F350479

General Info

Members Datasets Scaffolds Average Seq Length
237 188 232 159

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2526164512|2526210666
Length 177
Sequence WARRTLFPHAVREDGPMSRLLFVCMGNICRSPTAEGVFRKLLQTRKLDARFEVDSAGTHGYHVGEPPDPRTQRAAAARGYDLSQMRARKVAPQDLEYFDLILAMDKTNLDNLRRMVDPEKHQKLHLFMEFARNYDDDEVPDPYYGLGYGFDVVIDMVEDASQGLLEALLAPQSVQIK

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2643221645 Massilia sp. Root351 Isolate Unclassified
3 2821131069 Duganella sp. 1224 Isolate Unclassified
4 2842711865 Duganella sp. R-73148 Isolate Unclassified
5 2857564685 Duganella sp. R-74599 Isolate Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
99 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
100 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
140 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
141 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
142 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
183 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
184 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.89
Metatranscriptomes 0
Isolates 2.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 4.64
Rhizosphere 85.65
Stem 0
Stem Tuber 0
Unclassified 8.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000643 3300002738 Bacteria 16415
2 rootL2_10034274 3300003322 Bacteria 10155
3 Ga0065712_10079204 3300005290 Bacteria 3246
4 Ga0065707_10086070 3300005295 Bacteria 5684
5 Ga0070683_100000736 3300005329 Bacteria 23963
6 Ga0070670_100000901 3300005331 Bacteria 23375
7 Ga0070677_10018622 3300005333 Bacteria 2503
8 Ga0070666_10005441 3300005335 Bacteria 7806
9 Ga0070680_101066368 3300005336 Bacteria 698
10 Ga0070691_10264668 3300005341 Bacteria 927
11 Ga0070661_100001362 3300005344 Bacteria 17076
12 Ga0070668_100438178 3300005347 Unclassified 1121
13 Ga0070675_100000757 3300005354 Bacteria 22560
14 Ga0070671_100000219 3300005355 Bacteria 38310
15 Ga0070674_100006496 3300005356 Bacteria 6827
16 Ga0070709_10235440 3300005434 Bacteria 1312
17 Ga0070700_100732228 3300005441 Unclassified 789
18 Ga0070694_100421952 3300005444 Bacteria 1048
19 Ga0070678_100000219 3300005456 Bacteria 25787
20 Ga0070662_100041664 3300005457 Bacteria 3277
21 Ga0070681_10283945 3300005458 Bacteria 1566
22 Ga0068867_100039519 3300005459 Bacteria 3440
23 Ga0070707_101252489 3300005468 Bacteria 708
24 Ga0070679_100347898 3300005530 Bacteria 1430
25 Ga0070684_100134543 3300005535 Bacteria 2232
26 Ga0070697_101034274 3300005536 Bacteria 730
27 Ga0068853_100351922 3300005539 Unclassified 1370
28 Ga0070672_100000090 3300005543 Bacteria 44222
29 Ga0070695_100776430 3300005545 Bacteria 766
30 Ga0070665_100889613 3300005548 Unclassified 903
31 Ga0070664_100000742 3300005564 Bacteria 25137
32 Ga0068854_100003478 3300005578 Bacteria 9835
33 Ga0068852_100000201 3300005616 Bacteria 40698
34 Ga0068864_100010680 3300005618 Bacteria 7589
35 Ga0068866_10055797 3300005718 Bacteria 2030
36 Ga0068851_10123182 3300005834 Unclassified 1395
37 Ga0097621_100000764 3300006237 Bacteria 22560
38 Ga0068871_100000434 3300006358 Bacteria 28753
39 Ga0075436_100196527 3300006914 Bacteria 1428
40 Ga0099794_10039444 3300007265 Bacteria 2242
41 Ga0105247_11287897 3300009101 Bacteria 586
42 Ga0105243_10502429 3300009148 Unclassified 1149
43 Ga0105248_10790850 3300009177 Unclassified 1071
44 Ga0105239_12422754 3300010375 Unclassified 611
45 Ga0157371_10471090 3300013102 Unclassified 925
46 Ga0157374_10006450 3300013296 Bacteria 9960
47 Ga0157378_10028765 3300013297 Bacteria 4907
48 Ga0163162_10060532 3300013306 Bacteria 3822
49 Ga0157375_10008297 3300013308 Bacteria 9099
