F350182

General Info

Members Datasets Scaffolds Average Seq Length
237 192 474 260

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0381178|Ga0373937_0381178_262_1122
Length 286
Sequence MLAHNFKGRELMDEQALKIDPLHKVWDPDTRIGDMLKGKRGLIVGVANADSIAYGCAVKLRAFGAELALTYLNEKSKRFVEPLAAHIEASLLLPLDVEQPGEMEAVFKRIEAEWGQLDFVVHSIAFAPRADLHGRVVDCSKDGFLQAMRVSCYSFIEMARLAEPLMKNGGSLLTMSYYGADKVVNHYNVMGPVKSALQATTRYLAAELGEKGIRVYAVSPGPLKTRAASGIADFDELVEAAVKRSPAHRLVDIAEVGRVAAFLVGGASSGMTGDTIYVDGGLHNVA

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
3 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
4 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
54 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
84 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
85 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
86 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
87 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
90 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
91 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
100 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
101 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
102 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
108 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
116 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
132 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
168 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
171 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
172 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
173 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
174 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
175 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
176 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
177 2818991452 Burkholderia cepacia 561 Isolate Unclassified
178 2821131069 Duganella sp. 1224 Isolate Unclassified
179 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
180 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
181 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
182 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
183 2857553236 Duganella sp. R-74557 Isolate Unclassified
184 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
185 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
186 2919476304 Duganella sp. 3397 Isolate Unclassified
187 2928170801 Burkholderia sp. 572 Isolate Unclassified
188 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
189 641522639 Methylobacterium sp. 4-46 Isolate Nodule
190 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
191 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
192 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.45
Metatranscriptomes 1.27
Isolates 9.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.59
Nodule 1.69
Rhizoplane 13.08
Rhizosphere 72.57
Stem 0
Stem Tuber 0
Unclassified 2.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0381178 3300036401 Bacteria 1337
2 Ga0055532_1000381 3300003758 Bacteria 22783
3 Ga0055527_1002243 3300003760 Bacteria 3377
4 Ga0055535_1000832 3300003761 Bacteria 22142
5 Ga0055542_1000829 3300003762 Bacteria 22142
6 Ga0055529_1000142 3300003763 Bacteria 102143
