F350479
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 237 | 188 | 232 | 159 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2526164512|2526210666 |
| Length | 177 |
| Sequence | WARRTLFPHAVREDGPMSRLLFVCMGNICRSPTAEGVFRKLLQTRKLDARFEVDSAGTHGYHVGEPPDPRTQRAAAARGYDLSQMRARKVAPQDLEYFDLILAMDKTNLDNLRRMVDPEKHQKLHLFMEFARNYDDDEVPDPYYGLGYGFDVVIDMVEDASQGLLEALLAPQSVQIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 2 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 3 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 4 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 5 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 45 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 58 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 85 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 86 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 87 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 88 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 89 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 90 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 91 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 92 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 94 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 95 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 96 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 97 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 99 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 100 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 101 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 102 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 103 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 104 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 105 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 106 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 107 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 108 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 109 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 147 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 148 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 149 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 152 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 153 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 154 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 155 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 156 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 157 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 158 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 159 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 160 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 176 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 183 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 184 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 185 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 188 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.89 |
| Metatranscriptomes | 0 |
| Isolates | 2.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.27 |
| Nodule | 0 |
| Rhizoplane | 4.64 |
| Rhizosphere | 85.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25154J39366_1000643 | 3300002738 | Bacteria | 16415 |
| 2 | rootL2_10034274 | 3300003322 | Bacteria | 10155 |
| 3 | Ga0065712_10079204 | 3300005290 | Bacteria | 3246 |
| 4 | Ga0065707_10086070 | 3300005295 | Bacteria | 5684 |
| 5 | Ga0070683_100000736 | 3300005329 | Bacteria | 23963 |
| 6 | Ga0070670_100000901 | 3300005331 | Bacteria | 23375 |
| 7 | Ga0070677_10018622 | 3300005333 | Bacteria | 2503 |
| 8 | Ga0070666_10005441 | 3300005335 | Bacteria | 7806 |
| 9 | Ga0070680_101066368 | 3300005336 | Bacteria | 698 |
| 10 | Ga0070691_10264668 | 3300005341 | Bacteria | 927 |
| 11 | Ga0070661_100001362 | 3300005344 | Bacteria | 17076 |
| 12 | Ga0070668_100438178 | 3300005347 | Unclassified | 1121 |
| 13 | Ga0070675_100000757 | 3300005354 | Bacteria | 22560 |
| 14 | Ga0070671_100000219 | 3300005355 | Bacteria | 38310 |
| 15 | Ga0070674_100006496 | 3300005356 | Bacteria | 6827 |
| 16 | Ga0070709_10235440 | 3300005434 | Bacteria | 1312 |
| 17 | Ga0070700_100732228 | 3300005441 | Unclassified | 789 |
| 18 | Ga0070694_100421952 | 3300005444 | Bacteria | 1048 |
| 19 | Ga0070678_100000219 | 3300005456 | Bacteria | 25787 |
| 20 | Ga0070662_100041664 | 3300005457 | Bacteria | 3277 |
| 21 | Ga0070681_10283945 | 3300005458 | Bacteria | 1566 |
| 22 | Ga0068867_100039519 | 3300005459 | Bacteria | 3440 |
