F350209

General Info

Members Datasets Scaffolds Average Seq Length
237 182 474 266

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1553813|Ga0436365_1553813_26472_27353
Length 293
Sequence MRIDVYNADAIMAPLAFMTEALEVRDLTKLFFRQTPRGWGGFLVLDHVSFKVRPGEFVAVLGPSGCGKTTLARILVGIESLDQGEVLIDGRAPGPPGQDRCLVFQNYGLFPWRTVAQNVELGLELRGVPVNQRREAARKYIDLVGLTGFEKYFPHQISGGMQQRAGLARALSTQPRLLLMDEPFGAVDAQMRTALQDQLLRVCEVTGATVLFVTHSIEEAIYLSDRIVIFSARPGRVVEEVTVKLPKPRYASDVRSDVLFGEMRKRVTQILAERTDYYRAGDPTSDSAVLHTD

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
53 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
83 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
84 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
85 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
86 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
93 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
96 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
132 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
144 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
179 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
180 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
181 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
182 2738543032 Methylobacterium sp. GV104 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 0
Isolates 1.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 0
Rhizoplane 3.8
Rhizosphere 86.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1553813 3300039437 Bacteria 33990
2 Ga0065715_10130896 3300005293 Bacteria 2018
3 Ga0070676_10102708 3300005328 Bacteria 1769
4 Ga0070670_100260051 3300005331 Bacteria 1513
5 Ga0068869_100338956 3300005334 Bacteria 1223
6 Ga0068869_100348413 3300005334 Bacteria 1207
7 Ga0070680_100048607 3300005336 Bacteria 3457
8 Ga0070680_100142340 3300005336 Bacteria 2011
9 Ga0070689_100228785 3300005340 Bacteria 1528
10 Ga0070692_10055814 3300005345 Bacteria 2066
11 Ga0070668_100163282 3300005347 Bacteria 1809
12 Ga0070669_100176098 3300005353 Bacteria 1670
13 Ga0070669_100619488 3300005353 Bacteria 908
14 Ga0070671_100160126 3300005355 Bacteria 1903
15 Ga0070659_100594959 3300005366 Bacteria 950
16 Ga0070667_100066606 3300005367 Bacteria 3060
17 Ga0070703_10012101 3300005406 Bacteria 2443
18 Ga0070708_100023596 3300005445 Bacteria 5233
19 Ga0070708_100125637 3300005445 Bacteria 2370
20 Ga0070681_10004104 3300005458 Bacteria 13763
21 Ga0068867_100247010 3300005459 Bacteria 1450
22 Ga0070706_100000089 3300005467 Bacteria 107706
23 Ga0070706_100029756 3300005467 Bacteria 5030
24 Ga0070707_100067008 3300005468 Bacteria 3452
25 Ga0070698_100040041 3300005471 Bacteria 4818
26 Ga0070698_100101817 3300005471 Bacteria 2843
27 Ga0070699_100021225 3300005518 Bacteria 5600
28 Ga0070699_100213636 3300005518 Bacteria 1718
29 Ga0070679_100037582 3300005530 Bacteria 4811
30 Ga0070697_100040407 3300005536 Bacteria 3774
31 Ga0070697_100380465 3300005536 Bacteria 1223
32 Ga0070695_100009715 3300005545 Bacteria 5731
33 Ga0070695_100120488 3300005545 Bacteria 1794
34 Ga0070704_100161114 3300005549 Bacteria 1774
35 Ga0070704_100300875 3300005549 Bacteria 1336
36 Ga0070664_100022234 3300005564 Bacteria 5230
37 Ga0068857_100001811 3300005577 Bacteria 17199