50 Ga0157376_10574808 3300014969 Unclassified 1118
51 Ga0163161_10064656 3300017792 Bacteria 2669
52 Ga0209646_1000007 3300025246 Bacteria 670994
53 Ga0207656_10077082 3300025321 Bacteria 1492
54 Ga0207682_10040246 3300025893 Bacteria 1903
55 Ga0207642_10076348 3300025899 Unclassified 1612
56 Ga0207680_10069077 3300025903 Unclassified 2182
57 Ga0207699_10211218 3300025906 Bacteria 1320
58 Ga0207649_10340568 3300025920 Unclassified 1107
59 Ga0207652_10387093 3300025921 Bacteria 1262
60 Ga0207650_10000726 3300025925 Bacteria 25560
61 Ga0207659_10008293 3300025926 Bacteria 6442
62 Ga0207644_10021333 3300025931 Bacteria 4411
63 Ga0207709_10323272 3300025935 Unclassified 1155
64 Ga0207691_10000431 3300025940 Bacteria 41756
65 Ga0207661_10023428 3300025944 Bacteria 4664
66 Ga0207679_10016177 3300025945 Bacteria 4947
67 Ga0207651_10001359 3300025960 Bacteria 11078
68 Ga0207668_10679473 3300025972 Unclassified 903
69 Ga0207640_10025066 3300025981 Bacteria 3606
70 Ga0207677_10001394 3300026023 Bacteria 12909
71 Ga0207703_11132494 3300026035 Unclassified 752
72 Ga0207639_11312379 3300026041 Unclassified 679
73 Ga0207641_10069268 3300026088 Bacteria 3028
74 Ga0207641_10449095 3300026088 Bacteria 1246
75 Ga0207648_10444085 3300026089 Unclassified 1180
76 Ga0207676_10007975 3300026095 Bacteria 7527
77 Ga0207683_10000536 3300026121 Bacteria 35159
78 Ga0207698_10062902 3300026142 Bacteria 2901
79 Ga0268266_10229547 3300028379 Unclassified 1709
80 Ga0265318_10002194 3300028577 Bacteria 10557
81 Ga0307515_10000053 3300028794 Bacteria 266512
82 Ga0265332_10000868 3300031238 Bacteria 18323
83 Ga0265331_10001456 3300031250 Bacteria 17402
84 Ga0265316_10441488 3300031344 Bacteria 934
85 Ga0307513_10194964 3300031456 Bacteria 1873
86 Ga0307408_100000678 3300031548 Bacteria 28125
87 Ga0307508_10118525 3300031616 Bacteria 2248
88 Ga0265314_10002149 3300031711 Bacteria 20606
89 Ga0265314_10159109 3300031711 Bacteria 1376
90 Ga0307416_100107622 3300032002 Bacteria 2447
91 Ga0307414_10902558 3300032004 Bacteria 810
92 Ga0373951_0095309 3300035091 Bacteria 785
93 Ga0373954_0390598 3300035118 Bacteria 688
94 Ga0373925_0309461 3300037068 Bacteria 1277
95 Ga0373925_0396116 3300037068 Unclassified 1126
96 Ga0451800_1474291 3300041459 Bacteria 1097
97 Ga0451851_0093493 3300041507 Unclassified 534
98 Ga0451843_0155865 3300041509 Bacteria 1790
99 Ga0451853_3816489 3300041512 Bacteria 1967
100 Ga0451577_0484670 3300042876 Bacteria 1123
101 Ga0451577_0633069 3300042876 Bacteria 970
102 Ga0466966_0187080 3300044684 Bacteria 1255
103 Ga0453684_0000847 3300044712 Bacteria 103142
104 Ga0453684_0038310 3300044712 Bacteria 6557
105 Ga0453684_0051615 3300044712 Bacteria 5388
106 Ga0453684_0061927 3300044712 Bacteria 4798
107 Ga0466971_0124517 3300044719 Bacteria 1194
108 Ga0466960_0184585 3300044901 Bacteria 1132
109 Ga0466959_0184993 3300045049 Bacteria 1456
110 Ga0451576_0148075 3300045051 Bacteria 2448
111 Ga0451576_0176152 3300045051 Bacteria 2233
112 Ga0451576_0249135 3300045051 Bacteria 1856
113 Ga0495617_003359 3300046452 Bacteria 6038
114 Ga0495617_020093 3300046452 Bacteria 2256
115 Ga0495590_0000005 3300046457 Bacteria 384276
116 Ga0495590_0268757 3300046457 Bacteria 637
117 Ga0495638_0000349 3300046460 Bacteria 57958
118 Ga0495638_0009621 3300046460 Bacteria 6763
119 Ga0495638_0121605 3300046460 Bacteria 1542
120 Ga0495653_0000040 3300046463 Bacteria 119794
121 Ga0495650_0000044 3300046471 Bacteria 355139
122 Ga0495650_0011748 3300046471 Bacteria 4763
123 Ga0495650_0023692 3300046471 Bacteria 2917
124 Ga0495605_0000038 3300046474 Bacteria 197063
125 Ga0495639_0069997 3300046475 Bacteria 1619