7 Ga0055528_1001335 3300003790 Bacteria 15344
8 Ga0070676_10357910 3300005328 Bacteria 1005
9 Ga0070680_100060757 3300005336 Bacteria 3092
10 Ga0068868_100357792 3300005338 Bacteria 1252
11 Ga0070660_100092589 3300005339 Bacteria 2386
12 Ga0070691_10073407 3300005341 Bacteria 1663
13 Ga0070668_100360762 3300005347 Bacteria 1232
14 Ga0070659_100048356 3300005366 Plasmid 3341
15 Ga0070659_100164319 3300005366 Bacteria 1816
16 Ga0070705_100025147 3300005440 Bacteria 3225
17 Ga0070694_100048582 3300005444 Bacteria 2855
18 Ga0070663_100025809 3300005455 Bacteria 3971
19 Ga0070662_100665262 3300005457 Bacteria 879
20 Ga0070681_10005974 3300005458 Bacteria 11792
21 Ga0070681_10231617 3300005458 Bacteria 1762
22 Ga0070707_100286375 3300005468 Bacteria 1601
23 Ga0070679_100048119 3300005530 Bacteria 4249
24 Ga0070679_100139424 3300005530 Bacteria 2405
25 Ga0070697_100311011 3300005536 Bacteria 1356
26 Ga0070695_100028358 3300005545 Bacteria 3474
27 Ga0070696_100037918 3300005546 Bacteria 3325
28 Ga0070693_100015017 3300005547 Bacteria 3982
29 Ga0068855_100032938 3300005563 Bacteria 6186
30 Ga0070664_100075717 3300005564 Bacteria 2891
31 Ga0070702_100112158 3300005615 Unclassified 1693
32 Ga0068861_100041992 3300005719 Bacteria 3427
33 Ga0068858_100096563 3300005842 Bacteria 2754
34 Ga0081455_10003206 3300005937 Bacteria 18939
35 Ga0081538_10104960 3300005981 Bacteria 1408
36 Ga0081540_1000363 3300005983 Bacteria 45608
37 Ga0097621_100131209 3300006237 Bacteria 2133
38 Ga0068871_100204166 3300006358 Bacteria 1707
39 Ga0075430_100473319 3300006846 Bacteria 1034
40 Ga0075431_100155335 3300006847 Bacteria 2354
41 Ga0075431_100164832 3300006847 Bacteria 2278
42 Ga0075429_100262727 3300006880 Bacteria 1511
43 Ga0079104_1023002 3300006946 Bacteria 1666
44 Ga0105240_10000287 3300009093 Bacteria 98443
45 Ga0111539_10107066 3300009094 Bacteria 3280
46 Ga0111539_10567821 3300009094 Bacteria 1321
47 Ga0105237_10505474 3300009545 Bacteria 1215
48 Ga0105238_10955354 3300009551 Bacteria 877
49 Ga0105239_10101218 3300010375 Bacteria 3187
50 Ga0105246_10066946 3300011119 Bacteria 2516
51 Ga0157370_10133567 3300013104 Bacteria 2314
52 Ga0157369_10049985 3300013105 Bacteria 4530
53 Ga0157379_10196581 3300014968 Bacteria 1823
54 Ga0157376_10043821 3300014969 Bacteria 3673
55 Ga0157376_10395083 3300014969 Bacteria 1335
56 Ga0182006_1000008 3300015261 Bacteria 449652
57 Ga0182006_1031589 3300015261 Bacteria 2132
58 Ga0182005_1000022 3300015265 Bacteria 266181
59 Ga0213872_10043283 3300021361 Bacteria 2052
60 Ga0213872_10059086 3300021361 Bacteria 1735
61 Ga0213872_10144056 3300021361 Bacteria 1044
62 Ga0213871_10017140 3300021441 Unclassified 1756
63 Ga0209566_100233 3300025225 Bacteria 53840
64 Ga0209672_100032 3300025228 Bacteria 324684
65 Ga0209147_100012 3300025229 Bacteria 681990
66 Ga0209147_100150 3300025229 Bacteria 100971
67 Ga0209258_100030 3300025242 Bacteria 470208
68 Ga0209148_1000022 3300025254 Bacteria 681990
69 Ga0209565_1017890 3300025263 Bacteria 1544
70 Ga0209455_1000024 3300025272 Bacteria 676133
71 Ga0209673_1000056 3300025273 Bacteria 271069
72 Ga0209564_1028001 3300025295 Bacteria 1814
73 Ga0207647_10007006 3300025904 Bacteria 8175
74 Ga0207645_10514711 3300025907 Bacteria 811
