F351826

General Info

Members Datasets Scaffolds Average Seq Length
239 180 478 303

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100015145|Ga0097621_1000151456
Length 336
Sequence VNRTETGRHVNAIARNAAPHGTHGRLGPLWTFFFRYGPPRWSRYVLDHWTGQRLVIAVPYLWLGIFFLIPFLIVLKISFAEVDPGGRPPYKPVFDWLQLNEGVLKDGALQIRLAIHSYVYLITEPLYWSSMLFSLKVAAVSTVLALGVGYPMAYAIARSNPTARNLLLMLVILPFWTSFLLRVYAWVGLLKADGVINNVLLAIGVIHEPLTMMKTDFALYIGIVYSYLPFMILPLYSNLEKHDNTLIEAASDLGAGPIRAFMRVTLPLSMPGIVAGSLLVFIPAVGEYVIPELLGRSDQLMIATQLYHEFFSDRDWPNASMIFQHFQNRELQAARK

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 1.26
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.77
Nodule 0
Rhizoplane 2.51
Rhizosphere 89.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100015145 3300006237 Bacteria 5794
2 JGI25151J46595_10000130 3300003187 Bacteria 101649
3 JGI25151J46595_10000312 3300003187 Bacteria 52924
4 JGI25153J46596_10000426 3300003215 Bacteria 27425
5 JGI25153J46596_10035764 3300003215 Bacteria 1604
6 Ga0070690_100006208 3300005330 Bacteria 6775
7 Ga0070680_100347568 3300005336 Bacteria 1261
8 Ga0070689_100003565 3300005340 Bacteria 10366
9 Ga0070668_100111159 3300005347 Bacteria 2181
10 Ga0070668_100213418 3300005347 Bacteria 1588
11 Ga0070675_100016485 3300005354 Bacteria 5867
12 Ga0070675_100162832 3300005354 Bacteria 1919
13 Ga0070673_100018907 3300005364 Bacteria 4937
14 Ga0070673_100020858 3300005364 Bacteria 4735
15 Ga0070688_100234298 3300005365 Bacteria 1300
16 Ga0070709_10007519 3300005434 Bacteria 5977
17 Ga0070714_100006553 3300005435 Bacteria 9004
18 Ga0070714_100230893 3300005435 Bacteria 1704
19 Ga0070713_100025335 3300005436 Bacteria 4636
20 Ga0070713_100048927 3300005436 Bacteria 3485
21 Ga0070713_100225958 3300005436 Bacteria 1700
22 Ga0070701_10015953 3300005438 Bacteria 3481
23 Ga0070711_100007365 3300005439 Bacteria 6695
24 Ga0070711_100054162 3300005439 Bacteria 2767
25 Ga0070705_100003825 3300005440 Bacteria 7364
26 Ga0070694_100006766 3300005444 Bacteria 6963
27 Ga0070708_100000274 3300005445 Bacteria 38511
28 Ga0070708_100113999 3300005445 Bacteria 2487
29 Ga0070663_100202019 3300005455 Bacteria 1552
30 Ga0070663_100276561 3300005455 Bacteria 1336
31 Ga0070678_100176132 3300005456 Bacteria 1746
32 Ga0068867_100201769 3300005459 Bacteria 1592
33 Ga0068867_100260070 3300005459 Bacteria 1415
34 Ga0070706_100164025 3300005467 Bacteria 2075
35 Ga0070707_100009069 3300005468 Bacteria 9223
36 Ga0070707_100063916 3300005468 Bacteria 3532
37 Ga0070698_100183821 3300005471 Bacteria 2028
38 Ga0070698_100242898 3300005471 Bacteria 1734
39 Ga0070679_100043855 3300005530 Bacteria 4454
40 Ga0070697_100234981 3300005536 Bacteria 1564
41 Ga0070672_100018789 3300005543 Bacteria 5005
42 Ga0070672_100112896 3300005543 Bacteria 2217
43 Ga0070686_100018514 3300005544 Bacteria 4090
44 Ga0070695_100020915 3300005545 Bacteria 3999
45 Ga0070696_100000233 3300005546 Bacteria 33711
46 Ga0070696_100091969 3300005546 Bacteria 2161
47 Ga0068856_100023851 3300005614 Bacteria 5951
48 Ga0070702_100044583 3300005615 Bacteria 2505
49 Ga0070702_100142616 3300005615 Bacteria 1528
50 Ga0068859_100033129 3300005617 Bacteria 5190
51 Ga0068859_100452540 3300005617 Bacteria 1380