126 Ga0495584_0236092 3300046491 Bacteria 929
127 Ga0495607_0002281 3300046501 Bacteria 15782
128 Ga0495583_0000100 3300046506 Bacteria 145745
129 Ga0495583_0023736 3300046506 Bacteria 3095
130 Ga0495606_0000053 3300046507 Bacteria 200818
131 Ga0495606_0000202 3300046507 Bacteria 103924
132 Ga0495606_0002070 3300046507 Bacteria 24503
133 Ga0495606_0003035 3300046507 Bacteria 18341
134 Ga0495606_0003994 3300046507 Bacteria 15071
135 Ga0495606_0007957 3300046507 Bacteria 9332
136 Ga0495610_0009686 3300046512 Bacteria 6063
137 Ga0495610_0012434 3300046512 Bacteria 5124
138 Ga0495610_0014927 3300046512 Bacteria 4541
139 Ga0495637_0001097 3300046520 Bacteria 16706
140 Ga0495637_0039533 3300046520 Bacteria 2035
141 Ga0495643_0000195 3300046522 Bacteria 96110
142 Ga0495643_0142832 3300046522 Bacteria 1192
143 Ga0495648_0000002 3300046524 Bacteria 593972
144 Ga0495648_0035209 3300046524 Bacteria 3248
145 Ga0495648_0254098 3300046524 Bacteria 847
146 Ga0495648_0369878 3300046524 Bacteria 649
147 Ga0495642_0005806 3300046528 Bacteria 4733
148 Ga0495642_0093720 3300046528 Bacteria 1273
149 Ga0495642_0167055 3300046528 Bacteria 955
150 Ga0495654_0000002 3300046530 Bacteria 1021205
151 Ga0495609_0052419 3300046538 Bacteria 1815
152 Ga0495597_0000055 3300046542 Bacteria 95175
153 Ga0495622_0000009 3300046557 Bacteria 224622
154 Ga0495622_0000586 3300046557 Bacteria 21427
155 Ga0495633_0000024 3300046558 Bacteria 225077
156 Ga0495633_0002266 3300046558 Bacteria 13757
157 Ga0495633_0005574 3300046558 Bacteria 7641
158 Ga0495633_0148135 3300046558 Bacteria 1084
159 Ga0495668_0000719 3300046616 Bacteria 39799
160 Ga0495668_0001072 3300046616 Bacteria 28855
161 Ga0495668_0069116 3300046616 Bacteria 1942
162 Ga0495625_0000124 3300046660 Bacteria 120849
163 Ga0495625_0002530 3300046660 Bacteria 19664
164 Ga0495625_0004642 3300046660 Bacteria 12903
165 Ga0495625_0005977 3300046660 Bacteria 10941
166 Ga0495659_0002003 3300046664 Bacteria 6697
167 Ga0495669_0008337 3300046684 Bacteria 4356
168 Ga0495670_0088162 3300046691 Bacteria 1586
169 Ga0495671_0044642 3300046692 Bacteria 2221
170 Ga0495649_0006472 3300046694 Bacteria 7289
171 Ga0495649_0019600 3300046694 Bacteria 3800
172 Ga0495660_0008228 3300046810 Bacteria 6111
173 Ga0495660_0082619 3300046810 Bacteria 1682
174 Ga0495660_0226934 3300046810 Bacteria 877
175 Ga0495672_0000605 3300047320 Bacteria 40392
176 Ga0495672_0066700 3300047320 Bacteria 2052
177 Ga0495683_0173852 3300047323 Bacteria 988
178 Ga0495687_002204 3300047443 Bacteria 16131
179 Ga0495687_187341 3300047443 Bacteria 669
180 Ga0495685_207302 3300047447 Bacteria 627
181 Ga0495673_0000005 3300047469 Bacteria 943364
182 Ga0495673_0000199 3300047469 Bacteria 93637
183 Ga0495673_0041948 3300047469 Bacteria 2057
184 Ga0495686_0007109 3300047472 Bacteria 8435
185 Ga0495615_0068938 3300048090 Bacteria 949
186 Ga0496100_0059346 3300048903 Bacteria 2514
187 Ga0496104_1235590 3300048907 Unclassified 650
188 Ga0496105_0374873 3300048908 Unclassified 1133
189 Ga0496106_0139506 3300048909 Bacteria 1906
190 Ga0496108_0008718 3300048911 Bacteria 8222
191 Ga0496109_0011704 3300048912 Bacteria 7546
192 Ga0496110_0003126 3300048913 Bacteria 12576
193 Ga0496111_0070903 3300048914 Bacteria 2536
194 Ga0496112_0818713 3300048915 Unclassified 855
195 Ga0496114_0055215 3300048917 Bacteria 3313
196 Ga0496116_0019950 3300048919 Bacteria 5111
197 Ga0496119_0048498 3300048922 Bacteria 2633
198 Ga0496121_0056351 3300048924 Bacteria 3265
199 Ga0496121_0221086 3300048924 Bacteria 1334
200 Ga0496123_0005389 3300048926 Bacteria 12889
201 Ga0496124_0121735 3300048927 Bacteria 2084