75 Ga0207654_10078672 3300025911 Bacteria 1979
76 Ga0207707_10054682 3300025912 Bacteria 3475
77 Ga0207695_10001005 3300025913 Bacteria 49964
78 Ga0207695_10003086 3300025913 Bacteria 23848
79 Ga0207660_10009424 3300025917 Bacteria 6319
80 Ga0207660_10367300 3300025917 Bacteria 1155
81 Ga0207657_10178724 3300025919 Bacteria 1716
82 Ga0207652_10037301 3300025921 Bacteria 4114
83 Ga0207694_10018696 3300025924 Bacteria 5237
84 Ga0207690_10031070 3300025932 Bacteria 3414
85 Ga0207679_10378687 3300025945 Bacteria 1240
86 Ga0207667_10082748 3300025949 Bacteria 3324
87 Ga0207703_10244495 3300026035 Bacteria 1614
88 Ga0207639_10113324 3300026041 Bacteria 2214
89 Ga0207678_10002892 3300026067 Bacteria 15594
90 Ga0207708_10030557 3300026075 Bacteria 4085
91 Ga0207675_100014317 3300026118 Bacteria 7393
92 Ga0207683_10117267 3300026121 Bacteria 2387
93 Ga0209371_1000200 3300027312 Bacteria 86718
94 Ga0268266_10092200 3300028379 Bacteria 2658
95 Ga0265326_10000576 3300028558 Bacteria 13713
96 Ga0265319_1005052 3300028563 Bacteria 6413
97 Ga0265334_10002009 3300028573 Bacteria 9642
98 Ga0265323_10001056 3300028653 Bacteria 14241
99 Ga0265336_10000063 3300028666 Bacteria 98413
100 Ga0265338_10000154 3300028800 Bacteria 125708
101 Ga0265338_10108695 3300028800 Bacteria 2239
102 Ga0265324_10003537 3300029957 Bacteria 7364
103 Ga0268256_1000085 3300030500 Bacteria 162183
104 Ga0265760_10050795 3300031090 Bacteria 1248
105 Ga0265328_10000343 3300031239 Bacteria 21881
106 Ga0265320_10012776 3300031240 Bacteria 4866
107 Ga0265316_10027133 3300031344 Bacteria 4749
108 Ga0265313_10000170 3300031595 Bacteria 68643
109 Ga0316579_10007105 3300031691 Bacteria 4607
110 Ga0316579_10064645 3300031691 Bacteria 1725
111 Ga0265314_10056130 3300031711 Bacteria 2713
112 Ga0316576_10217813 3300031727 Bacteria 1436
113 Ga0316577_10063618 3300031733 Bacteria 2059
114 Ga0316577_10145450 3300031733 Archaea 1335
115 Ga0316583_10002955 3300032133 Bacteria 5973
116 Ga0316583_10099576 3300032133 Bacteria 1013
117 Ga0316580_10000902 3300032139 Bacteria 7347
118 Ga0316580_10018985 3300032139 Bacteria 2116
119 Ga0316588_1002128 3300033528 Bacteria 3402
120 Ga0316596_1052208 3300033541 Unclassified 1083
121 Ga0373936_0060012 3300035113 Bacteria 1551
122 Ga0316574_0005647 3300035398 Bacteria 6693
123 Ga0373931_0023722 3300035691 Bacteria 3100
124 Ga0373937_0093511 3300036401 Bacteria 2788
125 Ga0316582_0091254 3300036647 Bacteria 2005
126 Ga0316584_0003618 3300036712 Bacteria 10113
127 Ga0395905_0186300 3300037471 Bacteria 1948
128 Ga0316581_0004951 3300037588 Bacteria 3434
129 Ga0316581_0058746 3300037588 Unclassified 1179
130 Ga0395901_0000076 3300038443 Bacteria 138169
131 Ga0436360_0008684 3300039438 Unclassified 2153
132 Ga0436360_0509681 3300039438 Bacteria 1403
133 Ga0436361_0179830 3300039447 Bacteria 7307
134 Ga0436361_0409863 3300039447 Bacteria 3413
135 Ga0436361_0485730 3300039447 Bacteria 2161
136 Ga0436361_0545177 3300039447 Bacteria 6200
137 Ga0436361_0702469 3300039447 Bacteria 2943
138 Ga0436363_0301411 3300039450 Bacteria 3995
139 Ga0450911_000134 3300042115 Bacteria 29664
140 Ga0495627_000001 3300046453 Bacteria 1104709
141 Ga0495650_0000827 3300046471 Bacteria 37402
142 Ga0495580_0000419 3300046472 Bacteria 35257