38 Ga0068856_100200252 3300005614 Bacteria 2011
39 Ga0068852_100345144 3300005616 Bacteria 1452
40 Ga0068864_100165430 3300005618 Bacteria 2013
41 Ga0068866_10175771 3300005718 Bacteria 1261
42 Ga0068862_100255340 3300005844 Bacteria 1598
43 Ga0081538_10045881 3300005981 Bacteria 2703
44 Ga0081538_10128446 3300005981 Bacteria 1198
45 Ga0075365_10230758 3300006038 Bacteria 1299
46 Ga0097621_100550081 3300006237 Bacteria 1050
47 Ga0075428_100474258 3300006844 Bacteria 1339
48 Ga0075433_10101620 3300006852 Bacteria 2546
49 Ga0075434_100077108 3300006871 Bacteria 3328
50 Ga0075435_100024824 3300007076 Bacteria 4659
51 Ga0075435_100342065 3300007076 Bacteria 1282
52 Ga0099794_10000212 3300007265 Bacteria 20984
53 Ga0099795_10000319 3300007788 Bacteria 8666
54 Ga0111539_10249362 3300009094 Bacteria 2067
55 Ga0114129_10011880 3300009147 Bacteria 12386
56 Ga0114129_10063581 3300009147 Bacteria 5153
57 Ga0114129_10115858 3300009147 Bacteria 3693
58 Ga0114129_10719054 3300009147 Bacteria 1282
59 Ga0099796_10002039 3300010159 Bacteria 4307
60 Ga0157370_10032688 3300013104 Bacteria 5079
61 Ga0157378_10175273 3300013297 Bacteria 2014
62 Ga0157375_10238736 3300013308 Bacteria 1977
63 Ga0157380_10425424 3300014326 Bacteria 1268
64 Ga0157376_10324730 3300014969 Bacteria 1464
65 Ga0213876_10030163 3300021384 Bacteria 2859
66 Ga0213875_10005885 3300021388 Bacteria 6516
67 Ga0213871_10007269 3300021441 Bacteria 2386
68 Ga0207653_10000736 3300025885 Bacteria 11200
69 Ga0207642_10027620 3300025899 Bacteria 2325
70 Ga0207645_10080736 3300025907 Bacteria 2085
71 Ga0207684_10000106 3300025910 Bacteria 158041
72 Ga0207684_10175006 3300025910 Bacteria 1850
73 Ga0207654_10224210 3300025911 Bacteria 1248
74 Ga0207707_10003422 3300025912 Bacteria 14069
75 Ga0207660_10016843 3300025917 Bacteria 4846
76 Ga0207660_10109789 3300025917 Bacteria 2074
77 Ga0207662_10025061 3300025918 Bacteria 3434
78 Ga0207652_10053655 3300025921 Bacteria 3463
79 Ga0207652_10090330 3300025921 Bacteria 2691
80 Ga0207652_10155582 3300025921 Bacteria 2048
81 Ga0207646_10000023 3300025922 Bacteria 255171
82 Ga0207646_10294556 3300025922 Bacteria 1466
83 Ga0207700_10382027 3300025928 Bacteria 1232
84 Ga0207700_10618114 3300025928 Bacteria 965
85 Ga0207706_10405570 3300025933 Bacteria 1181
86 Ga0207689_10176878 3300025942 Bacteria 1760
87 Ga0207679_10004559 3300025945 Bacteria 8629
88 Ga0207679_10224751 3300025945 Bacteria 1581
89 Ga0207712_10464184 3300025961 Bacteria 1076
90 Ga0207668_10135040 3300025972 Bacteria 1889
91 Ga0207640_10166830 3300025981 Bacteria 1636
92 Ga0207658_10052285 3300025986 Bacteria 3014
93 Ga0207678_10489789 3300026067 Bacteria 1071
94 Ga0207708_10103676 3300026075 Bacteria 2203
95 Ga0207702_10570747 3300026078 Bacteria 1108
96 Ga0207641_10500536 3300026088 Bacteria 1180
97 Ga0207648_10046028 3300026089 Bacteria 3826
98 Ga0207648_10250283 3300026089 Bacteria 1580
99 Ga0207676_10602361 3300026095 Bacteria 1055
100 Ga0207674_10026814 3300026116 Bacteria 6111
101 Ga0207674_10164402 3300026116 Bacteria 2173
102 Ga0207675_100078857 3300026118 Bacteria 3086
103 Ga0207675_100190512 3300026118 Bacteria 1967
104 Ga0268265_10213676 3300028380 Bacteria 1683
105 Ga0307409_100856523 3300031995 Bacteria 920
106 Ga0307416_100382172 3300032002 Bacteria 1439