202 Ga0495678_000071 3300049459 Bacteria 128709
203 Ga0495678_004558 3300049459 Bacteria 7969
204 Ga0495678_012576 3300049459 Bacteria 4009
205 Ga0501034_0054863 3300049571 Bacteria 4011
206 Ga0501039_0034265 3300049575 Bacteria 3919
207 Ga0501040_0020729 3300049576 Bacteria 4383
208 Ga0501041_0039907 3300049577 Bacteria 2848
209 Ga0501047_0175288 3300049581 Bacteria 2012
210 Ga0501048_0019687 3300049582 Bacteria 4950
211 Ga0501068_0146319 3300049584 Bacteria 1483
212 Ga0501070_0311586 3300049586 Bacteria 1281
213 Ga0501071_0255733 3300049587 Bacteria 1322
214 Ga0501072_0017625 3300049588 Bacteria 5492
215 Ga0501074_0337039 3300049590 Bacteria 1070
216 Ga0501075_0037840 3300049591 Bacteria 3606
217 Ga0501076_0087500 3300049592 Bacteria 2504
218 Ga0501077_0085789 3300049593 Bacteria 1996
219 Ga0501230_028077 3300049667 Bacteria 1032
220 Ga0501079_0102244 3300049741 Bacteria 2222
221 Ga0501080_0128777 3300049742 Bacteria 2343
222 Ga0501081_0266442 3300049743 Bacteria 1252
223 Ga0501083_0141287 3300049744 Bacteria 1577
224 Ga0501045_0016752 3300049824 Bacteria 5206
225 nmdc:mga08x19_336213_c1 3300050514 Bacteria 1053
226 Ga0500618_000857 3300053125 Bacteria 16351
227 Ga0500586_001403 3300053145 Bacteria 5069
228 Ga0500633_0337802 3300053160 Bacteria 550
229 Ga0501084_0024193 3300054114 Bacteria 5066
230 Ga0501082_0224808 3300060353 Bacteria 1633
231 Ga0466962_0206112 3300061719 Bacteria 961
232 Ga0530510_0057625 3300061734 Bacteria 2807

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009101 Ga0105247_11287897 Ga0105247_112878972 128
2 3300047323 Ga0495683_0173852 Ga0495683_0173852_554_964 133
3 3300045051 Ga0451576_0148075 Ga0451576_0148075_569_1012 145
4 3300046457 Ga0495590_0268757 Ga0495590_0268757_111_551 145
5 3300046460 Ga0495638_0121605 Ga0495638_0121605_689_1129 145
6 3300046491 Ga0495584_0236092 Ga0495584_0236092_364_804 145
7 3300046506 Ga0495583_0023736 Ga0495583_0023736_1853_2293 145
8 3300046507 Ga0495606_0002070 Ga0495606_0002070_6891_7337 145
9 3300046524 Ga0495648_0254098 Ga0495648_0254098_64_504 145
10 3300046528 Ga0495642_0093720 Ga0495642_0093720_692_1132 145
11 3300046616 Ga0495668_0069116 Ga0495668_0069116_847_1287 145
12 3300046660 Ga0495625_0004642 Ga0495625_0004642_10140_10580 145
13 3300046664 Ga0495659_0002003 Ga0495659_0002003_2876_3316 145
14 3300046684 Ga0495669_0008337 Ga0495669_0008337_1736_2176 145
15 3300046694 Ga0495649_0019600 Ga0495649_0019600_793_1233 145
16 3300046810 Ga0495660_0082619 Ga0495660_0082619_731_1171 145
17 3300047443 Ga0495687_187341 Ga0495687_187341_179_619 145
18 3300047447 Ga0495685_207302 Ga0495685_207302_143_583 145
19 3300046471 Ga0495650_0023692 Ga0495650_0023692_1481_1966 146
20 3300046520 Ga0495637_0001097 Ga0495637_0001097_2754_3239 146
21 3300046530 Ga0495654_0000002 Ga0495654_0000002_898151_898636 146
22 3300046810 Ga0495660_0226934 Ga0495660_0226934_139_624 146
23 3300005457 Ga0070662_100041664 Ga0070662_1000416642 147
24 3300005535 Ga0070684_100134543 Ga0070684_1001345432 147
25 3300005539 Ga0068853_100351922 Ga0068853_1003519221 147
26 3300009148 Ga0105243_10502429 Ga0105243_105024292 147
27 3300009177 Ga0105248_10790850 Ga0105248_107908502 147
28 3300010375 Ga0105239_12422754 Ga0105239_124227541 147
29 3300013102 Ga0157371_10471090 Ga0157371_104710901 147
30 3300013296 Ga0157374_10006450 Ga0157374_100064508 147
31 3300013297 Ga0157378_10028765 Ga0157378_100287655 147
32 3300013306 Ga0163162_10060532 Ga0163162_100605322 147
33 3300013308 Ga0157375_10008297 Ga0157375_100082979 147
34 3300014969 Ga0157376_10574808 Ga0157376_105748082 147
35 3300028577 Ga0265318_10002194 Ga0265318_1000219410 147