| 23 | Ga0070707_101252489 | 3300005468 | Bacteria | 708 |
| 24 | Ga0070679_100347898 | 3300005530 | Bacteria | 1430 |
| 25 | Ga0070684_100134543 | 3300005535 | Bacteria | 2232 |
| 26 | Ga0070697_101034274 | 3300005536 | Bacteria | 730 |
| 27 | Ga0068853_100351922 | 3300005539 | Unclassified | 1370 |
| 28 | Ga0070672_100000090 | 3300005543 | Bacteria | 44222 |
| 29 | Ga0070695_100776430 | 3300005545 | Bacteria | 766 |
| 30 | Ga0070665_100889613 | 3300005548 | Unclassified | 903 |
| 31 | Ga0070664_100000742 | 3300005564 | Bacteria | 25137 |
| 32 | Ga0068854_100003478 | 3300005578 | Bacteria | 9835 |
| 33 | Ga0068852_100000201 | 3300005616 | Bacteria | 40698 |
| 34 | Ga0068864_100010680 | 3300005618 | Bacteria | 7589 |
| 35 | Ga0068866_10055797 | 3300005718 | Bacteria | 2030 |
| 36 | Ga0068851_10123182 | 3300005834 | Unclassified | 1395 |
| 37 | Ga0097621_100000764 | 3300006237 | Bacteria | 22560 |
| 38 | Ga0068871_100000434 | 3300006358 | Bacteria | 28753 |
| 39 | Ga0075436_100196527 | 3300006914 | Bacteria | 1428 |
| 40 | Ga0099794_10039444 | 3300007265 | Bacteria | 2242 |
| 41 | Ga0105247_11287897 | 3300009101 | Bacteria | 586 |
| 42 | Ga0105243_10502429 | 3300009148 | Unclassified | 1149 |
| 43 | Ga0105248_10790850 | 3300009177 | Unclassified | 1071 |
| 44 | Ga0105239_12422754 | 3300010375 | Unclassified | 611 |
| 45 | Ga0157371_10471090 | 3300013102 | Unclassified | 925 |
| 46 | Ga0157374_10006450 | 3300013296 | Bacteria | 9960 |
| 47 | Ga0157378_10028765 | 3300013297 | Bacteria | 4907 |
| 48 | Ga0163162_10060532 | 3300013306 | Bacteria | 3822 |
| 49 | Ga0157375_10008297 | 3300013308 | Bacteria | 9099 |
| 50 | Ga0157376_10574808 | 3300014969 | Unclassified | 1118 |
| 51 | Ga0163161_10064656 | 3300017792 | Bacteria | 2669 |
| 52 | Ga0209646_1000007 | 3300025246 | Bacteria | 670994 |
| 53 | Ga0207656_10077082 | 3300025321 | Bacteria | 1492 |
| 54 | Ga0207682_10040246 | 3300025893 | Bacteria | 1903 |
| 55 | Ga0207642_10076348 | 3300025899 | Unclassified | 1612 |
| 56 | Ga0207680_10069077 | 3300025903 | Unclassified | 2182 |
| 57 | Ga0207699_10211218 | 3300025906 | Bacteria | 1320 |
| 58 | Ga0207649_10340568 | 3300025920 | Unclassified | 1107 |
| 59 | Ga0207652_10387093 | 3300025921 | Bacteria | 1262 |
| 60 | Ga0207650_10000726 | 3300025925 | Bacteria | 25560 |
| 61 | Ga0207659_10008293 | 3300025926 | Bacteria | 6442 |
| 62 | Ga0207644_10021333 | 3300025931 | Bacteria | 4411 |
| 63 | Ga0207709_10323272 | 3300025935 | Unclassified | 1155 |
| 64 | Ga0207691_10000431 | 3300025940 | Bacteria | 41756 |
| 65 | Ga0207661_10023428 | 3300025944 | Bacteria | 4664 |
| 66 | Ga0207679_10016177 | 3300025945 | Bacteria | 4947 |
| 67 | Ga0207651_10001359 | 3300025960 | Bacteria | 11078 |
| 68 | Ga0207668_10679473 | 3300025972 | Unclassified | 903 |
| 69 | Ga0207640_10025066 | 3300025981 | Bacteria | 3606 |
| 70 | Ga0207677_10001394 | 3300026023 | Bacteria | 12909 |
| 71 | Ga0207703_11132494 | 3300026035 | Unclassified | 752 |
| 72 | Ga0207639_11312379 | 3300026041 | Unclassified | 679 |
| 73 | Ga0207641_10069268 | 3300026088 | Bacteria | 3028 |
| 74 | Ga0207641_10449095 | 3300026088 | Bacteria | 1246 |
| 75 | Ga0207648_10444085 | 3300026089 | Unclassified | 1180 |
| 76 | Ga0207676_10007975 | 3300026095 | Bacteria | 7527 |
| 77 | Ga0207683_10000536 | 3300026121 | Bacteria | 35159 |
| 78 | Ga0207698_10062902 | 3300026142 | Bacteria | 2901 |
| 79 | Ga0268266_10229547 | 3300028379 | Unclassified | 1709 |
| 80 | Ga0265318_10002194 | 3300028577 | Bacteria | 10557 |
| 81 | Ga0307515_10000053 | 3300028794 | Bacteria | 266512 |
| 82 | Ga0265332_10000868 | 3300031238 | Bacteria | 18323 |
| 83 | Ga0265331_10001456 | 3300031250 | Bacteria | 17402 |
| 84 | Ga0265316_10441488 | 3300031344 | Bacteria | 934 |
| 85 | Ga0307513_10194964 | 3300031456 | Bacteria | 1873 |
| 86 | Ga0307408_100000678 | 3300031548 | Bacteria | 28125 |
| 87 | Ga0307508_10118525 | 3300031616 | Bacteria | 2248 |
| 88 | Ga0265314_10002149 | 3300031711 | Bacteria | 20606 |
| 89 | Ga0265314_10159109 | 3300031711 | Bacteria | 1376 |
| 90 | Ga0307416_100107622 | 3300032002 | Bacteria | 2447 |
| 91 | Ga0307414_10902558 | 3300032004 | Bacteria | 810 |
| 92 | Ga0373951_0095309 | 3300035091 | Bacteria | 785 |
| 93 | Ga0373954_0390598 | 3300035118 | Bacteria | 688 |
| 94 | Ga0373925_0309461 | 3300037068 | Bacteria | 1277 |
| 95 | Ga0373925_0396116 | 3300037068 | Unclassified | 1126 |
| 96 | Ga0451800_1474291 | 3300041459 | Bacteria | 1097 |
| 97 | Ga0451851_0093493 | 3300041507 | Unclassified | 534 |
| 98 | Ga0451843_0155865 | 3300041509 | Bacteria | 1790 |