143 Ga0495596_0002183 3300046500 Bacteria 10669
144 Ga0495628_0128096 3300046516 Bacteria 1943
145 Ga0495652_0235551 3300046529 Bacteria 1366
146 Ga0495609_0001047 3300046538 Bacteria 19407
147 Ga0495667_0227389 3300046559 Bacteria 1190
148 Ga0495599_0354196 3300046678 Bacteria 879
149 Ga0495646_0167345 3300046680 Bacteria 1213
150 Ga0495624_0000446 3300046690 Bacteria 32513
151 Ga0495660_0000024 3300046810 Bacteria 268209
152 Ga0495660_0001053 3300046810 Bacteria 19967
153 Ga0495604_0102713 3300047317 Bacteria 2098
154 Ga0495680_0033461 3300047322 Bacteria 4161
155 Ga0495675_0046146 3300047444 Bacteria 2774
156 Ga0495675_0216599 3300047444 Bacteria 1160
157 Ga0495673_0000015 3300047469 Bacteria 598766
158 Ga0495681_0014251 3300047470 Bacteria 4568
159 Ga0495602_0135861 3300048088 Bacteria 1953
160 Ga0496102_0008348 3300048905 Bacteria 8867
161 Ga0496103_0002653 3300048906 Bacteria 11194
162 Ga0496104_0003883 3300048907 Bacteria 12932
163 Ga0496104_0006383 3300048907 Bacteria 10368
164 Ga0496104_0160251 3300048907 Bacteria 2158
165 Ga0496105_0000100 3300048908 Bacteria 58110
166 Ga0496105_0002213 3300048908 Bacteria 14093
167 Ga0496105_0073603 3300048908 Bacteria 2822
168 Ga0496105_0076513 3300048908 Bacteria 2763
169 Ga0496105_0349088 3300048908 Bacteria 1182
170 Ga0496106_0039787 3300048909 Bacteria 3521
171 Ga0496107_0013781 3300048910 Bacteria 5653
172 Ga0496108_0000684 3300048911 Bacteria 26239
173 Ga0496108_0073316 3300048911 Bacteria 2890
174 Ga0496108_0138335 3300048911 Bacteria 2097
175 Ga0496109_0042176 3300048912 Bacteria 4132
176 Ga0496110_0180026 3300048913 Bacteria 1919
177 Ga0496111_0021209 3300048914 Bacteria 4533
178 Ga0496111_0026319 3300048914 Bacteria 4107
179 Ga0496112_0000820 3300048915 Bacteria 22031
180 Ga0496112_0025283 3300048915 Bacteria 5701
181 Ga0496113_0001595 3300048916 Bacteria 12743
182 Ga0496113_0031920 3300048916 Bacteria 3825
183 Ga0496113_0116798 3300048916 Bacteria 2082
184 Ga0496114_0030373 3300048917 Plasmid 4446
185 Ga0496115_0221968 3300048918 Bacteria 1559
186 Ga0496115_0287887 3300048918 Bacteria 1348
187 Ga0496119_0003321 3300048922 Bacteria 16786
188 Ga0496119_0088529 3300048922 Bacteria 1765
189 Ga0496124_0018094 3300048927 Bacteria 6615
190 Ga0496125_0130984 3300048928 Bacteria 1766
191 Ga0496126_0000196 3300048929 Bacteria 134394
192 Ga0495678_000002 3300049459 Bacteria 999613
193 Ga0501042_0194973 3300049578 Bacteria 1461
194 Ga0501046_0000127 3300049580 Bacteria 81278
195 Ga0501047_0012133 3300049581 Bacteria 8155
196 Ga0501076_0093803 3300049592 Bacteria 2416
197 Ga0501076_0196251 3300049592 Bacteria 1648
198 Ga0501077_0115212 3300049593 Bacteria 1704
199 Ga0501081_0311912 3300049743 Bacteria 1155
200 Ga0501035_0001960 3300049822 Bacteria 20598
201 Ga0501045_0131101 3300049824 Bacteria 1863
202 nmdc:mga05p37_502026_c1 3300050507 Bacteria 1392
203 nmdc:mga09592_146657_c1 3300050508 Bacteria 2035
204 nmdc:mga0qj67_121552_c1 3300050509 Bacteria 2113
205 nmdc:mga0qj67_18898_c1 3300050509 Bacteria 5259
206 nmdc:mga06r32_103762_c1 3300050510 Bacteria 2792
207 nmdc:mga06r32_165576_c1 3300050510 Bacteria 2194
208 nmdc:mga08y16_111454_c1 3300050511 Bacteria 2848
209 nmdc:mga08y16_445638_c1 3300050511 Bacteria 1321