36 3300031238 Ga0265332_10000868 Ga0265332_100008687 147
37 3300031250 Ga0265331_10001456 Ga0265331_100014565 147
38 3300031711 Ga0265314_10002149 Ga0265314_1000214911 147
39 3300035091 Ga0373951_0095309 Ga0373951_0095309_256_711 147
40 3300046507 Ga0495606_0007957 Ga0495606_0007957_3329_3784 147
41 3300046660 Ga0495625_0002530 Ga0495625_0002530_8484_8933 147
42 3300048922 Ga0496119_0048498 Ga0496119_0048498_205_672 147
43 3300042876 Ga0451577_0633069 Ga0451577_0633069_97_570 150
44 3300026088 Ga0207641_10449095 Ga0207641_104490952 153
45 3300005295 Ga0065707_10086070 Ga0065707_100860701 154
46 3300049667 Ga0501230_028077 Ga0501230_028077_434_919 154
47 3300050514 nmdc:mga08x19_336213_c1 nmdc:mga08x19_336213_c1_122_604 154
48 iso_pu_bacteria 2821131069 2821132675 154
49 iso_pu_bacteria 2842711865 2842716454 154
50 3300031344 Ga0265316_10441488 Ga0265316_104414881 155
51 3300031548 Ga0307408_100000678 Ga0307408_10000067813 155
52 3300031616 Ga0307508_10118525 Ga0307508_101185252 155
53 3300032004 Ga0307414_10902558 Ga0307414_109025581 155
54 3300035118 Ga0373954_0390598 Ga0373954_0390598_12_491 155
55 3300037068 Ga0373925_0309461 Ga0373925_0309461_269_751 155
56 3300041509 Ga0451843_0155865 Ga0451843_0155865_513_995 155
57 3300042876 Ga0451577_0484670 Ga0451577_0484670_610_1092 155
58 3300044684 Ga0466966_0187080 Ga0466966_0187080_603_1103 155
59 3300044712 Ga0453684_0000847 Ga0453684_0000847_90639_91121 155
60 3300044712 Ga0453684_0038310 Ga0453684_0038310_723_1205 155
61 3300044712 Ga0453684_0051615 Ga0453684_0051615_999_1481 155
62 3300044712 Ga0453684_0061927 Ga0453684_0061927_1408_1881 155
63 3300044719 Ga0466971_0124517 Ga0466971_0124517_395_895 155
64 3300044901 Ga0466960_0184585 Ga0466960_0184585_192_668 155
65 3300045049 Ga0466959_0184993 Ga0466959_0184993_694_1194 155
66 3300045051 Ga0451576_0176152 Ga0451576_0176152_119_589 155
67 3300045051 Ga0451576_0249135 Ga0451576_0249135_79_561 155
68 3300046452 Ga0495617_020093 Ga0495617_020093_1203_1679 155
69 3300046460 Ga0495638_0009621 Ga0495638_0009621_5092_5568 155
70 3300047320 Ga0495672_0066700 Ga0495672_0066700_502_978 155
71 3300047469 Ga0495673_0041948 Ga0495673_0041948_249_725 155
72 3300048924 Ga0496121_0221086 Ga0496121_0221086_414_908 155
73 3300049571 Ga0501034_0054863 Ga0501034_0054863_2885_3361 155
74 3300049575 Ga0501039_0034265 Ga0501039_0034265_231_713 155
75 3300049576 Ga0501040_0020729 Ga0501040_0020729_3397_3879 155
76 3300049577 Ga0501041_0039907 Ga0501041_0039907_650_1132 155
77 3300049581 Ga0501047_0175288 Ga0501047_0175288_524_1012 155
78 3300049582 Ga0501048_0019687 Ga0501048_0019687_510_992 155
79 3300049584 Ga0501068_0146319 Ga0501068_0146319_944_1426 155
80 3300049586 Ga0501070_0311586 Ga0501070_0311586_352_834 155
81 3300049587 Ga0501071_0255733 Ga0501071_0255733_160_642 155
82 3300049588 Ga0501072_0017625 Ga0501072_0017625_4200_4682 155
83 3300049590 Ga0501074_0337039 Ga0501074_0337039_445_927 155
84 3300049591 Ga0501075_0037840 Ga0501075_0037840_1601_2083 155
85 3300049592 Ga0501076_0087500 Ga0501076_0087500_1396_1878 155
86 3300049593 Ga0501077_0085789 Ga0501077_0085789_415_897 155
87 3300049741 Ga0501079_0102244 Ga0501079_0102244_208_690 155
88 3300049742 Ga0501080_0128777 Ga0501080_0128777_873_1355 155
89 3300049743 Ga0501081_0266442 Ga0501081_0266442_694_1176 155
90 3300049744 Ga0501083_0141287 Ga0501083_0141287_369_851 155
91 3300049824 Ga0501045_0016752 Ga0501045_0016752_3208_3690 155
92 3300054114 Ga0501084_0024193 Ga0501084_0024193_566_1048 155
93 3300060353 Ga0501082_0224808 Ga0501082_0224808_261_743 155
94 3300061719 Ga0466962_0206112 Ga0466962_0206112_317_817 155