52 Ga0068861_100018692 3300005719 Bacteria 4939
53 Ga0068870_10001342 3300005840 Bacteria 9927
54 Ga0068863_100105915 3300005841 Bacteria 2675
55 Ga0068863_100158066 3300005841 Bacteria 2171
56 Ga0068860_100110745 3300005843 Bacteria 2624
57 Ga0068860_100154406 3300005843 Bacteria 2212
58 Ga0068862_100017338 3300005844 Bacteria 5995
59 Ga0068862_100031640 3300005844 Bacteria 4468
60 Ga0081455_10022056 3300005937 Bacteria 5961
61 Ga0070716_100063546 3300006173 Bacteria 2144
62 Ga0070716_100071925 3300006173 Bacteria 2035
63 Ga0070716_100184890 3300006173 Bacteria 1372
64 Ga0068871_100036718 3300006358 Bacteria 3902
65 Ga0068871_100227583 3300006358 Bacteria 1617
66 Ga0075428_100267672 3300006844 Bacteria 1839
67 Ga0075430_100428998 3300006846 Bacteria 1091
68 Ga0075431_100008804 3300006847 Bacteria 10112
69 Ga0068865_100141824 3300006881 Bacteria 1813
70 Ga0075436_100127795 3300006914 Bacteria 1781
71 Ga0097620_100033129 3300006931 Bacteria 5190
72 Ga0097620_100452514 3300006931 Bacteria 1380
73 Ga0075435_100316220 3300007076 Bacteria 1336
74 Ga0099795_10005120 3300007788 Bacteria 3457
75 Ga0099795_10081577 3300007788 Bacteria 1238
76 Ga0105240_10007391 3300009093 Bacteria 15971
77 Ga0105240_10032775 3300009093 Bacteria 6721
78 Ga0105240_10040891 3300009093 Bacteria 5924
79 Ga0105240_10217092 3300009093 Bacteria 2231
80 Ga0105245_10263141 3300009098 Bacteria 1679
81 Ga0114129_10079019 3300009147 Bacteria 4574
82 Ga0114129_10157357 3300009147 Bacteria 3106
83 Ga0105243_10055542 3300009148 Bacteria 3147
84 Ga0105237_10418432 3300009545 Bacteria 1345
85 Ga0099796_10000128 3300010159 Bacteria 11567
86 Ga0105239_10052494 3300010375 Bacteria 4471
87 Ga0105246_10297537 3300011119 Bacteria 1301
88 Ga0157369_10028992 3300013105 Bacteria 6121
89 Ga0157374_10018557 3300013296 Bacteria 6141
90 Ga0163162_10300415 3300013306 Bacteria 1737
91 Ga0157372_10014940 3300013307 Bacteria 8313
92 Ga0157375_10042637 3300013308 Bacteria 4393
93 Ga0157375_10743199 3300013308 Bacteria 1133
94 Ga0157376_10174800 3300014969 Bacteria 1958
95 Ga0157376_10226292 3300014969 Bacteria 1735
96 Ga0213872_10050684 3300021361 Bacteria 1884
97 Ga0228598_1001606 3300024227 Bacteria 4944
98 Ga0209025_1000152 3300025294 Bacteria 171558
99 Ga0209758_1000169 3300025297 Bacteria 149782
100 Ga0209758_1002944 3300025297 Bacteria 16373
101 Ga0207682_10000773 3300025893 Bacteria 14767
102 Ga0207692_10100746 3300025898 Bacteria 1585
103 Ga0207699_10013238 3300025906 Bacteria 4217
104 Ga0207643_10056053 3300025908 Bacteria 2241
105 Ga0207684_10197188 3300025910 Bacteria 1737
106 Ga0207695_10024867 3300025913 Bacteria 6721
107 Ga0207695_10047805 3300025913 Bacteria 4523
108 Ga0207695_10196390 3300025913 Bacteria 1934
109 Ga0207663_10180310 3300025916 Bacteria 1508
110 Ga0207660_10282850 3300025917 Bacteria 1317
111 Ga0207652_10104672 3300025921 Bacteria 2503
112 Ga0207646_10004715 3300025922 Bacteria 14692
113 Ga0207646_10034905 3300025922 Bacteria 4546
114 Ga0207659_10005682 3300025926 Bacteria 7589
115 Ga0207664_10002133 3300025929 Bacteria 13018
116 Ga0207706_10145627 3300025933 Bacteria 2084
117 Ga0207670_10003313 3300025936 Bacteria 8538
118 Ga0207704_10035897 3300025938 Bacteria 2846