210 Ga0495619_0086445 3300053085 Bacteria 2119
211 Ga0500595_018562 3300053119 Bacteria 2541
212 Ga0500618_003065 3300053125 Bacteria 5924
213 Ga0501082_0697356 3300060353 Bacteria 889
214 Ga0530510_0018825 3300061734 Bacteria 4897
215 Ga0530510_0401604 3300061734 Bacteria 1033
216 2545673451 2545555834 Bacteria 8130841
217 2547375895 2547132103 Bacteria 5115736
218 2599735870 2599185239 Bacteria 8686614
219 2599748593 2599185240 Bacteria 7968121
220 2600210504 2599185355 Bacteria 7968906
221 2676746829 2675903129 Bacteria 7964495
222 2819630080 2818991452 Bacteria 8442785
223 2821132286 2821131069 Bacteria 6108407
224 2842336951 2842333319 Bacteria 8899485
225 2843691597 2843690924 Bacteria 5169057
226 2846035449 2846033681 Bacteria 4377894
227 2846040199 2846037992 Bacteria 4526407
228 2857555265 2857553236 Bacteria 6166726
229 2863424165 2863421361 Bacteria 7300805
230 2870073281 2870068957 Bacteria 8925310
231 2919477627 2919476304 Bacteria 5888696
232 2928173948 2928170801 Bacteria 8785406
233 2998345876 2998344455 Bacteria 4222996
234 641646198 641522639 Bacteria 7737025
235 8018848396 8018845410 Bacteria 8933938
236 8020953329 8020945358 Bacteria 8467355
237 8021126200 8021120328 Bacteria 8782274
238 Ga0373937_0381178
239 Ga0055532_1000381
240 Ga0055527_1002243
241 Ga0055535_1000832
242 Ga0055542_1000829
243 Ga0055529_1000142
244 Ga0055528_1001335
245 Ga0070676_10357910
246 Ga0070680_100060757
247 Ga0068868_100357792
248 Ga0070660_100092589
249 Ga0070691_10073407
250 Ga0070668_100360762
251 Ga0070659_100048356
252 Ga0070659_100164319
253 Ga0070705_100025147
254 Ga0070694_100048582
255 Ga0070663_100025809
256 Ga0070662_100665262
257 Ga0070681_10005974
258 Ga0070681_10231617
259 Ga0070707_100286375
260 Ga0070679_100048119
261 Ga0070679_100139424
262 Ga0070697_100311011
263 Ga0070695_100028358
264 Ga0070696_100037918
265 Ga0070693_100015017
266 Ga0068855_100032938
267 Ga0070664_100075717
268 Ga0070702_100112158
269 Ga0068861_100041992
270 Ga0068858_100096563
271 Ga0081455_10003206
272 Ga0081538_10104960
273 Ga0081540_1000363
274 Ga0097621_100131209
275 Ga0068871_100204166
276 Ga0075430_100473319
277 Ga0075431_100155335
278 Ga0075431_100164832
279 Ga0075429_100262727
280 Ga0079104_1023002
281 Ga0105240_10000287
282 Ga0111539_10107066
283 Ga0111539_10567821
284 Ga0105237_10505474
285 Ga0105238_10955354
286 Ga0105239_10101218
287 Ga0105246_10066946
288 Ga0157370_10133567
289 Ga0157369_10049985
290 Ga0157379_10196581
291 Ga0157376_10043821
292 Ga0157376_10395083
293 Ga0182006_1000008
294 Ga0182006_1031589
295 Ga0182005_1000022
296 Ga0213872_10043283
297 Ga0213872_10059086
298 Ga0213872_10144056
299 Ga0213871_10017140
300 Ga0209566_100233
301 Ga0209672_100032
302 Ga0209147_100012
303 Ga0209147_100150
304 Ga0209258_100030
305 Ga0209148_1000022
306 Ga0209565_1017890
307 Ga0209455_1000024
308 Ga0209673_1000056
309 Ga0209564_1028001
310 Ga0207647_10007006
311 Ga0207645_10514711
312 Ga0207654_10078672
313 Ga0207707_10054682
314 Ga0207695_10001005
315 Ga0207695_10003086
316 Ga0207660_10009424
317 Ga0207660_10367300
318 Ga0207657_10178724
319 Ga0207652_10037301
320 Ga0207694_10018696
321 Ga0207690_10031070
322 Ga0207679_10378687
323 Ga0207667_10082748
324 Ga0207703_10244495