95 3300061734 Ga0530510_0057625 Ga0530510_0057625_1570_2052 155
96 iso_pu_bacteria 2643221645 2644253431 155
97 iso_pu_bacteria 2857564685 2857566747 155
98 3300003322 rootL2_10034274 rootL2_100342743 156
99 3300005336 Ga0070680_101066368 Ga0070680_1010663681 156
100 3300005341 Ga0070691_10264668 Ga0070691_102646682 156
101 3300005444 Ga0070694_100421952 Ga0070694_1004219522 156
102 3300005545 Ga0070695_100776430 Ga0070695_1007764301 156
103 3300031456 Ga0307513_10194964 Ga0307513_101949642 156
104 3300032002 Ga0307416_100107622 Ga0307416_1001076222 156
105 3300046452 Ga0495617_003359 Ga0495617_003359_3276_3755 156
106 3300046520 Ga0495637_0039533 Ga0495637_0039533_1008_1487 156
107 3300053160 Ga0500633_0337802 Ga0500633_0337802_58_537 156
108 3300046474 Ga0495605_0000038 Ga0495605_0000038_83508_83981 157
109 3300046524 Ga0495648_0035209 Ga0495648_0035209_1122_1601 157
110 3300002738 JGI25154J39366_1000643 JGI25154J39366_100064313 158
111 3300005290 Ga0065712_10079204 Ga0065712_100792044 158
112 3300005329 Ga0070683_100000736 Ga0070683_1000007362 158
113 3300005331 Ga0070670_100000901 Ga0070670_10000090126 158
114 3300005333 Ga0070677_10018622 Ga0070677_100186222 158
115 3300005335 Ga0070666_10005441 Ga0070666_100054413 158
116 3300005344 Ga0070661_100001362 Ga0070661_1000013626 158
117 3300005347 Ga0070668_100438178 Ga0070668_1004381782 158
118 3300005354 Ga0070675_100000757 Ga0070675_10000075727 158
119 3300005355 Ga0070671_100000219 Ga0070671_10000021921 158
120 3300005356 Ga0070674_100006496 Ga0070674_1000064966 158
121 3300005434 Ga0070709_10235440 Ga0070709_102354403 158
122 3300005441 Ga0070700_100732228 Ga0070700_1007322281 158
123 3300005456 Ga0070678_100000219 Ga0070678_10000021912 158
124 3300005458 Ga0070681_10283945 Ga0070681_102839452 158
125 3300005459 Ga0068867_100039519 Ga0068867_1000395192 158
126 3300005468 Ga0070707_101252489 Ga0070707_1012524891 158
127 3300005530 Ga0070679_100347898 Ga0070679_1003478982 158
128 3300005536 Ga0070697_101034274 Ga0070697_1010342741 158
129 3300005543 Ga0070672_100000090 Ga0070672_10000009032 158
130 3300005548 Ga0070665_100889613 Ga0070665_1008896131 158
131 3300005564 Ga0070664_100000742 Ga0070664_1000007424 158
132 3300005578 Ga0068854_100003478 Ga0068854_10000347812 158
133 3300005616 Ga0068852_100000201 Ga0068852_10000020122 158
134 3300005618 Ga0068864_100010680 Ga0068864_1000106804 158
135 3300005718 Ga0068866_10055797 Ga0068866_100557971 158
136 3300005834 Ga0068851_10123182 Ga0068851_101231822 158
137 3300006237 Ga0097621_100000764 Ga0097621_1000007645 158
138 3300006358 Ga0068871_100000434 Ga0068871_10000043413 158
139 3300006914 Ga0075436_100196527 Ga0075436_1001965272 158
140 3300007265 Ga0099794_10039444 Ga0099794_100394442 158
141 3300017792 Ga0163161_10064656 Ga0163161_100646562 158
142 3300025246 Ga0209646_1000007 Ga0209646_1000007100 158
143 3300025321 Ga0207656_10077082 Ga0207656_100770822 158
144 3300025893 Ga0207682_10040246 Ga0207682_100402462 158
145 3300025899 Ga0207642_10076348 Ga0207642_100763481 158
146 3300025903 Ga0207680_10069077 Ga0207680_100690773 158
147 3300025906 Ga0207699_10211218 Ga0207699_102112181 158
148 3300025920 Ga0207649_10340568 Ga0207649_103405682 158
149 3300025921 Ga0207652_10387093 Ga0207652_103870932 158
150 3300025925 Ga0207650_10000726 Ga0207650_1000072619 158
151 3300025926 Ga0207659_10008293 Ga0207659_100082935 158
152 3300025931 Ga0207644_10021333 Ga0207644_100213334 158
153 3300025935 Ga0207709_10323272 Ga0207709_103232722 158
154 3300025940 Ga0207691_10000431 Ga0207691_1000043138 158
155 3300025944 Ga0207661_10023428 Ga0207661_100234282 158