119 Ga0207704_10040430 3300025938 Bacteria 2726
120 Ga0207704_10100355 3300025938 Bacteria 1928
121 Ga0207665_10098499 3300025939 Bacteria 2037
122 Ga0207665_10104700 3300025939 Bacteria 1981
123 Ga0207665_10212241 3300025939 Bacteria 1415
124 Ga0207691_10012066 3300025940 Bacteria 8288
125 Ga0207711_10092225 3300025941 Bacteria 2665
126 Ga0207689_10010805 3300025942 Bacteria 7853
127 Ga0207651_10023326 3300025960 Bacteria 3803
128 Ga0207651_10056566 3300025960 Bacteria 2700
129 Ga0207668_10189129 3300025972 Bacteria 1630
130 Ga0207668_10197619 3300025972 Bacteria 1599
131 Ga0207703_10064056 3300026035 Bacteria 3016
132 Ga0207678_10220095 3300026067 Bacteria 1625
133 Ga0207702_10166412 3300026078 Bacteria 2018
134 Ga0207641_10075741 3300026088 Bacteria 2906
135 Ga0207641_10101295 3300026088 Bacteria 2538
136 Ga0207641_10222745 3300026088 Bacteria 1750
137 Ga0207648_10071348 3300026089 Bacteria 3027
138 Ga0207675_100034938 3300026118 Bacteria 4687
139 Ga0207675_100061715 3300026118 Bacteria 3499
140 Ga0207683_10201573 3300026121 Bacteria 1809
141 Ga0209974_10009728 3300027876 Bacteria 3261
142 Ga0268266_10011750 3300028379 Bacteria 7594
143 Ga0268265_10141490 3300028380 Bacteria 2015
144 Ga0268264_10090205 3300028381 Bacteria 2641
145 Ga0268264_10160795 3300028381 Bacteria 2023
146 Ga0307515_10153838 3300028794 Bacteria 2387
147 Ga0265763_1000076 3300030763 Bacteria 4236
148 Ga0265770_1000007 3300030878 Bacteria 20558
149 Ga0265760_10000833 3300031090 Bacteria 8855
150 Ga0307509_10100062 3300031507 Bacteria 2939
151 Ga0307408_100114112 3300031548 Bacteria 2081
152 Ga0307508_10317872 3300031616 Bacteria 1149
153 Ga0316576_10072024 3300031727 Bacteria 2550
154 Ga0307516_10003963 3300031730 Bacteria 18595
155 Ga0307413_10016844 3300031824 Bacteria 3791
156 Ga0307407_10062331 3300031903 Bacteria 2183
157 Ga0307412_10135687 3300031911 Bacteria 1795
158 Ga0307409_100002517 3300031995 Bacteria 9603
159 Ga0307416_100209393 3300032002 Bacteria 1858
160 Ga0307411_10056657 3300032005 Bacteria 2585
161 Ga0307415_100051865 3300032126 Bacteria 2787
162 Ga0307415_100191280 3300032126 Bacteria 1615
163 Ga0373923_0026198 3300035111 Bacteria 2318
164 Ga0373943_0004695 3300035170 Bacteria 6180
165 Ga0373946_0209657 3300035171 Bacteria 937
166 Ga0373933_0012987 3300035724 Bacteria 4607
167 Ga0373947_0031270 3300035725 Bacteria 3132
168 Ga0373937_0031120 3300036401 Bacteria 4832
169 Ga0316584_0166640 3300036712 Bacteria 1636
170 Ga0395900_0084547 3300037418 Bacteria 3261
171 Ga0395900_0197570 3300037418 Bacteria 2037
172 Ga0395898_0020339 3300037466 Bacteria 6740
173 Ga0395898_0020760 3300037466 Bacteria 6668
174 Ga0395898_0036071 3300037466 Bacteria 4913
175 Ga0395901_0125340 3300038443 Bacteria 2699
176 Ga0400483_002929 3300039062 Bacteria 2493
177 Ga0400483_154058 3300039062 Bacteria 1934
178 Ga0400483_281294 3300039062 Bacteria 1148
179 Ga0436361_0200397 3300039447 Bacteria 5394
180 Ga0451577_0502482 3300042876 Bacteria 1101
181 Ga0466966_0065176 3300044684 Bacteria 2292
182 Ga0466966_0081671 3300044684 Bacteria 2012
183 Ga0466963_0003416 3300044694 Bacteria 9088
184 Ga0453684_0245875 3300044712 Bacteria 2057
185 Ga0466959_0120887 3300045049 Bacteria 1862