107 Ga0373938_0040029 3300034957 Bacteria 1038
108 Ga0373940_0037043 3300035088 Bacteria 1327
109 Ga0373952_0008242 3300035092 Bacteria 1974
110 Ga0373932_0008101 3300035112 Bacteria 2508
111 Ga0373953_0060497 3300035117 Bacteria 1548
112 Ga0373931_0002853 3300035691 Bacteria 7708
113 Ga0373931_0073411 3300035691 Bacteria 1872
114 Ga0373947_0121725 3300035725 Bacteria 1658
115 Ga0395898_0284701 3300037466 Bacteria 1577
116 Ga0436364_0374996 3300037853 Bacteria 6606
117 Ga0395901_0012313 3300038443 Bacteria 8680
118 Ga0400483_014670 3300039062 Bacteria 1784
119 Ga0400483_065043 3300039062 Bacteria 5190
120 Ga0400483_160013 3300039062 Bacteria 1925
121 Ga0400483_168823 3300039062 Bacteria 3865
122 Ga0400483_259034 3300039062 Bacteria 1673
123 Ga0400483_266260 3300039062 Bacteria 4910
124 Ga0436360_1160764 3300039438 Bacteria 1317
125 Ga0436361_0692027 3300039447 Bacteria 1774
126 Ga0436361_0814819 3300039447 Bacteria 965
127 Ga0436361_1212535 3300039447 Bacteria 4107
128 Ga0439441_045559 3300042001 Bacteria 891
129 Ga0439459_0043343 3300042438 Bacteria 964
130 Ga0451577_0101962 3300042876 Bacteria 2564
131 Ga0453683_0346646 3300044673 Bacteria 954
132 Ga0466970_0062022 3300044765 Bacteria 2004
133 Ga0466958_0095960 3300045836 Bacteria 1839
134 Ga0466967_0010172 3300045976 Bacteria 7037
135 Ga0495592_0034498 3300046454 Bacteria 3814
136 Ga0495603_0004643 3300046455 Bacteria 8209
137 Ga0495603_0011851 3300046455 Bacteria 5276
138 Ga0495629_0002955 3300046459 Bacteria 12941
139 Ga0495629_0009808 3300046459 Bacteria 6988
140 Ga0495641_0033888 3300046461 Bacteria 2419
141 Ga0495653_0001327 3300046463 Bacteria 19198
142 Ga0495580_0000128 3300046472 Bacteria 52580
143 Ga0495580_0024736 3300046472 Bacteria 4392
144 Ga0495582_0001392 3300046473 Bacteria 13631
145 Ga0495582_0003314 3300046473 Bacteria 9052
146 Ga0495662_0061898 3300046476 Bacteria 1808
147 Ga0495664_0000211 3300046477 Bacteria 28023
148 Ga0495594_0008135 3300046499 Bacteria 5394
149 Ga0495594_0025113 3300046499 Bacteria 3202
150 Ga0495583_0046456 3300046506 Bacteria 2002
151 Ga0495606_0032226 3300046507 Bacteria 3633
152 Ga0495618_0003297 3300046514 Bacteria 10104
153 Ga0495628_0003860 3300046516 Bacteria 13345
154 Ga0495630_0002574 3300046517 Bacteria 12567
155 Ga0495648_0003369 3300046524 Bacteria 14071
156 Ga0495648_0026168 3300046524 Bacteria 3931
157 Ga0495666_0000714 3300046526 Bacteria 15146
158 Ga0495652_0016751 3300046529 Bacteria 6550
159 Ga0495654_0025156 3300046530 Bacteria 3069
160 Ga0495665_0002565 3300046531 Bacteria 9805
161 Ga0495640_0005019 3300046533 Bacteria 10513
162 Ga0495586_0000731 3300046535 Bacteria 18801
163 Ga0495587_0002628 3300046536 Bacteria 12001
164 Ga0495645_0004341 3300046543 Bacteria 9685
165 Ga0495634_0006571 3300046642 Bacteria 8822
166 Ga0495634_0130277 3300046642 Bacteria 1604
167 Ga0495635_0030628 3300046663 Bacteria 3738
168 Ga0495661_0002408 3300046665 Bacteria 14421
169 Ga0495588_0003231 3300046674 Bacteria 7063
170 Ga0495623_0019798 3300046679 Bacteria 4350
171 Ga0495646_0000235 3300046680 Bacteria 27591
172 Ga0495647_0000714 3300046681 Bacteria 9888
173 Ga0495613_0010211 3300046689 Bacteria 6975
174 Ga0495613_0027048 3300046689 Bacteria 4269
175 Ga0495624_0001769 3300046690 Bacteria 16533