156 3300025945 Ga0207679_10016177 Ga0207679_100161773 158
157 3300025960 Ga0207651_10001359 Ga0207651_100013597 158
158 3300025972 Ga0207668_10679473 Ga0207668_106794732 158
159 3300025981 Ga0207640_10025066 Ga0207640_100250662 158
160 3300026023 Ga0207677_10001394 Ga0207677_100013944 158
161 3300026035 Ga0207703_11132494 Ga0207703_111324942 158
162 3300026041 Ga0207639_11312379 Ga0207639_113123791 158
163 3300026088 Ga0207641_10069268 Ga0207641_100692682 158
164 3300026089 Ga0207648_10444085 Ga0207648_104440852 158
165 3300026095 Ga0207676_10007975 Ga0207676_100079754 158
166 3300026121 Ga0207683_10000536 Ga0207683_1000053619 158
167 3300026142 Ga0207698_10062902 Ga0207698_100629024 158
168 3300028379 Ga0268266_10229547 Ga0268266_102295472 158
169 3300028794 Ga0307515_10000053 Ga0307515_10000053129 158
170 3300031711 Ga0265314_10159109 Ga0265314_101591092 158
171 3300037068 Ga0373925_0396116 Ga0373925_0396116_153_641 158
172 3300041459 Ga0451800_1474291 Ga0451800_1474291_521_1021 158
173 3300041507 Ga0451851_0093493 Ga0451851_0093493_35_523 158
174 3300041512 Ga0451853_3816489 Ga0451853_3816489_484_972 158
175 3300046457 Ga0495590_0000005 Ga0495590_0000005_102808_103284 158
176 3300046460 Ga0495638_0000349 Ga0495638_0000349_17335_17811 158
177 3300046463 Ga0495653_0000040 Ga0495653_0000040_96686_97180 158
178 3300046471 Ga0495650_0000044 Ga0495650_0000044_95152_95631 158
179 3300046471 Ga0495650_0011748 Ga0495650_0011748_2837_3313 158
180 3300046475 Ga0495639_0069997 Ga0495639_0069997_1083_1559 158
181 3300046501 Ga0495607_0002281 Ga0495607_0002281_1591_2067 158
182 3300046506 Ga0495583_0000100 Ga0495583_0000100_136254_136730 158
183 3300046507 Ga0495606_0000053 Ga0495606_0000053_91118_91603 158
184 3300046507 Ga0495606_0000202 Ga0495606_0000202_2490_2984 158
185 3300046507 Ga0495606_0003035 Ga0495606_0003035_16218_16694 158
186 3300046507 Ga0495606_0003994 Ga0495606_0003994_5369_5848 158
187 3300046512 Ga0495610_0009686 Ga0495610_0009686_1748_2233 158
188 3300046512 Ga0495610_0012434 Ga0495610_0012434_938_1426 158
189 3300046512 Ga0495610_0014927 Ga0495610_0014927_415_900 158
190 3300046522 Ga0495643_0000195 Ga0495643_0000195_86419_86910 158
191 3300046522 Ga0495643_0142832 Ga0495643_0142832_642_1127 158
192 3300046524 Ga0495648_0000002 Ga0495648_0000002_305662_306138 158
193 3300046524 Ga0495648_0369878 Ga0495648_0369878_37_519 158
194 3300046528 Ga0495642_0005806 Ga0495642_0005806_2369_2845 158
195 3300046528 Ga0495642_0167055 Ga0495642_0167055_73_552 158
196 3300046538 Ga0495609_0052419 Ga0495609_0052419_260_751 158
197 3300046542 Ga0495597_0000055 Ga0495597_0000055_86104_86595 158
198 3300046557 Ga0495622_0000009 Ga0495622_0000009_6839_7321 158
199 3300046557 Ga0495622_0000586 Ga0495622_0000586_17324_17800 158
200 3300046558 Ga0495633_0000024 Ga0495633_0000024_5371_5847 158
201 3300046558 Ga0495633_0002266 Ga0495633_0002266_1159_1635 158
202 3300046558 Ga0495633_0005574 Ga0495633_0005574_3745_4230 158
203 3300046558 Ga0495633_0148135 Ga0495633_0148135_28_513 158
204 3300046616 Ga0495668_0000719 Ga0495668_0000719_35310_35786 158
205 3300046616 Ga0495668_0001072 Ga0495668_0001072_16208_16693 158
206 3300046660 Ga0495625_0000124 Ga0495625_0000124_27313_27789 158
207 3300046660 Ga0495625_0005977 Ga0495625_0005977_1259_1750 158
208 3300046691 Ga0495670_0088162 Ga0495670_0088162_1013_1489 158
209 3300046692 Ga0495671_0044642 Ga0495671_0044642_805_1296 158
210 3300046694 Ga0495649_0006472 Ga0495649_0006472_2705_3196 158
211 3300046810 Ga0495660_0008228 Ga0495660_0008228_2363_2839 158
212 3300047320 Ga0495672_0000605 Ga0495672_0000605_32655_33146 158
213 3300047443 Ga0495687_002204 Ga0495687_002204_923_1399 158