186 Ga0451576_0002355 3300045051 Bacteria 28513
187 Ga0451576_0017273 3300045051 Bacteria 7939
188 Ga0466958_0188177 3300045836 Bacteria 1311
189 Ga0466967_0298443 3300045976 Bacteria 1550
190 Ga0495651_0232815 3300046462 Bacteria 1268
191 Ga0495650_0012198 3300046471 Bacteria 4639
192 Ga0495580_0008705 3300046472 Bacteria 8047
193 Ga0495625_0008103 3300046660 Bacteria 9009
194 Ga0495657_0062829 3300046675 Bacteria 2452
195 Ga0495623_0025535 3300046679 Bacteria 3806
196 Ga0495604_0043627 3300047317 Bacteria 3510
197 Ga0495686_0082491 3300047472 Bacteria 1962
198 Ga0496101_0086225 3300048904 Bacteria 2328
199 Ga0496104_0032491 3300048907 Bacteria 4857
200 Ga0496105_0001071 3300048908 Bacteria 18940
201 Ga0496105_0194010 3300048908 Bacteria 1660
202 Ga0496114_0004355 3300048917 Bacteria 10956
203 Ga0496115_0008598 3300048918 Bacteria 7559
204 Ga0496126_0002263 3300048929 Bacteria 26552
205 Ga0501032_0026600 3300049569 Bacteria 3977
206 Ga0501036_0029704 3300049572 Bacteria 4617
207 Ga0501037_0014418 3300049573 Bacteria 5818
208 Ga0501039_0057670 3300049575 Bacteria 3007
209 Ga0501041_0165719 3300049577 Bacteria 1382
210 Ga0501043_0018913 3300049579 Bacteria 5405
211 Ga0501046_0046263 3300049580 Bacteria 3454
212 Ga0501048_0025815 3300049582 Bacteria 4280
213 Ga0501067_0024271 3300049583 Bacteria 3363
214 Ga0501069_0025059 3300049585 Bacteria 3258
215 Ga0501070_0120075 3300049586 Bacteria 2172
216 Ga0501072_0171329 3300049588 Bacteria 1732
217 Ga0501073_0072395 3300049589 Bacteria 2400
218 Ga0501073_0104033 3300049589 Bacteria 1971
219 Ga0501075_0006528 3300049591 Bacteria 8031
220 Ga0501080_0014789 3300049742 Bacteria 7188
221 Ga0501081_0434778 3300049743 Bacteria 974
222 Ga0501083_0011088 3300049744 Bacteria 6331
223 Ga0501083_0165326 3300049744 Bacteria 1446
224 Ga0501035_0080959 3300049822 Bacteria 2866
225 Ga0501044_0046378 3300049823 Bacteria 4499
226 Ga0501044_0285515 3300049823 Bacteria 1583
227 Ga0501045_0275827 3300049824 Bacteria 1252
228 nmdc:mga05p37_552506_c1 3300050507 Bacteria 1310
229 nmdc:mga06r32_13153_c1 3300050510 Bacteria 7495
230 nmdc:mga06r32_42186_c1 3300050510 Bacteria 4337
231 nmdc:mga0rr50_103855_c1 3300050513 Bacteria 2237
232 nmdc:mga08x19_297288_c1 3300050514 Bacteria 1121
233 Ga0495601_0053034 3300053077 Bacteria 2562
234 Ga0495655_0010044 3300053083 Bacteria 1855
235 Ga0495595_0103713 3300053084 Bacteria 1374
236 Ga0500556_0000288 3300053104 Bacteria 39530
237 Ga0500616_0000637 3300053153 Bacteria 42393
238 Ga0501084_0157325 3300054114 Bacteria 1917
239 8054568925 8054563764 Bacteria 5592885
240 Ga0097621_100015145
241 JGI25151J46595_10000130
242 JGI25151J46595_10000312
243 JGI25153J46596_10000426
244 JGI25153J46596_10035764
245 Ga0070690_100006208
246 Ga0070680_100347568
247 Ga0070689_100003565
248 Ga0070668_100111159
249 Ga0070668_100213418
250 Ga0070675_100016485
251 Ga0070675_100162832
252 Ga0070673_100018907
253 Ga0070673_100020858
254 Ga0070688_100234298
255 Ga0070709_10007519
256 Ga0070714_100006553
257 Ga0070714_100230893
258 Ga0070713_100025335
259 Ga0070713_100048927
260 Ga0070713_100225958
261 Ga0070701_10015953
262 Ga0070711_100007365
263 Ga0070711_100054162