176 Ga0495649_0136087 3300046694 Bacteria 1295
177 Ga0495581_0000710 3300047315 Bacteria 17537
178 Ga0495604_0003266 3300047317 Bacteria 12953
179 Ga0495674_0010816 3300047319 Bacteria 8631
180 Ga0495672_0001073 3300047320 Bacteria 27847
181 Ga0495672_0007076 3300047320 Bacteria 8506
182 Ga0495676_0005318 3300047321 Bacteria 11787
183 Ga0495676_0086473 3300047321 Bacteria 2359
184 Ga0495680_0004811 3300047322 Bacteria 12811
185 Ga0495675_0041357 3300047444 Bacteria 2939
186 Ga0495679_001997 3300047446 Bacteria 10827
187 Ga0495673_0011228 3300047469 Bacteria 4831
188 Ga0495673_0024643 3300047469 Bacteria 2902
189 Ga0495684_0011302 3300047471 Bacteria 6895
190 Ga0495593_0000425 3300047673 Bacteria 23571
191 Ga0495593_0001081 3300047673 Bacteria 15932
192 Ga0495602_0004782 3300048088 Bacteria 14156
193 Ga0495614_0000303 3300048089 Bacteria 19463
194 Ga0496100_0139474 3300048903 Bacteria 1716
195 Ga0496104_0000912 3300048907 Bacteria 25341
196 Ga0496104_0001205 3300048907 Bacteria 22261
197 Ga0496105_0064402 3300048908 Bacteria 3025
198 Ga0496112_0005035 3300048915 Bacteria 11345
199 Ga0496112_0222369 3300048915 Bacteria 1844
200 Ga0496113_0027070 3300048916 Bacteria 4107
201 Ga0496114_0593211 3300048917 Bacteria 977
202 Ga0496115_0048901 3300048918 Bacteria 3384
203 Ga0496119_0016809 3300048922 Bacteria 5540
204 Ga0496120_0058984 3300048923 Bacteria 2152
205 Ga0496121_0002724 3300048924 Bacteria 26359
206 Ga0496125_0012331 3300048928 Bacteria 8492
207 Ga0501033_0000476 3300049570 Bacteria 37977
208 Ga0501042_0282780 3300049578 Bacteria 1198
209 Ga0501047_0038961 3300049581 Bacteria 4597
210 Ga0501047_0047754 3300049581 Bacteria 4135
211 Ga0501068_0127294 3300049584 Bacteria 1591
212 Ga0501070_0299225 3300049586 Bacteria 1311
213 Ga0501080_0148977 3300049742 Bacteria 2164
214 Ga0501035_0271071 3300049822 Bacteria 1436
215 Ga0501044_0185127 3300049823 Bacteria 2048
216 nmdc:mga03683_18137_c1 3300050489 Bacteria 2672
217 nmdc:mga00v17_170562_c1 3300050491 Bacteria 1403
218 nmdc:mga05p37_108210_c1 3300050507 Bacteria 3420
219 nmdc:mga05p37_285487_c1 3300050507 Bacteria 1966
220 nmdc:mga05p37_28800_c1 3300050507 Bacteria 6776
221 nmdc:mga05p37_353063_c1 3300050507 Bacteria 1731
222 nmdc:mga09592_217552_c1 3300050508 Bacteria 1655
223 nmdc:mga06r32_572868_c1 3300050510 Bacteria 1102
224 nmdc:mga0n895_56035_c1 3300050512 Bacteria 3882
225 nmdc:mga0n895_65339_c1 3300050512 Bacteria 3601
226 nmdc:mga0rr50_22018_c1 3300050513 Bacteria 4365
227 nmdc:mga0rr50_388284_c1 3300050513 Bacteria 1178
228 nmdc:mga08x19_333321_c1 3300050514 Bacteria 1057
229 nmdc:mga0a205_195281_c1 3300050515 Bacteria 1915
230 nmdc:mga0a205_92702_c1 3300050515 Bacteria 2919
231 Ga0500616_0009422 3300053153 Bacteria 5940
232 Ga0500616_0050567 3300053153 Bacteria 2194
233 Ga0530510_0077788 3300061734 Bacteria 2411
234 2501408732 2501025504 Bacteria 8008976
235 2511098444 2510917014 Bacteria 8296963
236 2738745619 2738541281 Bacteria 5112672
237 2739354849 2738543032 Bacteria 5115625
238 Ga0436365_1553813
239 Ga0065715_10130896
240 Ga0070676_10102708
241 Ga0070670_100260051
242 Ga0068869_100338956
243 Ga0068869_100348413
244 Ga0070680_100048607
245 Ga0070680_100142340
246 Ga0070689_100228785
247 Ga0070692_10055814
248 Ga0070668_100163282