| 99 | Ga0451853_3816489 | 3300041512 | Bacteria | 1967 |
| 100 | Ga0451577_0484670 | 3300042876 | Bacteria | 1123 |
| 101 | Ga0451577_0633069 | 3300042876 | Bacteria | 970 |
| 102 | Ga0466966_0187080 | 3300044684 | Bacteria | 1255 |
| 103 | Ga0453684_0000847 | 3300044712 | Bacteria | 103142 |
| 104 | Ga0453684_0038310 | 3300044712 | Bacteria | 6557 |
| 105 | Ga0453684_0051615 | 3300044712 | Bacteria | 5388 |
| 106 | Ga0453684_0061927 | 3300044712 | Bacteria | 4798 |
| 107 | Ga0466971_0124517 | 3300044719 | Bacteria | 1194 |
| 108 | Ga0466960_0184585 | 3300044901 | Bacteria | 1132 |
| 109 | Ga0466959_0184993 | 3300045049 | Bacteria | 1456 |
| 110 | Ga0451576_0148075 | 3300045051 | Bacteria | 2448 |
| 111 | Ga0451576_0176152 | 3300045051 | Bacteria | 2233 |
| 112 | Ga0451576_0249135 | 3300045051 | Bacteria | 1856 |
| 113 | Ga0495617_003359 | 3300046452 | Bacteria | 6038 |
| 114 | Ga0495617_020093 | 3300046452 | Bacteria | 2256 |
| 115 | Ga0495590_0000005 | 3300046457 | Bacteria | 384276 |
| 116 | Ga0495590_0268757 | 3300046457 | Bacteria | 637 |
| 117 | Ga0495638_0000349 | 3300046460 | Bacteria | 57958 |
| 118 | Ga0495638_0009621 | 3300046460 | Bacteria | 6763 |
| 119 | Ga0495638_0121605 | 3300046460 | Bacteria | 1542 |
| 120 | Ga0495653_0000040 | 3300046463 | Bacteria | 119794 |
| 121 | Ga0495650_0000044 | 3300046471 | Bacteria | 355139 |
| 122 | Ga0495650_0011748 | 3300046471 | Bacteria | 4763 |
| 123 | Ga0495650_0023692 | 3300046471 | Bacteria | 2917 |
| 124 | Ga0495605_0000038 | 3300046474 | Bacteria | 197063 |
| 125 | Ga0495639_0069997 | 3300046475 | Bacteria | 1619 |
| 126 | Ga0495584_0236092 | 3300046491 | Bacteria | 929 |
| 127 | Ga0495607_0002281 | 3300046501 | Bacteria | 15782 |
| 128 | Ga0495583_0000100 | 3300046506 | Bacteria | 145745 |
| 129 | Ga0495583_0023736 | 3300046506 | Bacteria | 3095 |
| 130 | Ga0495606_0000053 | 3300046507 | Bacteria | 200818 |
| 131 | Ga0495606_0000202 | 3300046507 | Bacteria | 103924 |
| 132 | Ga0495606_0002070 | 3300046507 | Bacteria | 24503 |
| 133 | Ga0495606_0003035 | 3300046507 | Bacteria | 18341 |
| 134 | Ga0495606_0003994 | 3300046507 | Bacteria | 15071 |
| 135 | Ga0495606_0007957 | 3300046507 | Bacteria | 9332 |
| 136 | Ga0495610_0009686 | 3300046512 | Bacteria | 6063 |
| 137 | Ga0495610_0012434 | 3300046512 | Bacteria | 5124 |
| 138 | Ga0495610_0014927 | 3300046512 | Bacteria | 4541 |
| 139 | Ga0495637_0001097 | 3300046520 | Bacteria | 16706 |
| 140 | Ga0495637_0039533 | 3300046520 | Bacteria | 2035 |
| 141 | Ga0495643_0000195 | 3300046522 | Bacteria | 96110 |
| 142 | Ga0495643_0142832 | 3300046522 | Bacteria | 1192 |
| 143 | Ga0495648_0000002 | 3300046524 | Bacteria | 593972 |
| 144 | Ga0495648_0035209 | 3300046524 | Bacteria | 3248 |
| 145 | Ga0495648_0254098 | 3300046524 | Bacteria | 847 |
| 146 | Ga0495648_0369878 | 3300046524 | Bacteria | 649 |
| 147 | Ga0495642_0005806 | 3300046528 | Bacteria | 4733 |
| 148 | Ga0495642_0093720 | 3300046528 | Bacteria | 1273 |
| 149 | Ga0495642_0167055 | 3300046528 | Bacteria | 955 |
| 150 | Ga0495654_0000002 | 3300046530 | Bacteria | 1021205 |
| 151 | Ga0495609_0052419 | 3300046538 | Bacteria | 1815 |
| 152 | Ga0495597_0000055 | 3300046542 | Bacteria | 95175 |
| 153 | Ga0495622_0000009 | 3300046557 | Bacteria | 224622 |
| 154 | Ga0495622_0000586 | 3300046557 | Bacteria | 21427 |
| 155 | Ga0495633_0000024 | 3300046558 | Bacteria | 225077 |
| 156 | Ga0495633_0002266 | 3300046558 | Bacteria | 13757 |
| 157 | Ga0495633_0005574 | 3300046558 | Bacteria | 7641 |
| 158 | Ga0495633_0148135 | 3300046558 | Bacteria | 1084 |
| 159 | Ga0495668_0000719 | 3300046616 | Bacteria | 39799 |
| 160 | Ga0495668_0001072 | 3300046616 | Bacteria | 28855 |
| 161 | Ga0495668_0069116 | 3300046616 | Bacteria | 1942 |
| 162 | Ga0495625_0000124 | 3300046660 | Bacteria | 120849 |
| 163 | Ga0495625_0002530 | 3300046660 | Bacteria | 19664 |
| 164 | Ga0495625_0004642 | 3300046660 | Bacteria | 12903 |
| 165 | Ga0495625_0005977 | 3300046660 | Bacteria | 10941 |
| 166 | Ga0495659_0002003 | 3300046664 | Bacteria | 6697 |
| 167 | Ga0495669_0008337 | 3300046684 | Bacteria | 4356 |
| 168 | Ga0495670_0088162 | 3300046691 | Bacteria | 1586 |
| 169 | Ga0495671_0044642 | 3300046692 | Bacteria | 2221 |
| 170 | Ga0495649_0006472 | 3300046694 | Bacteria | 7289 |
| 171 | Ga0495649_0019600 | 3300046694 | Bacteria | 3800 |
| 172 | Ga0495660_0008228 | 3300046810 | Bacteria | 6111 |
| 173 | Ga0495660_0082619 | 3300046810 | Bacteria | 1682 |
| 174 | Ga0495660_0226934 | 3300046810 | Bacteria | 877 |
| 175 | Ga0495672_0000605 | 3300047320 | Bacteria | 40392 |
