 Ga0315911_1000002803 302
104 3300035170 Ga0373943_0025255 Ga0373943_0025255_1117_2142 302
105 3300039447 Ga0436361_0902026 Ga0436361_0902026_1965_2990 302
106 3300044684 Ga0466966_0004295 Ga0466966_0004295_6032_7057 302
107 3300046522 Ga0495643_0009112 Ga0495643_0009112_74_1099 302
108 3300048919 Ga0496116_0068909 Ga0496116_0068909_831_1856 302
109 3300048929 Ga0496126_0023544 Ga0496126_0023544_2396_3421 302
110 3300048929 Ga0496126_0044525 Ga0496126_0044525_466_1491 302
111 3300050492 nmdc:mga0yw44_13134_c1 nmdc:mga0yw44_13134_c1_1933_2958 302
112 3300050492 nmdc:mga0yw44_8299_c2 nmdc:mga0yw44_8299_c2_504_1529 302
113 3300053094 Ga0500566_0000136 Ga0500566_0000136_573_1598 302
114 3300053104 Ga0500556_0003117 Ga0500556_0003117_479_1504 302
115 3300053111 Ga0500572_000800 Ga0500572_000800_6783_7808 302
116 3300053123 Ga0500614_001414 Ga0500614_001414_1940_2965 302
117 3300053140 Ga0500573_0086907 Ga0500573_0086907_216_1241 302
118 3300053150 Ga0500603_001545 Ga0500603_001545_1532_2557 302
119 3300053159 Ga0500630_001358 Ga0500630_001358_4200_5225 302
120 3300053163 Ga0500639_000068 Ga0500639_000068_12961_13986 302
121 3300053735 Ga0500596_008869 Ga0500596_008869_215_1240 302
122 iso_pu_bacteria 2508501128 2509151411 302
123 iso_pu_bacteria 2513237098 2513677668 302
124 iso_pu_bacteria 2513237101 2513696811 302
125 iso_pu_bacteria 2513237137 2513863598 302
126 iso_pu_bacteria 2513237161 2514012737 302
127 iso_pu_bacteria 2524023210 2524470538 302
128 iso_pu_bacteria 2528768022 2528848826 302
129 iso_pu_bacteria 2617270741 2617375309 302
130 iso_pu_bacteria 2667528175 2671118250 302
131 iso_pu_bacteria 2721755755 2723844728 302
132 iso_pu_bacteria 2824617872 2824618475 302
133 iso_pu_bacteria 2824626560 2824627310 302
134 iso_pu_bacteria 2824635225 2824639725 302
135 iso_pu_bacteria 2824644064 2824646705 302
136 iso_pu_bacteria 2824714736 2824717003 302
137 iso_pu_bacteria 2824723954 2824727229 302
138 iso_pu_bacteria 2824753945 2824755932 302
139 iso_pu_bacteria 2824763712 2824764985 302
140 iso_pu_bacteria 2838122688 2838130337 302
141 iso_pu_bacteria 2854601825 2854602870 302
142 iso_pu_bacteria 2876808645 2876815839 302
143 iso_pu_bacteria 2879099564 2879108485 302
144 iso_pu_bacteria 2879110137 2879111103 302
145 iso_pu_bacteria 2885374607 2885379930 302
146 iso_pu_bacteria 2885409591 2885416847 302
147 iso_pu_bacteria 2889033259 2889041215 302
148 iso_pu_bacteria 2903768456 2903775666 302
149 iso_pu_bacteria 2904711408 2904715984 302
150 iso_pu_bacteria 2922361189 2922365867 302
151 iso_pu_bacteria 2922386360 2922391404 302
152 iso_pu_bacteria 2922425934 2922428860 302
153 iso_pu_bacteria 2928115317 2928118122 302
154 iso_pu_bacteria 2928115317 2928121249 302
155 iso_pu_bacteria 2935810662 2935813647 302
156 iso_pu_bacteria 2936037263 2936042820 302
157 iso_pu_bacteria 3005594810 3005597988 302
158 iso_pu_bacteria 8006964411 8006970710 302
159 iso_pu_bacteria 8006984368 8006990695 302
160 iso_pu_bacteria 8056673599 8056677055 302
161 iso_pu_bacteria 8056681323 8056689733 302
162 iso_pu_bacteria 8056689827 8056692313 302
163 3300003187 JGI25151J46595_10047302 JGI25151J46595_100473022 303
164 3300003215 JGI25153J46596_10000109 JGI25153J46596_1000010969 303
165 3300003791 Ga0055530_10017339 Ga0055530_100173392 303
166 3300003794 Ga0055531_10000216 Ga0055531_1000021639 303
167 3300025245 Ga0207425_1000073 Ga0207425_100007337 303
168 3300025258 Ga0209129_1000352 Ga0209129_100035216 303
169 3300025292 Ga0209676_1000823 Ga0209676_100082330 303
170 3300025294 Ga0209025_1000202 Ga0209025_100020260 303
171 3300025297 Ga0209758_1000242 Ga0209758_100024237 303
172 3300025298 Ga0209050_1000725 Ga0209050_100072537 303
173 3300025304 Ga0209257_1000337 Ga0209257_100033735 303
174 3300053119 Ga0500595_011286 Ga0500595_011286_1728_2759 303
175 3300031456 Ga0307513_10060422 Ga0307513_100604223 304
176 3300037853 Ga0436364_0167314 Ga0436364_0167314_5083_6054 305