325 Ga0207639_10113324
326 Ga0207678_10002892
327 Ga0207708_10030557
328 Ga0207675_100014317
329 Ga0207683_10117267
330 Ga0209371_1000200
331 Ga0268266_10092200
332 Ga0265326_10000576
333 Ga0265319_1005052
334 Ga0265334_10002009
335 Ga0265323_10001056
336 Ga0265336_10000063
337 Ga0265338_10000154
338 Ga0265338_10108695
339 Ga0265324_10003537
340 Ga0268256_1000085
341 Ga0265760_10050795
342 Ga0265328_10000343
343 Ga0265320_10012776
344 Ga0265316_10027133
345 Ga0265313_10000170
346 Ga0316579_10007105
347 Ga0316579_10064645
348 Ga0265314_10056130
349 Ga0316576_10217813
350 Ga0316577_10063618
351 Ga0316577_10145450
352 Ga0316583_10002955
353 Ga0316583_10099576
354 Ga0316580_10000902
355 Ga0316580_10018985
356 Ga0316588_1002128
357 Ga0316596_1052208
358 Ga0373936_0060012
359 Ga0316574_0005647
360 Ga0373931_0023722
361 Ga0373937_0093511
362 Ga0316582_0091254
363 Ga0316584_0003618
364 Ga0395905_0186300
365 Ga0316581_0004951
366 Ga0316581_0058746
367 Ga0395901_0000076
368 Ga0436360_0008684
369 Ga0436360_0509681
370 Ga0436361_0179830
371 Ga0436361_0409863
372 Ga0436361_0485730
373 Ga0436361_0545177
374 Ga0436361_0702469
375 Ga0436363_0301411
376 Ga0450911_000134
377 Ga0495627_000001
378 Ga0495650_0000827
379 Ga0495580_0000419
380 Ga0495596_0002183
381 Ga0495628_0128096
382 Ga0495652_0235551
383 Ga0495609_0001047
384 Ga0495667_0227389
385 Ga0495599_0354196
386 Ga0495646_0167345
387 Ga0495624_0000446
388 Ga0495660_0000024
389 Ga0495660_0001053
390 Ga0495604_0102713
391 Ga0495680_0033461
392 Ga0495675_0046146
393 Ga0495675_0216599
394 Ga0495673_0000015
395 Ga0495681_0014251
396 Ga0495602_0135861
397 Ga0496102_0008348
398 Ga0496103_0002653
399 Ga0496104_0003883
400 Ga0496104_0006383
401 Ga0496104_0160251
402 Ga0496105_0000100
403 Ga0496105_0002213
404 Ga0496105_0073603
405 Ga0496105_0076513
406 Ga0496105_0349088
407 Ga0496106_0039787
408 Ga0496107_0013781
409 Ga0496108_0000684
410 Ga0496108_0073316
411 Ga0496108_0138335
412 Ga0496109_0042176
413 Ga0496110_0180026
414 Ga0496111_0021209
415 Ga0496111_0026319
416 Ga0496112_0000820
417 Ga0496112_0025283
418 Ga0496113_0001595
419 Ga0496113_0031920
420 Ga0496113_0116798
421 Ga0496114_0030373
422 Ga0496115_0221968
423 Ga0496115_0287887
424 Ga0496119_0003321
425 Ga0496119_0088529
426 Ga0496124_0018094
427 Ga0496125_0130984
428 Ga0496126_0000196
429 Ga0495678_000002
430 Ga0501042_0194973
431 Ga0501046_0000127
432 Ga0501047_0012133
433 Ga0501076_0093803
434 Ga0501076_0196251
435 Ga0501077_0115212
436 Ga0501081_0311912
437 Ga0501035_0001960
438 Ga0501045_0131101
439 nmdc:mga05p37_502026_c1
440 nmdc:mga09592_146657_c1
441 nmdc:mga0qj67_121552_c1
442 nmdc:mga0qj67_18898_c1
443 nmdc:mga06r32_103762_c1
444 nmdc:mga06r32_165576_c1
445 nmdc:mga08y16_111454_c1
446 nmdc:mga08y16_445638_c1
447 Ga0495619_0086445
448 Ga0500595_018562
449 Ga0500618_003065
450 Ga0501082_0697356
451 Ga0530510_0018825
452 Ga0530510_0401604
453 2545673451
454 2547375895
455 2599735870
456 2599748593
457 2600210504
458 2676746829
459 2819630080
460 2821132286
461 2842336951
462 2843691597
463 2846035449
464 2846040199
465 2857555265
466 2863424165
467 2870073281
468 2919477627
469 2928173948
470 2998345876
471 641646198
472 8018848396
473 8020953329
474 8021126200

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

45

283

0.99

PF00106

adh_short

short chain dehydrogenase

35

236

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ycs-assembly1.cif.gz_B x-ray structure of enoyl-acyl carrier protein reductase from bacillus anthracis with triclosan 0.9694 16 269
7fcm-assembly1.cif.gz_B crystal structure of moraxella catarrhalis enoyl-acp-reductase (fabi) in complex with nad and triclosan 0.9686 16 267
2pd3-assembly1.cif.gz_B crystal structure of the helicobacter pylori enoyl-acyl carrier protein reductase in complex with hydroxydiphenyl ether compounds, triclosan and diclosan 0.9682 19 269
3oig-assembly1.cif.gz_A crystal structure of enoyl-acp reductases i (fabi) from b. subtilis (complex with nad and inh) 0.9662 19 267
5tf4-assembly2.cif.gz_F crystal structure of enoyl-(acyl carrier protein) reductase from bartonella henselae in complext with nad 0.9645 19 269
ID Description Score Start End Superfamily
af_P0AEK4_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9661 19 267 3.40.50.720
3grkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9632 19 269 3.40.50.720
2p91A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9553 18 269 3.40.50.720
4cv1H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9539 19 269 3.40.50.720
3grkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9481 19 269 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1E3GBS4-F1-model_v4 deleted 0.9809 19 269
AF-R4YR29-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI (EC 1.3.1.9) (NADH-dependent enoyl-ACP reductase) 0.9808 83 267 GO:0004318
GO:0006633
AF-A0A7R9AJE4-F1-model_v4 MaoC-like domain-containing protein 0.9806 96 267 GO:0004318
GO:0006633
GO:0006635
AF-A0A2E2KIW3-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) 0.9805 15 269 GO:0004318
GO:0006633
AF-A0A557R2C0-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) 0.9804 19 269 GO:0004318
GO:0006633

Map