249 Ga0070669_100176098
250 Ga0070669_100619488
251 Ga0070671_100160126
252 Ga0070659_100594959
253 Ga0070667_100066606
254 Ga0070703_10012101
255 Ga0070708_100023596
256 Ga0070708_100125637
257 Ga0070681_10004104
258 Ga0068867_100247010
259 Ga0070706_100000089
260 Ga0070706_100029756
261 Ga0070707_100067008
262 Ga0070698_100040041
263 Ga0070698_100101817
264 Ga0070699_100021225
265 Ga0070699_100213636
266 Ga0070679_100037582
267 Ga0070697_100040407
268 Ga0070697_100380465
269 Ga0070695_100009715
270 Ga0070695_100120488
271 Ga0070704_100161114
272 Ga0070704_100300875
273 Ga0070664_100022234
274 Ga0068857_100001811
275 Ga0068856_100200252
276 Ga0068852_100345144
277 Ga0068864_100165430
278 Ga0068866_10175771
279 Ga0068862_100255340
280 Ga0081538_10045881
281 Ga0081538_10128446
282 Ga0075365_10230758
283 Ga0097621_100550081
284 Ga0075428_100474258
285 Ga0075433_10101620
286 Ga0075434_100077108
287 Ga0075435_100024824
288 Ga0075435_100342065
289 Ga0099794_10000212
290 Ga0099795_10000319
291 Ga0111539_10249362
292 Ga0114129_10011880
293 Ga0114129_10063581
294 Ga0114129_10115858
295 Ga0114129_10719054
296 Ga0099796_10002039
297 Ga0157370_10032688
298 Ga0157378_10175273
299 Ga0157375_10238736
300 Ga0157380_10425424
301 Ga0157376_10324730
302 Ga0213876_10030163
303 Ga0213875_10005885
304 Ga0213871_10007269
305 Ga0207653_10000736
306 Ga0207642_10027620
307 Ga0207645_10080736
308 Ga0207684_10000106
309 Ga0207684_10175006
310 Ga0207654_10224210
311 Ga0207707_10003422
312 Ga0207660_10016843
313 Ga0207660_10109789
314 Ga0207662_10025061
315 Ga0207652_10053655
316 Ga0207652_10090330
317 Ga0207652_10155582
318 Ga0207646_10000023
319 Ga0207646_10294556
320 Ga0207700_10382027
321 Ga0207700_10618114
322 Ga0207706_10405570
323 Ga0207689_10176878
324 Ga0207679_10004559
325 Ga0207679_10224751
326 Ga0207712_10464184
327 Ga0207668_10135040
328 Ga0207640_10166830
329 Ga0207658_10052285
330 Ga0207678_10489789
331 Ga0207708_10103676
332 Ga0207702_10570747
333 Ga0207641_10500536
334 Ga0207648_10046028
335 Ga0207648_10250283
336 Ga0207676_10602361
337 Ga0207674_10026814
338 Ga0207674_10164402
339 Ga0207675_100078857
340 Ga0207675_100190512
341 Ga0268265_10213676
342 Ga0307409_100856523
343 Ga0307416_100382172
344 Ga0373938_0040029
345 Ga0373940_0037043
346 Ga0373952_0008242
347 Ga0373932_0008101
348 Ga0373953_0060497
349 Ga0373931_0002853
350 Ga0373931_0073411
351 Ga0373947_0121725
352 Ga0395898_0284701
353 Ga0436364_0374996
354 Ga0395901_0012313
355 Ga0400483_014670
356 Ga0400483_065043
357 Ga0400483_160013
358 Ga0400483_168823
359 Ga0400483_259034
360 Ga0400483_266260
361 Ga0436360_1160764
362 Ga0436361_0692027
363 Ga0436361_0814819
364 Ga0436361_1212535
365 Ga0439441_045559
366 Ga0439459_0043343
367 Ga0451577_0101962
368 Ga0453683_0346646
369 Ga0466970_0062022
370 Ga0466958_0095960
371 Ga0466967_0010172
372 Ga0495592_0034498
373 Ga0495603_0004643
374 Ga0495603_0011851
375 Ga0495629_0002955
376 Ga0495629_0009808
377 Ga0495641_0033888
378 Ga0495653_0001327
379 Ga0495580_0000128
380 Ga0495580_0024736
381 Ga0495582_0001392
382 Ga0495582_0003314
383 Ga0495662_0061898
384 Ga0495664_0000211
385 Ga0495594_0008135
386 Ga0495594_0025113
387 Ga0495583_0046456
388 Ga0495606_0032226
389 Ga0495618_0003297
390 Ga0495628_0003860