264 Ga0070705_100003825
265 Ga0070694_100006766
266 Ga0070708_100000274
267 Ga0070708_100113999
268 Ga0070663_100202019
269 Ga0070663_100276561
270 Ga0070678_100176132
271 Ga0068867_100201769
272 Ga0068867_100260070
273 Ga0070706_100164025
274 Ga0070707_100009069
275 Ga0070707_100063916
276 Ga0070698_100183821
277 Ga0070698_100242898
278 Ga0070679_100043855
279 Ga0070697_100234981
280 Ga0070672_100018789
281 Ga0070672_100112896
282 Ga0070686_100018514
283 Ga0070695_100020915
284 Ga0070696_100000233
285 Ga0070696_100091969
286 Ga0068856_100023851
287 Ga0070702_100044583
288 Ga0070702_100142616
289 Ga0068859_100033129
290 Ga0068859_100452540
291 Ga0068861_100018692
292 Ga0068870_10001342
293 Ga0068863_100105915
294 Ga0068863_100158066
295 Ga0068860_100110745
296 Ga0068860_100154406
297 Ga0068862_100017338
298 Ga0068862_100031640
299 Ga0081455_10022056
300 Ga0070716_100063546
301 Ga0070716_100071925
302 Ga0070716_100184890
303 Ga0068871_100036718
304 Ga0068871_100227583
305 Ga0075428_100267672
306 Ga0075430_100428998
307 Ga0075431_100008804
308 Ga0068865_100141824
309 Ga0075436_100127795
310 Ga0097620_100033129
311 Ga0097620_100452514
312 Ga0075435_100316220
313 Ga0099795_10005120
314 Ga0099795_10081577
315 Ga0105240_10007391
316 Ga0105240_10032775
317 Ga0105240_10040891
318 Ga0105240_10217092
319 Ga0105245_10263141
320 Ga0114129_10079019
321 Ga0114129_10157357
322 Ga0105243_10055542
323 Ga0105237_10418432
324 Ga0099796_10000128
325 Ga0105239_10052494
326 Ga0105246_10297537
327 Ga0157369_10028992
328 Ga0157374_10018557
329 Ga0163162_10300415
330 Ga0157372_10014940
331 Ga0157375_10042637
332 Ga0157375_10743199
333 Ga0157376_10174800
334 Ga0157376_10226292
335 Ga0213872_10050684
336 Ga0228598_1001606
337 Ga0209025_1000152
338 Ga0209758_1000169
339 Ga0209758_1002944
340 Ga0207682_10000773
341 Ga0207692_10100746
342 Ga0207699_10013238
343 Ga0207643_10056053
344 Ga0207684_10197188
345 Ga0207695_10024867
346 Ga0207695_10047805
347 Ga0207695_10196390
348 Ga0207663_10180310
349 Ga0207660_10282850
350 Ga0207652_10104672
351 Ga0207646_10004715
352 Ga0207646_10034905
353 Ga0207659_10005682
354 Ga0207664_10002133
355 Ga0207706_10145627
356 Ga0207670_10003313
357 Ga0207704_10035897
358 Ga0207704_10040430
359 Ga0207704_10100355
360 Ga0207665_10098499
361 Ga0207665_10104700
362 Ga0207665_10212241
363 Ga0207691_10012066
364 Ga0207711_10092225
365 Ga0207689_10010805
366 Ga0207651_10023326
367 Ga0207651_10056566
368 Ga0207668_10189129
369 Ga0207668_10197619
370 Ga0207703_10064056
371 Ga0207678_10220095
372 Ga0207702_10166412
373 Ga0207641_10075741
374 Ga0207641_10101295
375 Ga0207641_10222745
376 Ga0207648_10071348
377 Ga0207675_100034938
378 Ga0207675_100061715
379 Ga0207683_10201573
380 Ga0209974_10009728
381 Ga0268266_10011750
382 Ga0268265_10141490
383 Ga0268264_10090205
384 Ga0268264_10160795
385 Ga0307515_10153838
386 Ga0265763_1000076
387 Ga0265770_1000007
388 Ga0265760_10000833
389 Ga0307509_10100062
390 Ga0307408_100114112
391 Ga0307508_10317872
392 Ga0316576_10072024
393 Ga0307516_10003963
394 Ga0307413_10016844
395 Ga0307407_10062331
396 Ga0307412_10135687
397 Ga0307409_100002517
398 Ga0307416_100209393
399 Ga0307411_10056657
400 Ga0307415_100051865