| 176 | Ga0495672_0066700 | 3300047320 | Bacteria | 2052 |
| 177 | Ga0495683_0173852 | 3300047323 | Bacteria | 988 |
| 178 | Ga0495687_002204 | 3300047443 | Bacteria | 16131 |
| 179 | Ga0495687_187341 | 3300047443 | Bacteria | 669 |
| 180 | Ga0495685_207302 | 3300047447 | Bacteria | 627 |
| 181 | Ga0495673_0000005 | 3300047469 | Bacteria | 943364 |
| 182 | Ga0495673_0000199 | 3300047469 | Bacteria | 93637 |
| 183 | Ga0495673_0041948 | 3300047469 | Bacteria | 2057 |
| 184 | Ga0495686_0007109 | 3300047472 | Bacteria | 8435 |
| 185 | Ga0495615_0068938 | 3300048090 | Bacteria | 949 |
| 186 | Ga0496100_0059346 | 3300048903 | Bacteria | 2514 |
| 187 | Ga0496104_1235590 | 3300048907 | Unclassified | 650 |
| 188 | Ga0496105_0374873 | 3300048908 | Unclassified | 1133 |
| 189 | Ga0496106_0139506 | 3300048909 | Bacteria | 1906 |
| 190 | Ga0496108_0008718 | 3300048911 | Bacteria | 8222 |
| 191 | Ga0496109_0011704 | 3300048912 | Bacteria | 7546 |
| 192 | Ga0496110_0003126 | 3300048913 | Bacteria | 12576 |
| 193 | Ga0496111_0070903 | 3300048914 | Bacteria | 2536 |
| 194 | Ga0496112_0818713 | 3300048915 | Unclassified | 855 |
| 195 | Ga0496114_0055215 | 3300048917 | Bacteria | 3313 |
| 196 | Ga0496116_0019950 | 3300048919 | Bacteria | 5111 |
| 197 | Ga0496119_0048498 | 3300048922 | Bacteria | 2633 |
| 198 | Ga0496121_0056351 | 3300048924 | Bacteria | 3265 |
| 199 | Ga0496121_0221086 | 3300048924 | Bacteria | 1334 |
| 200 | Ga0496123_0005389 | 3300048926 | Bacteria | 12889 |
| 201 | Ga0496124_0121735 | 3300048927 | Bacteria | 2084 |
| 202 | Ga0495678_000071 | 3300049459 | Bacteria | 128709 |
| 203 | Ga0495678_004558 | 3300049459 | Bacteria | 7969 |
| 204 | Ga0495678_012576 | 3300049459 | Bacteria | 4009 |
| 205 | Ga0501034_0054863 | 3300049571 | Bacteria | 4011 |
| 206 | Ga0501039_0034265 | 3300049575 | Bacteria | 3919 |
| 207 | Ga0501040_0020729 | 3300049576 | Bacteria | 4383 |
| 208 | Ga0501041_0039907 | 3300049577 | Bacteria | 2848 |
| 209 | Ga0501047_0175288 | 3300049581 | Bacteria | 2012 |
| 210 | Ga0501048_0019687 | 3300049582 | Bacteria | 4950 |
| 211 | Ga0501068_0146319 | 3300049584 | Bacteria | 1483 |
| 212 | Ga0501070_0311586 | 3300049586 | Bacteria | 1281 |
| 213 | Ga0501071_0255733 | 3300049587 | Bacteria | 1322 |
| 214 | Ga0501072_0017625 | 3300049588 | Bacteria | 5492 |
| 215 | Ga0501074_0337039 | 3300049590 | Bacteria | 1070 |
| 216 | Ga0501075_0037840 | 3300049591 | Bacteria | 3606 |
| 217 | Ga0501076_0087500 | 3300049592 | Bacteria | 2504 |
| 218 | Ga0501077_0085789 | 3300049593 | Bacteria | 1996 |
| 219 | Ga0501230_028077 | 3300049667 | Bacteria | 1032 |
| 220 | Ga0501079_0102244 | 3300049741 | Bacteria | 2222 |
| 221 | Ga0501080_0128777 | 3300049742 | Bacteria | 2343 |
| 222 | Ga0501081_0266442 | 3300049743 | Bacteria | 1252 |
| 223 | Ga0501083_0141287 | 3300049744 | Bacteria | 1577 |
| 224 | Ga0501045_0016752 | 3300049824 | Bacteria | 5206 |
| 225 | nmdc:mga08x19_336213_c1 | 3300050514 | Bacteria | 1053 |
| 226 | Ga0500618_000857 | 3300053125 | Bacteria | 16351 |
| 227 | Ga0500586_001403 | 3300053145 | Bacteria | 5069 |
| 228 | Ga0500633_0337802 | 3300053160 | Bacteria | 550 |
| 229 | Ga0501084_0024193 | 3300054114 | Bacteria | 5066 |
| 230 | Ga0501082_0224808 | 3300060353 | Bacteria | 1633 |
| 231 | Ga0466962_0206112 | 3300061719 | Bacteria | 961 |
| 232 | Ga0530510_0057625 | 3300061734 | Bacteria | 2807 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009101 | Ga0105247_11287897 | Ga0105247_112878972 | 128 |
| 2 | 3300047323 | Ga0495683_0173852 | Ga0495683_0173852_554_964 | 133 |
| 3 | 3300045051 | Ga0451576_0148075 | Ga0451576_0148075_569_1012 | 145 |
| 4 | 3300046457 | Ga0495590_0268757 | Ga0495590_0268757_111_551 | 145 |
| 5 | 3300046460 | Ga0495638_0121605 | Ga0495638_0121605_689_1129 | 145 |
| 6 | 3300046491 | Ga0495584_0236092 | Ga0495584_0236092_364_804 | 145 |
| 7 | 3300046506 | Ga0495583_0023736 | Ga0495583_0023736_1853_2293 | 145 |
| 8 | 3300046507 | Ga0495606_0002070 | Ga0495606_0002070_6891_7337 | 145 |
| 9 | 3300046524 | Ga0495648_0254098 | Ga0495648_0254098_64_504 | 145 |
| 10 | 3300046528 | Ga0495642_0093720 | Ga0495642_0093720_692_1132 | 145 |
| 11 | 3300046616 | Ga0495668_0069116 | Ga0495668_0069116_847_1287 | 145 |
| 12 | 3300046660 | Ga0495625_0004642 | Ga0495625_0004642_10140_10580 | 145 |
| 13 | 3300046664 | Ga0495659_0002003 | Ga0495659_0002003_2876_3316 | 145 |
| 14 | 3300046684 | Ga0495669_0008337 | Ga0495669_0008337_1736_2176 | 145 |
| 15 | 3300046694 | Ga0495649_0019600 | Ga0495649_0019600_793_1233 | 145 |
| 16 | 3300046810 | Ga0495660_0082619 | Ga0495660_0082619_731_1171 | 145 |