391 Ga0495630_0002574
392 Ga0495648_0003369
393 Ga0495648_0026168
394 Ga0495666_0000714
395 Ga0495652_0016751
396 Ga0495654_0025156
397 Ga0495665_0002565
398 Ga0495640_0005019
399 Ga0495586_0000731
400 Ga0495587_0002628
401 Ga0495645_0004341
402 Ga0495634_0006571
403 Ga0495634_0130277
404 Ga0495635_0030628
405 Ga0495661_0002408
406 Ga0495588_0003231
407 Ga0495623_0019798
408 Ga0495646_0000235
409 Ga0495647_0000714
410 Ga0495613_0010211
411 Ga0495613_0027048
412 Ga0495624_0001769
413 Ga0495649_0136087
414 Ga0495581_0000710
415 Ga0495604_0003266
416 Ga0495674_0010816
417 Ga0495672_0001073
418 Ga0495672_0007076
419 Ga0495676_0005318
420 Ga0495676_0086473
421 Ga0495680_0004811
422 Ga0495675_0041357
423 Ga0495679_001997
424 Ga0495673_0011228
425 Ga0495673_0024643
426 Ga0495684_0011302
427 Ga0495593_0000425
428 Ga0495593_0001081
429 Ga0495602_0004782
430 Ga0495614_0000303
431 Ga0496100_0139474
432 Ga0496104_0000912
433 Ga0496104_0001205
434 Ga0496105_0064402
435 Ga0496112_0005035
436 Ga0496112_0222369
437 Ga0496113_0027070
438 Ga0496114_0593211
439 Ga0496115_0048901
440 Ga0496119_0016809
441 Ga0496120_0058984
442 Ga0496121_0002724
443 Ga0496125_0012331
444 Ga0501033_0000476
445 Ga0501042_0282780
446 Ga0501047_0038961
447 Ga0501047_0047754
448 Ga0501068_0127294
449 Ga0501070_0299225
450 Ga0501080_0148977
451 Ga0501035_0271071
452 Ga0501044_0185127
453 nmdc:mga03683_18137_c1
454 nmdc:mga00v17_170562_c1
455 nmdc:mga05p37_108210_c1
456 nmdc:mga05p37_285487_c1
457 nmdc:mga05p37_28800_c1
458 nmdc:mga05p37_353063_c1
459 nmdc:mga09592_217552_c1
460 nmdc:mga06r32_572868_c1
461 nmdc:mga0n895_56035_c1
462 nmdc:mga0n895_65339_c1
463 nmdc:mga0rr50_22018_c1
464 nmdc:mga0rr50_388284_c1
465 nmdc:mga08x19_333321_c1
466 nmdc:mga0a205_195281_c1
467 nmdc:mga0a205_92702_c1
468 Ga0500616_0009422
469 Ga0500616_0050567
470 Ga0530510_0077788
471 2501408732
472 2511098444
473 2738745619
474 2739354849

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

45

185

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9381 1 223
8ja7-assembly1.cif.gz_D cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.9358 2 221
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9344 1 223
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9251 2 222
2awo-assembly2.cif.gz_C crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.925 1 222
ID Description Score Start End Superfamily
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9804 1 246 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9724 1 246 3.40.50.300
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9456 3 238 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9432 2 223 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9364 2 219 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6A8AKN4-F1-model_v4 ATP-binding cassette domain-containing protein 0.9794 2 188 GO:0005524
GO:0016887
AF-A0A536LBD7-F1-model_v4 ATP-binding cassette domain-containing protein 0.973 2 160 GO:0005524
GO:0016887
AF-A0A2S8K3Z3-F1-model_v4 deleted 0.9654 34 185
AF-A0A7C7UW92-F1-model_v4 ABC transporter ATP-binding protein 0.9623 1 203 GO:0005524
GO:0005886
GO:0016887
AF-A0A6A8AKN4-F1-model_v4 ATP-binding cassette domain-containing protein 0.9589 2 188 GO:0005524
GO:0016887

Map