401 Ga0307415_100191280
402 Ga0373923_0026198
403 Ga0373943_0004695
404 Ga0373946_0209657
405 Ga0373933_0012987
406 Ga0373947_0031270
407 Ga0373937_0031120
408 Ga0316584_0166640
409 Ga0395900_0084547
410 Ga0395900_0197570
411 Ga0395898_0020339
412 Ga0395898_0020760
413 Ga0395898_0036071
414 Ga0395901_0125340
415 Ga0400483_002929
416 Ga0400483_154058
417 Ga0400483_281294
418 Ga0436361_0200397
419 Ga0451577_0502482
420 Ga0466966_0065176
421 Ga0466966_0081671
422 Ga0466963_0003416
423 Ga0453684_0245875
424 Ga0466959_0120887
425 Ga0451576_0002355
426 Ga0451576_0017273
427 Ga0466958_0188177
428 Ga0466967_0298443
429 Ga0495651_0232815
430 Ga0495650_0012198
431 Ga0495580_0008705
432 Ga0495625_0008103
433 Ga0495657_0062829
434 Ga0495623_0025535
435 Ga0495604_0043627
436 Ga0495686_0082491
437 Ga0496101_0086225
438 Ga0496104_0032491
439 Ga0496105_0001071
440 Ga0496105_0194010
441 Ga0496114_0004355
442 Ga0496115_0008598
443 Ga0496126_0002263
444 Ga0501032_0026600
445 Ga0501036_0029704
446 Ga0501037_0014418
447 Ga0501039_0057670
448 Ga0501041_0165719
449 Ga0501043_0018913
450 Ga0501046_0046263
451 Ga0501048_0025815
452 Ga0501067_0024271
453 Ga0501069_0025059
454 Ga0501070_0120075
455 Ga0501072_0171329
456 Ga0501073_0072395
457 Ga0501073_0104033
458 Ga0501075_0006528
459 Ga0501080_0014789
460 Ga0501081_0434778
461 Ga0501083_0011088
462 Ga0501083_0165326
463 Ga0501035_0080959
464 Ga0501044_0046378
465 Ga0501044_0285515
466 Ga0501045_0275827
467 nmdc:mga05p37_552506_c1
468 nmdc:mga06r32_13153_c1
469 nmdc:mga06r32_42186_c1
470 nmdc:mga0rr50_103855_c1
471 nmdc:mga08x19_297288_c1
472 Ga0495601_0053034
473 Ga0495655_0010044
474 Ga0495595_0103713
475 Ga0500556_0000288
476 Ga0500616_0000637
477 Ga0501084_0157325
478 8054568925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

145

323

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8469 23 294
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8258 23 294
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8189 17 294
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8072 20 287
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8027 20 294
ID Description Score Start End Superfamily
af_P31135_29_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9293 25 298 1.10.3720.10
af_P31135_29_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8949 25 298 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8689 78 295 1.10.3720.10
af_P0AFR7_53_289_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8586 78 297 1.10.3720.10
af_Q2G2B0_2_264_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8517 24 290 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A348W7L0-F1-model_v4 Putrescine/spermidine ABC transporter permease 0.9597 78 301 GO:0005886
GO:0055085
AF-A0A2S9H3K2-F1-model_v4 ABC-type spermidine/putrescine transport system permease component I 0.9508 62 300 GO:0005886
GO:0055085
AF-A0A6P3C273-F1-model_v4 Putrescine/spermidine ABC transporter permease 0.9455 38 301 GO:0005886
GO:0055085
AF-A0A529NW50-F1-model_v4 ABC transporter permease 0.945 91 296 GO:0005886
GO:0055085
AF-A0A354Z646-F1-model_v4 Putrescine ABC transporter permease PotH 0.9447 37 301 GO:0005886
GO:0055085

Map