| 17 | 3300047443 | Ga0495687_187341 | Ga0495687_187341_179_619 | 145 |
| 18 | 3300047447 | Ga0495685_207302 | Ga0495685_207302_143_583 | 145 |
| 19 | 3300046471 | Ga0495650_0023692 | Ga0495650_0023692_1481_1966 | 146 |
| 20 | 3300046520 | Ga0495637_0001097 | Ga0495637_0001097_2754_3239 | 146 |
| 21 | 3300046530 | Ga0495654_0000002 | Ga0495654_0000002_898151_898636 | 146 |
| 22 | 3300046810 | Ga0495660_0226934 | Ga0495660_0226934_139_624 | 146 |
| 23 | 3300005457 | Ga0070662_100041664 | Ga0070662_1000416642 | 147 |
| 24 | 3300005535 | Ga0070684_100134543 | Ga0070684_1001345432 | 147 |
| 25 | 3300005539 | Ga0068853_100351922 | Ga0068853_1003519221 | 147 |
| 26 | 3300009148 | Ga0105243_10502429 | Ga0105243_105024292 | 147 |
| 27 | 3300009177 | Ga0105248_10790850 | Ga0105248_107908502 | 147 |
| 28 | 3300010375 | Ga0105239_12422754 | Ga0105239_124227541 | 147 |
| 29 | 3300013102 | Ga0157371_10471090 | Ga0157371_104710901 | 147 |
| 30 | 3300013296 | Ga0157374_10006450 | Ga0157374_100064508 | 147 |
| 31 | 3300013297 | Ga0157378_10028765 | Ga0157378_100287655 | 147 |
| 32 | 3300013306 | Ga0163162_10060532 | Ga0163162_100605322 | 147 |
| 33 | 3300013308 | Ga0157375_10008297 | Ga0157375_100082979 | 147 |
| 34 | 3300014969 | Ga0157376_10574808 | Ga0157376_105748082 | 147 |
| 35 | 3300028577 | Ga0265318_10002194 | Ga0265318_1000219410 | 147 |
| 36 | 3300031238 | Ga0265332_10000868 | Ga0265332_100008687 | 147 |
| 37 | 3300031250 | Ga0265331_10001456 | Ga0265331_100014565 | 147 |
| 38 | 3300031711 | Ga0265314_10002149 | Ga0265314_1000214911 | 147 |
| 39 | 3300035091 | Ga0373951_0095309 | Ga0373951_0095309_256_711 | 147 |
| 40 | 3300046507 | Ga0495606_0007957 | Ga0495606_0007957_3329_3784 | 147 |
| 41 | 3300046660 | Ga0495625_0002530 | Ga0495625_0002530_8484_8933 | 147 |
| 42 | 3300048922 | Ga0496119_0048498 | Ga0496119_0048498_205_672 | 147 |
| 43 | 3300042876 | Ga0451577_0633069 | Ga0451577_0633069_97_570 | 150 |
| 44 | 3300026088 | Ga0207641_10449095 | Ga0207641_104490952 | 153 |
| 45 | 3300005295 | Ga0065707_10086070 | Ga0065707_100860701 | 154 |
| 46 | 3300049667 | Ga0501230_028077 | Ga0501230_028077_434_919 | 154 |
| 47 | 3300050514 | nmdc:mga08x19_336213_c1 | nmdc:mga08x19_336213_c1_122_604 | 154 |
| 48 | iso_pu_bacteria | 2821131069 | 2821132675 | 154 |
| 49 | iso_pu_bacteria | 2842711865 | 2842716454 | 154 |
| 50 | 3300031344 | Ga0265316_10441488 | Ga0265316_104414881 | 155 |
| 51 | 3300031548 | Ga0307408_100000678 | Ga0307408_10000067813 | 155 |
| 52 | 3300031616 | Ga0307508_10118525 | Ga0307508_101185252 | 155 |
| 53 | 3300032004 | Ga0307414_10902558 | Ga0307414_109025581 | 155 |
| 54 | 3300035118 | Ga0373954_0390598 | Ga0373954_0390598_12_491 | 155 |
| 55 | 3300037068 | Ga0373925_0309461 | Ga0373925_0309461_269_751 | 155 |
| 56 | 3300041509 | Ga0451843_0155865 | Ga0451843_0155865_513_995 | 155 |
| 57 | 3300042876 | Ga0451577_0484670 | Ga0451577_0484670_610_1092 | 155 |
| 58 | 3300044684 | Ga0466966_0187080 | Ga0466966_0187080_603_1103 | 155 |
| 59 | 3300044712 | Ga0453684_0000847 | Ga0453684_0000847_90639_91121 | 155 |
| 60 | 3300044712 | Ga0453684_0038310 | Ga0453684_0038310_723_1205 | 155 |
| 61 | 3300044712 | Ga0453684_0051615 | Ga0453684_0051615_999_1481 | 155 |
| 62 | 3300044712 | Ga0453684_0061927 | Ga0453684_0061927_1408_1881 | 155 |
| 63 | 3300044719 | Ga0466971_0124517 | Ga0466971_0124517_395_895 | 155 |
| 64 | 3300044901 | Ga0466960_0184585 | Ga0466960_0184585_192_668 | 155 |
| 65 | 3300045049 | Ga0466959_0184993 | Ga0466959_0184993_694_1194 | 155 |
| 66 | 3300045051 | Ga0451576_0176152 | Ga0451576_0176152_119_589 | 155 |
| 67 | 3300045051 | Ga0451576_0249135 | Ga0451576_0249135_79_561 | 155 |
| 68 | 3300046452 | Ga0495617_020093 | Ga0495617_020093_1203_1679 | 155 |
| 69 | 3300046460 | Ga0495638_0009621 | Ga0495638_0009621_5092_5568 | 155 |
| 70 | 3300047320 | Ga0495672_0066700 | Ga0495672_0066700_502_978 | 155 |
| 71 | 3300047469 | Ga0495673_0041948 | Ga0495673_0041948_249_725 | 155 |
| 72 | 3300048924 | Ga0496121_0221086 | Ga0496121_0221086_414_908 | 155 |
| 73 | 3300049571 | Ga0501034_0054863 | Ga0501034_0054863_2885_3361 | 155 |
| 74 | 3300049575 | Ga0501039_0034265 | Ga0501039_0034265_231_713 | 155 |
| 75 | 3300049576 | Ga0501040_0020729 | Ga0501040_0020729_3397_3879 | 155 |
| 76 | 3300049577 | Ga0501041_0039907 | Ga0501041_0039907_650_1132 | 155 |
| 77 | 3300049581 | Ga0501047_0175288 | Ga0501047_0175288_524_1012 | 155 |
| 78 | 3300049582 | Ga0501048_0019687 | Ga0501048_0019687_510_992 | 155 |
| 79 | 3300049584 | Ga0501068_0146319 | Ga0501068_0146319_944_1426 | 155 |