214 3300047469 Ga0495673_0000005 Ga0495673_0000005_796784_797260 158
215 3300047469 Ga0495673_0000199 Ga0495673_0000199_17038_17529 158
216 3300047472 Ga0495686_0007109 Ga0495686_0007109_5570_6055 158
217 3300048090 Ga0495615_0068938 Ga0495615_0068938_112_588 158
218 3300048903 Ga0496100_0059346 Ga0496100_0059346_200_688 158
219 3300048907 Ga0496104_1235590 Ga0496104_1235590_55_543 158
220 3300048908 Ga0496105_0374873 Ga0496105_0374873_295_783 158
221 3300048909 Ga0496106_0139506 Ga0496106_0139506_993_1481 158
222 3300048911 Ga0496108_0008718 Ga0496108_0008718_281_769 158
223 3300048912 Ga0496109_0011704 Ga0496109_0011704_1324_1812 158
224 3300048913 Ga0496110_0003126 Ga0496110_0003126_5626_6114 158
225 3300048914 Ga0496111_0070903 Ga0496111_0070903_448_936 158
226 3300048915 Ga0496112_0818713 Ga0496112_0818713_299_787 158
227 3300048917 Ga0496114_0055215 Ga0496114_0055215_1531_2019 158
228 3300048919 Ga0496116_0019950 Ga0496116_0019950_2906_3391 158
229 3300048924 Ga0496121_0056351 Ga0496121_0056351_198_674 158
230 3300048926 Ga0496123_0005389 Ga0496123_0005389_2919_3419 158
231 3300048927 Ga0496124_0121735 Ga0496124_0121735_123_599 158
232 3300049459 Ga0495678_000071 Ga0495678_000071_11113_11604 158
233 3300049459 Ga0495678_004558 Ga0495678_004558_6112_6588 158
234 3300049459 Ga0495678_012576 Ga0495678_012576_587_1063 158
235 3300053125 Ga0500618_000857 Ga0500618_000857_4812_5288 158
236 3300053145 Ga0500586_001403 Ga0500586_001403_3808_4293 158
237 iso_pu_bacteria 2526164512 2526210666 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

20

165

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jvi-assembly1.cif.gz_A product state mimic crystal structure of protein tyrosine phosphatase from entamoeba histolytica 0.9857 4 158
3js5-assembly1.cif.gz_A crystal structure of protein tyrosine phosphatase from entamoeba histolytica with hepes in the active site. high resolution, alternative crystal form with 1 molecule in asymmetric unit 0.9782 4 157
4lrq-assembly2.cif.gz_D crystal structure of a low molecular weight phosphotyrosine phosphatase from vibrio choleraeo395 0.978 5 153
3ily-assembly2.cif.gz_B apo crystal structure of protein tyrosine phosphatase from entamoeba histolytica featuring a disordered active site 0.9761 4 158
3ily-assembly1.cif.gz_A apo crystal structure of protein tyrosine phosphatase from entamoeba histolytica featuring a disordered active site 0.9618 4 158
ID Description Score Start End Superfamily
3idoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9808 4 157 3.40.50.2300
4lrqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9789 5 154 3.40.50.2300
3ilyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9761 4 158 3.40.50.2300
4lrqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.966 5 154 3.40.50.2300
af_C6T3N3_2_177_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.96 2 157 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A257WYR4-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 1.001 5 101 GO:0004726
GO:0030946
GO:0140793
AF-A0A011PPL1-F1-model_v4 Low molecular weight protein-tyrosine-phosphatase YfkJ (EC 3.1.3.48) 0.9937 5 157 GO:0004726
GO:0030946
GO:0140793
AF-A0A7C5CT74-F1-model_v4 Low molecular weight phosphotyrosine protein phosphatase 0.993 4 157 GO:0004726
GO:0030946
GO:0140793
AF-A0A6A7RTY3-F1-model_v4 Phosphotyrosine protein phosphatase 0.9919 5 157 GO:0004726
GO:0030946
GO:0140793
AF-A0A833GP17-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9916 4 157 GO:0004725

Feature Viewer

pLDDT pTM Quality
94.81 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map