177 3300046460 Ga0495638_0000029 Ga0495638_0000029_75379_76347 305
178 3300046558 Ga0495633_0000218 Ga0495633_0000218_55984_56952 305
179 3300006948 Ga0099826_10000056 Ga0099826_1000005615 306
180 3300027666 Ga0209282_1000084 Ga0209282_100008451 306
181 3300028800 Ga0265338_10033865 Ga0265338_100338656 306
182 3300031967 Ga0315914_1000129 Ga0315914_100012915 306
183 3300033430 Ga0315913_1000034 Ga0315913_100003451 306
184 3300033464 Ga0315915_1000066 Ga0315915_100006651 306
185 3300021377 Ga0213874_10023711 Ga0213874_100237112 307
186 3300031239 Ga0265328_10000098 Ga0265328_1000009826 307
187 3300037853 Ga0436364_0181534 Ga0436364_0181534_1274_2260 307
188 3300046460 Ga0495638_0000720 Ga0495638_0000720_10530_11591 307
189 iso_pu_bacteria 641228493 641334975 307
190 iso_pu_bacteria 641228493 641335049 307
191 iso_pu_bacteria 643348555 643390527 307
192 iso_pu_bacteria 8002060224 8002061439 307
193 3300001989 JGI24739J22299_10001906 JGI24739J22299_100019061 308
194 3300039447 Ga0436361_0162404 Ga0436361_0162404_780_1769 308
195 3300039450 Ga0436363_0423630 Ga0436363_0423630_421_1431 308
196 3300046524 Ga0495648_0025289 Ga0495648_0025289_2881_3930 308
197 3300046558 Ga0495633_0001507 Ga0495633_0001507_4438_5487 308
198 3300046660 Ga0495625_0002308 Ga0495625_0002308_18248_19297 308
199 3300047443 Ga0495687_000136 Ga0495687_000136_60561_61610 308
200 3300049459 Ga0495678_000216 Ga0495678_000216_699_1748 308
201 iso_pu_bacteria 2916061851 2916064044 308
202 3300037471 Ga0395905_0084949 Ga0395905_0084949_582_1661 309
203 3300046692 Ga0495671_0000071 Ga0495671_0000071_63940_64989 309
204 3300046810 Ga0495660_0037947 Ga0495660_0037947_884_1933 309
205 iso_pu_bacteria 2582581305 2585260863 309
206 2162886007 SwRhRL2b_contig_84769 SwRhRL2b_0995.00006440 310
207 3300005289 Ga0065704_10070242 Ga0065704_1007024249 310
208 3300025297 Ga0209758_1002266 Ga0209758_100226615 310
209 3300046519 Ga0495632_0000006 Ga0495632_0000006_122077_123045 310
210 3300046522 Ga0495643_0000007 Ga0495643_0000007_197924_198892 310
211 3300046558 Ga0495633_0107632 Ga0495633_0107632_155_1123 310
212 3300046648 Ga0495611_0068629 Ga0495611_0068629_351_1400 310
213 3300048922 Ga0496119_0030392 Ga0496119_0030392_891_1859 310
214 3300048923 Ga0496120_0016717 Ga0496120_0016717_3212_4180 310
215 3300049570 Ga0501033_0000437 Ga0501033_0000437_10020_11075 310
216 3300049571 Ga0501034_0039999 Ga0501034_0039999_3652_4677 310
217 3300049575 Ga0501039_0026962 Ga0501039_0026962_2525_3550 310
218 3300049579 Ga0501043_0352468 Ga0501043_0352468_23_1048 310
219 3300049581 Ga0501047_0182988 Ga0501047_0182988_86_1111 310
220 3300049742 Ga0501080_0109880 Ga0501080_0109880_129_1154 310
221 3300049822 Ga0501035_0006702 Ga0501035_0006702_8280_9335 310
222 3300049822 Ga0501035_0065536 Ga0501035_0065536_1746_2771 310
223 3300049823 Ga0501044_0019264 Ga0501044_0019264_5696_6721 310
224 3300049823 Ga0501044_0084067 Ga0501044_0084067_1822_2847 310
225 3300053153 Ga0500616_0000170 Ga0500616_0000170_76394_77470 310
226 3300060353 Ga0501082_0022192 Ga0501082_0022192_3955_4980 310
227 iso_pu_bacteria 2511231027 2511390566 310
228 iso_pu_bacteria 2513237088 2513595430 310
229 iso_pu_bacteria 2585427529 2585547044 310
230 iso_pu_bacteria 2585427530 2585553458 310
231 iso_pu_bacteria 2882632389 2882638754 310
232 iso_pu_bacteria 2888337043 2888339909 310
233 iso_pu_bacteria 2896384573 2896385261 310
234 iso_pu_bacteria 2899792073 2899794461 310
235 iso_pu_bacteria 2904690495 2904694735 310
236 iso_pu_bacteria 2929199973 2929202848 310
237 iso_pu_bacteria 2964628898 2964629797 310
238 iso_pu_bacteria 2996348954 2996350636 310
239 iso_pu_bacteria 3004275668 3004277334 310
240 iso_pu_bacteria 8001845381 8001848591 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03524

CagX

Conjugal transfer protein

99

322

0.95

Feature Viewer

pLDDT pTM Quality
66.63 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map