| 80 | 3300049586 | Ga0501070_0311586 | Ga0501070_0311586_352_834 | 155 |
| 81 | 3300049587 | Ga0501071_0255733 | Ga0501071_0255733_160_642 | 155 |
| 82 | 3300049588 | Ga0501072_0017625 | Ga0501072_0017625_4200_4682 | 155 |
| 83 | 3300049590 | Ga0501074_0337039 | Ga0501074_0337039_445_927 | 155 |
| 84 | 3300049591 | Ga0501075_0037840 | Ga0501075_0037840_1601_2083 | 155 |
| 85 | 3300049592 | Ga0501076_0087500 | Ga0501076_0087500_1396_1878 | 155 |
| 86 | 3300049593 | Ga0501077_0085789 | Ga0501077_0085789_415_897 | 155 |
| 87 | 3300049741 | Ga0501079_0102244 | Ga0501079_0102244_208_690 | 155 |
| 88 | 3300049742 | Ga0501080_0128777 | Ga0501080_0128777_873_1355 | 155 |
| 89 | 3300049743 | Ga0501081_0266442 | Ga0501081_0266442_694_1176 | 155 |
| 90 | 3300049744 | Ga0501083_0141287 | Ga0501083_0141287_369_851 | 155 |
| 91 | 3300049824 | Ga0501045_0016752 | Ga0501045_0016752_3208_3690 | 155 |
| 92 | 3300054114 | Ga0501084_0024193 | Ga0501084_0024193_566_1048 | 155 |
| 93 | 3300060353 | Ga0501082_0224808 | Ga0501082_0224808_261_743 | 155 |
| 94 | 3300061719 | Ga0466962_0206112 | Ga0466962_0206112_317_817 | 155 |
| 95 | 3300061734 | Ga0530510_0057625 | Ga0530510_0057625_1570_2052 | 155 |
| 96 | iso_pu_bacteria | 2643221645 | 2644253431 | 155 |
| 97 | iso_pu_bacteria | 2857564685 | 2857566747 | 155 |
| 98 | 3300003322 | rootL2_10034274 | rootL2_100342743 | 156 |
| 99 | 3300005336 | Ga0070680_101066368 | Ga0070680_1010663681 | 156 |
| 100 | 3300005341 | Ga0070691_10264668 | Ga0070691_102646682 | 156 |
| 101 | 3300005444 | Ga0070694_100421952 | Ga0070694_1004219522 | 156 |
| 102 | 3300005545 | Ga0070695_100776430 | Ga0070695_1007764301 | 156 |
| 103 | 3300031456 | Ga0307513_10194964 | Ga0307513_101949642 | 156 |
| 104 | 3300032002 | Ga0307416_100107622 | Ga0307416_1001076222 | 156 |
| 105 | 3300046452 | Ga0495617_003359 | Ga0495617_003359_3276_3755 | 156 |
| 106 | 3300046520 | Ga0495637_0039533 | Ga0495637_0039533_1008_1487 | 156 |
| 107 | 3300053160 | Ga0500633_0337802 | Ga0500633_0337802_58_537 | 156 |
| 108 | 3300046474 | Ga0495605_0000038 | Ga0495605_0000038_83508_83981 | 157 |
| 109 | 3300046524 | Ga0495648_0035209 | Ga0495648_0035209_1122_1601 | 157 |
| 110 | 3300002738 | JGI25154J39366_1000643 | JGI25154J39366_100064313 | 158 |
| 111 | 3300005290 | Ga0065712_10079204 | Ga0065712_100792044 | 158 |
| 112 | 3300005329 | Ga0070683_100000736 | Ga0070683_1000007362 | 158 |
| 113 | 3300005331 | Ga0070670_100000901 | Ga0070670_10000090126 | 158 |
| 114 | 3300005333 | Ga0070677_10018622 | Ga0070677_100186222 | 158 |
| 115 | 3300005335 | Ga0070666_10005441 | Ga0070666_100054413 | 158 |
| 116 | 3300005344 | Ga0070661_100001362 | Ga0070661_1000013626 | 158 |
| 117 | 3300005347 | Ga0070668_100438178 | Ga0070668_1004381782 | 158 |
| 118 | 3300005354 | Ga0070675_100000757 | Ga0070675_10000075727 | 158 |
| 119 | 3300005355 | Ga0070671_100000219 | Ga0070671_10000021921 | 158 |
| 120 | 3300005356 | Ga0070674_100006496 | Ga0070674_1000064966 | 158 |
| 121 | 3300005434 | Ga0070709_10235440 | Ga0070709_102354403 | 158 |
| 122 | 3300005441 | Ga0070700_100732228 | Ga0070700_1007322281 | 158 |
| 123 | 3300005456 | Ga0070678_100000219 | Ga0070678_10000021912 | 158 |
| 124 | 3300005458 | Ga0070681_10283945 | Ga0070681_102839452 | 158 |
| 125 | 3300005459 | Ga0068867_100039519 | Ga0068867_1000395192 | 158 |
| 126 | 3300005468 | Ga0070707_101252489 | Ga0070707_1012524891 | 158 |
| 127 | 3300005530 | Ga0070679_100347898 | Ga0070679_1003478982 | 158 |
| 128 | 3300005536 | Ga0070697_101034274 | Ga0070697_1010342741 | 158 |
| 129 | 3300005543 | Ga0070672_100000090 | Ga0070672_10000009032 | 158 |
| 130 | 3300005548 | Ga0070665_100889613 | Ga0070665_1008896131 | 158 |
| 131 | 3300005564 | Ga0070664_100000742 | Ga0070664_1000007424 | 158 |
| 132 | 3300005578 | Ga0068854_100003478 | Ga0068854_10000347812 | 158 |
| 133 | 3300005616 | Ga0068852_100000201 | Ga0068852_10000020122 | 158 |
| 134 | 3300005618 | Ga0068864_100010680 | Ga0068864_1000106804 | 158 |
| 135 | 3300005718 | Ga0068866_10055797 | Ga0068866_100557971 | 158 |
| 136 | 3300005834 | Ga0068851_10123182 | Ga0068851_101231822 | 158 |
| 137 | 3300006237 | Ga0097621_100000764 | Ga0097621_1000007645 | 158 |
| 138 | 3300006358 | Ga0068871_100000434 | Ga0068871_10000043413 | 158 |
| 139 | 3300006914 | Ga0075436_100196527 | Ga0075436_1001965272 | 158 |
| 140 | 3300007265 | Ga0099794_10039444 | Ga0099794_100394442 | 158 |
| 141 | 3300017792 | Ga0163161_10064656 | Ga0163161_100646562 | 158 |
| 142 | 3300025246 | Ga0209646_1000007 | Ga0209646_1000007100 | 158 |
| 143 | 3300025321 | Ga0207656_10077082 | Ga0207656_100770822 | 158 |
| 144 | 3300025893 | Ga0207682_10040246 | Ga0207682_100402462 | 158 |
| 145 | 3300025899 | Ga0207642_10076348 | Ga0207642_100763481 | 158 |
| 146 | 3300025903 | Ga0207680_10069077 | Ga0207680_100690773 | 158 |
| 147 | 3300025906 | Ga0207699_10211218 | Ga0207699_102112181 | 158 |
| 148 | 3300025920 | Ga0207649_10340568 | Ga0207649_103405682 | 158 |
| 149 | 3300025921 | Ga0207652_10387093 | Ga0207652_103870932 | 158 |
| 150 | 3300025925 | Ga0207650_10000726 | Ga0207650_1000072619 | 158 |
| 151 | 3300025926 | Ga0207659_10008293 | Ga0207659_100082935 | 158 |
| 152 | 3300025931 | Ga0207644_10021333 | Ga0207644_100213334 | 158 |
| 153 | 3300025935 | Ga0207709_10323272 | Ga0207709_103232722 | 158 |
| 154 | 3300025940 | Ga0207691_10000431 | Ga0207691_1000043138 | 158 |
| 155 | 3300025944 | Ga0207661_10023428 | Ga0207661_100234282 | 158 |
| 156 | 3300025945 | Ga0207679_10016177 | Ga0207679_100161773 | 158 |
| 157 | 3300025960 | Ga0207651_10001359 | Ga0207651_100013597 | 158 |
| 158 | 3300025972 | Ga0207668_10679473 | Ga0207668_106794732 | 158 |
| 159 | 3300025981 | Ga0207640_10025066 | Ga0207640_100250662 | 158 |
| 160 | 3300026023 | Ga0207677_10001394 | Ga0207677_100013944 | 158 |
| 161 | 3300026035 | Ga0207703_11132494 | Ga0207703_111324942 | 158 |
| 162 | 3300026041 | Ga0207639_11312379 | Ga0207639_113123791 | 158 |
| 163 | 3300026088 | Ga0207641_10069268 | Ga0207641_100692682 | 158 |
| 164 | 3300026089 | Ga0207648_10444085 | Ga0207648_104440852 | 158 |
| 165 | 3300026095 | Ga0207676_10007975 | Ga0207676_100079754 | 158 |
| 166 | 3300026121 | Ga0207683_10000536 | Ga0207683_1000053619 | 158 |
| 167 | 3300026142 | Ga0207698_10062902 | Ga0207698_100629024 | 158 |
| 168 | 3300028379 | Ga0268266_10229547 | Ga0268266_102295472 | 158 |
| 169 | 3300028794 | Ga0307515_10000053 | Ga0307515_10000053129 | 158 |
| 170 | 3300031711 | Ga0265314_10159109 | Ga0265314_101591092 | 158 |
| 171 | 3300037068 | Ga0373925_0396116 | Ga0373925_0396116_153_641 | 158 |
| 172 | 3300041459 | Ga0451800_1474291 | Ga0451800_1474291_521_1021 | 158 |
| 173 | 3300041507 | Ga0451851_0093493 | Ga0451851_0093493_35_523 | 158 |
| 174 | 3300041512 | Ga0451853_3816489 | Ga0451853_3816489_484_972 | 158 |
| 175 | 3300046457 | Ga0495590_0000005 | Ga0495590_0000005_102808_103284 | 158 |
| 176 | 3300046460 | Ga0495638_0000349 | Ga0495638_0000349_17335_17811 | 158 |
| 177 | 3300046463 | Ga0495653_0000040 | Ga0495653_0000040_96686_97180 | 158 |
| 178 | 3300046471 | Ga0495650_0000044 | Ga0495650_0000044_95152_95631 | 158 |
| 179 | 3300046471 | Ga0495650_0011748 | Ga0495650_0011748_2837_3313 | 158 |
| 180 | 3300046475 | Ga0495639_0069997 | Ga0495639_0069997_1083_1559 | 158 |
| 181 | 3300046501 | Ga0495607_0002281 | Ga0495607_0002281_1591_2067 | 158 |
| 182 | 3300046506 | Ga0495583_0000100 | Ga0495583_0000100_136254_136730 | 158 |
| 183 | 3300046507 | Ga0495606_0000053 | Ga0495606_0000053_91118_91603 | 158 |
| 184 | 3300046507 | Ga0495606_0000202 | Ga0495606_0000202_2490_2984 | 158 |
| 185 | 3300046507 | Ga0495606_0003035 | Ga0495606_0003035_16218_16694 | 158 |
| 186 | 3300046507 | Ga0495606_0003994 | Ga0495606_0003994_5369_5848 | 158 |
| 187 | 3300046512 | Ga0495610_0009686 | Ga0495610_0009686_1748_2233 | 158 |
| 188 | 3300046512 | Ga0495610_0012434 | Ga0495610_0012434_938_1426 | 158 |
| 189 | 3300046512 | Ga0495610_0014927 | Ga0495610_0014927_415_900 | 158 |
| 190 | 3300046522 | Ga0495643_0000195 | Ga0495643_0000195_86419_86910 | 158 |
| 191 | 3300046522 | Ga0495643_0142832 | Ga0495643_0142832_642_1127 | 158 |
| 192 | 3300046524 | Ga0495648_0000002 | Ga0495648_0000002_305662_306138 | 158 |
| 193 | 3300046524 | Ga0495648_0369878 | Ga0495648_0369878_37_519 | 158 |
| 194 | 3300046528 | Ga0495642_0005806 | Ga0495642_0005806_2369_2845 | 158 |
| 195 | 3300046528 | Ga0495642_0167055 | Ga0495642_0167055_73_552 | 158 |
| 196 | 3300046538 | Ga0495609_0052419 | Ga0495609_0052419_260_751 | 158 |
| 197 | 3300046542 | Ga0495597_0000055 | Ga0495597_0000055_86104_86595 | 158 |
| 198 | 3300046557 | Ga0495622_0000009 | Ga0495622_0000009_6839_7321 | 158 |
| 199 | 3300046557 | Ga0495622_0000586 | Ga0495622_0000586_17324_17800 | 158 |
| 200 | 3300046558 | Ga0495633_0000024 | Ga0495633_0000024_5371_5847 | 158 |
| 201 | 3300046558 | Ga0495633_0002266 | Ga0495633_0002266_1159_1635 | 158 |
| 202 | 3300046558 | Ga0495633_0005574 | Ga0495633_0005574_3745_4230 | 158 |
| 203 | 3300046558 | Ga0495633_0148135 | Ga0495633_0148135_28_513 | 158 |
| 204 | 3300046616 | Ga0495668_0000719 | Ga0495668_0000719_35310_35786 | 158 |
| 205 | 3300046616 | Ga0495668_0001072 | Ga0495668_0001072_16208_16693 | 158 |
| 206 | 3300046660 | Ga0495625_0000124 | Ga0495625_0000124_27313_27789 | 158 |
| 207 | 3300046660 | Ga0495625_0005977 | Ga0495625_0005977_1259_1750 | 158 |
| 208 | 3300046691 | Ga0495670_0088162 | Ga0495670_0088162_1013_1489 | 158 |
| 209 | 3300046692 | Ga0495671_0044642 | Ga0495671_0044642_805_1296 | 158 |
| 210 | 3300046694 | Ga0495649_0006472 | Ga0495649_0006472_2705_3196 | 158 |
| 211 | 3300046810 | Ga0495660_0008228 | Ga0495660_0008228_2363_2839 | 158 |
| 212 | 3300047320 | Ga0495672_0000605 | Ga0495672_0000605_32655_33146 | 158 |
| 213 | 3300047443 | Ga0495687_002204 | Ga0495687_002204_923_1399 | 158 |
| 214 | 3300047469 | Ga0495673_0000005 | Ga0495673_0000005_796784_797260 | 158 |
| 215 | 3300047469 | Ga0495673_0000199 | Ga0495673_0000199_17038_17529 | 158 |
| 216 | 3300047472 | Ga0495686_0007109 | Ga0495686_0007109_5570_6055 | 158 |
| 217 | 3300048090 | Ga0495615_0068938 | Ga0495615_0068938_112_588 | 158 |
| 218 | 3300048903 | Ga0496100_0059346 | Ga0496100_0059346_200_688 | 158 |
| 219 | 3300048907 | Ga0496104_1235590 | Ga0496104_1235590_55_543 | 158 |
| 220 | 3300048908 | Ga0496105_0374873 | Ga0496105_0374873_295_783 | 158 |
| 221 | 3300048909 | Ga0496106_0139506 | Ga0496106_0139506_993_1481 | 158 |
| 222 | 3300048911 | Ga0496108_0008718 | Ga0496108_0008718_281_769 | 158 |
| 223 | 3300048912 | Ga0496109_0011704 | Ga0496109_0011704_1324_1812 | 158 |
| 224 | 3300048913 | Ga0496110_0003126 | Ga0496110_0003126_5626_6114 | 158 |
| 225 | 3300048914 | Ga0496111_0070903 | Ga0496111_0070903_448_936 | 158 |
| 226 | 3300048915 | Ga0496112_0818713 | Ga0496112_0818713_299_787 | 158 |
| 227 | 3300048917 | Ga0496114_0055215 | Ga0496114_0055215_1531_2019 | 158 |
| 228 | 3300048919 | Ga0496116_0019950 | Ga0496116_0019950_2906_3391 | 158 |
| 229 | 3300048924 | Ga0496121_0056351 | Ga0496121_0056351_198_674 | 158 |
| 230 | 3300048926 | Ga0496123_0005389 | Ga0496123_0005389_2919_3419 | 158 |
| 231 | 3300048927 | Ga0496124_0121735 | Ga0496124_0121735_123_599 | 158 |
| 232 | 3300049459 | Ga0495678_000071 | Ga0495678_000071_11113_11604 | 158 |
| 233 | 3300049459 | Ga0495678_004558 | Ga0495678_004558_6112_6588 | 158 |
| 234 | 3300049459 | Ga0495678_012576 | Ga0495678_012576_587_1063 | 158 |
| 235 | 3300053125 | Ga0500618_000857 | Ga0500618_000857_4812_5288 | 158 |
| 236 | 3300053145 | Ga0500586_001403 | Ga0500586_001403_3808_4293 | 158 |
| 237 | iso_pu_bacteria | 2526164512 | 2526210666 | 158 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3jvi-assembly1.cif.gz_A | product state mimic crystal structure of protein tyrosine phosphatase from entamoeba histolytica | 0.9857 | 4 | 158 |
| 3js5-assembly1.cif.gz_A | crystal structure of protein tyrosine phosphatase from entamoeba histolytica with hepes in the active site. high resolution, alternative crystal form with 1 molecule in asymmetric unit | 0.9782 | 4 | 157 |
| 4lrq-assembly2.cif.gz_D | crystal structure of a low molecular weight phosphotyrosine phosphatase from vibrio choleraeo395 | 0.978 | 5 | 153 |
| 3ily-assembly2.cif.gz_B | apo crystal structure of protein tyrosine phosphatase from entamoeba histolytica featuring a disordered active site | 0.9761 | 4 | 158 |
| 3ily-assembly1.cif.gz_A | apo crystal structure of protein tyrosine phosphatase from entamoeba histolytica featuring a disordered active site | 0.9618 | 4 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3idoB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9808 | 4 | 157 | 3.40.50.2300 |
| 4lrqA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9789 | 5 | 154 | 3.40.50.2300 |
| 3ilyB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9761 | 4 | 158 | 3.40.50.2300 |
| 4lrqA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.966 | 5 | 154 | 3.40.50.2300 |
| af_C6T3N3_2_177_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.96 | 2 | 157 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257WYR4-F1-model_v4 | protein-tyrosine-phosphatase (EC 3.1.3.48) | 1.001 | 5 | 101 |
GO:0004726
GO:0030946 GO:0140793 |
| AF-A0A011PPL1-F1-model_v4 | Low molecular weight protein-tyrosine-phosphatase YfkJ (EC 3.1.3.48) | 0.9937 | 5 | 157 |
GO:0004726
GO:0030946 GO:0140793 |
| AF-A0A7C5CT74-F1-model_v4 | Low molecular weight phosphotyrosine protein phosphatase | 0.993 | 4 | 157 |
GO:0004726
GO:0030946 GO:0140793 |
| AF-A0A6A7RTY3-F1-model_v4 | Phosphotyrosine protein phosphatase | 0.9919 | 5 | 157 |
GO:0004726
GO:0030946 GO:0140793 |
| AF-A0A833GP17-F1-model_v4 | protein-tyrosine-phosphatase (EC 3.1.3.48) | 0.9916 | 4 | 157 |
GO:0004725
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar