F349916

General Info

Members Datasets Scaffolds Average Seq Length
237 177 474 135

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100080902|Ga0075434_1000809023
Length 146
Sequence MIPETLATLPPTLEAMMASIRKEILIDAPAEKVWDAVRDVGAVHRRLVPGFVVDTRLEDGARVVTFANGLVARELIVGVDDEARRLVWAVVGSRRLTHHNGSMQVFAEADAQSRVVWIADLLPHEVAPDIAGLMEQGLAVMKKTLG

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
111 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
114 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
138 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
159 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
160 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
161 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
162 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
163 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
164 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
165 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
166 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
167 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
168 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
169 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
170 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
171 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
172 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
173 2643221583 Caulobacter sp. Root655 Isolate Unclassified
174 2643221584 Caulobacter sp. Root656 Isolate Unclassified
175 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
176 2818991435 Caulobacter henricii 536 Isolate Unclassified
177 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.78
Metatranscriptomes 0
Isolates 4.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.77
Nodule 0
Rhizoplane 1.69
Rhizosphere 77.22
Stem 0
Stem Tuber 0
Unclassified 8.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100080902 3300006871 Bacteria 3246
2 rootL2_10012959 3300003322 Bacteria 1929
3 rootL2_10222047 3300003322 Bacteria 1101
4 Ga0055537_1009870 3300003773 Bacteria 2063
5 Ga0055524_1004685 3300003775 Bacteria 6266
6 Ga0055524_1014411 3300003775 Bacteria 2930
7 Ga0055528_1005829 3300003790 Bacteria 5662
8 Ga0055531_10012008 3300003794 Bacteria 4113
9 Ga0065165_1015968 3300005262 Bacteria 2836
10 Ga0065165_1135143 3300005262 Bacteria 587
11 Ga0068869_101227727 3300005334 Unclassified 659
12 Ga0070666_10050923 3300005335 Bacteria 2787
13 Ga0068868_100030389 3300005338 Bacteria 4143
14 Ga0070660_100349424 3300005339 Bacteria 1217
15 Ga0070661_100017531 3300005344 Bacteria 5081
16 Ga0070705_100695382 3300005440 Bacteria 798
17 Ga0070700_100544989 3300005441 Bacteria 900
18 Ga0070708_100233879 3300005445 Bacteria 1725
19 Ga0068867_100934566 3300005459 Bacteria 782
20 Ga0070706_100260824 3300005467 Bacteria 1618
21 Ga0070706_100654324 3300005467 Bacteria 975
22 Ga0070706_100741685 3300005467 Bacteria 910
23 Ga0070707_100132806 3300005468 Bacteria 2421
24 Ga0070707_100225493 3300005468 Bacteria 1825
25 Ga0070707_100337041 3300005468 Unclassified 1465
26 Ga0070707_100899222 3300005468 Bacteria 850
27 Ga0070698_100012835 3300005471 Bacteria 8873
28 Ga0070698_100078249 3300005471 Bacteria 3305
29 Ga0070698_100109783 3300005471 Bacteria 2725
30 Ga0070699_101116953 3300005518 Bacteria 723
31 Ga0070684_100125692 3300005535 Bacteria 2310
32 Ga0070697_100009639 3300005536 Bacteria 7544
33 Ga0070697_100282310 3300005536 Bacteria 1425
34 Ga0070697_101222744 3300005536 Bacteria 670
35 Ga0068853_100086879 3300005539 Bacteria 2743
36 Ga0070695_101498816 3300005545 Bacteria 561
37 Ga0070696_100964595 3300005546 Unclassified 710
38 Ga0070665_100003650 3300005548 Bacteria 16301
39 Ga0068855_100077362 3300005563 Bacteria 3861
40 Ga0068854_100009225 3300005578 Bacteria 6367
41 Ga0068856_100062193 3300005614 Bacteria 3687
42 Ga0068852_100010925 3300005616 Bacteria 6805
43 Ga0068864_100099185 3300005618 Bacteria 2580
44 Ga0068864_101177946 3300005618 Bacteria 764
45 Ga0068861_101395951 3300005719 Bacteria 684
46 Ga0068861_102040252 3300005719 Bacteria 573
47 Ga0068851_10006338 3300005834 Bacteria 5398
48 Ga0068858_100151327 3300005842 Bacteria 2182
49 Ga0070716_100547395 3300006173 Bacteria 862
50 Ga0070716_101247689 3300006173 Bacteria 599
51 Ga0075362_10187499 3300006177 Bacteria 1004
52 Ga0075366_10315568 3300006195 Bacteria 957
53 Ga0097621_100225920 3300006237 Unclassified 1633
54 Ga0075370_10318184 3300006353 Bacteria 927
55 Ga0068871_100165462 3300006358 Bacteria 1893
56 Ga0075428_100249317 3300006844 Unclassified 1914
57 Ga0075428_100359792 3300006844 Bacteria 1561
58 Ga0075430_101255978 3300006846 Bacteria 609
59 Ga0075431_100097228 3300006847 Bacteria 3040
60 Ga0075431_100219714 3300006847 Bacteria 1939
61 Ga0075431_100332489 3300006847 Bacteria 1530
62 Ga0075433_10024895 3300006852 Bacteria 5056
63 Ga0075433_10061585 3300006852 Bacteria 3287
64 Ga0075433_10992004 3300006852 Bacteria 732
65 Ga0075434_100046781 3300006871 Bacteria 4293
66 Ga0075434_101253972 3300006871 Bacteria 753
67 Ga0075434_101285701 3300006871 Bacteria 742
68 Ga0075434_101355178 3300006871 Unclassified 722
69 Ga0075429_101431496 3300006880 Bacteria 602
70 Ga0075436_100685004 3300006914 Bacteria 759
71 Ga0075435_100586926 3300007076 Bacteria 966
72 Ga0075435_101004526 3300007076 Bacteria 728
73 Ga0099795_10100130 3300007788 Bacteria 1136
74 Ga0105240_10170133 3300009093 Bacteria 2581
75 Ga0111539_10844735 3300009094 Bacteria 1065
76 Ga0105245_10005017 3300009098 Bacteria 11637
77 Ga0114129_10103329 3300009147 Unclassified 3940
78 Ga0114129_12627300 3300009147 Bacteria 601
79 Ga0105241_10009163 3300009174 Bacteria 7284
80 Ga0105242_10004605 3300009176 Bacteria 10688
81 Ga0105248_10236583 3300009177 Unclassified 2056
82 Ga0105237_10075415 3300009545 Bacteria 3364
83 Ga0105237_10295671 3300009545 Unclassified 1622
84 Ga0105238_10107666 3300009551 Bacteria 2768
85 Ga0105239_10030345 3300010375 Bacteria 5944
86 Ga0157374_10004332 3300013296 Bacteria 11941
87 Ga0163163_10463186 3300014325 Bacteria 1328
88 Ga0157379_10029584 3300014968 Bacteria 4870
89 Ga0209565_1002566 3300025263 Bacteria 6451
90 Ga0209673_1000941 3300025273 Bacteria 36504
91 Ga0209675_1031330 3300025291 Bacteria 1258
92 Ga0209564_1008652 3300025295 Bacteria 4980
93 Ga0209564_1013276 3300025295 Bacteria 3517
94 Ga0209758_1002304 3300025297 Bacteria 19732
95 Ga0209758_1011970 3300025297 Bacteria 4931
96 Ga0209050_1027808 3300025298 Bacteria 1853
97 Ga0209050_1107862 3300025298 Bacteria 540
98 Ga0209256_1000641 3300025299 Bacteria 47608
99 Ga0209256_1003933 3300025299 Bacteria 9787
100 Ga0209257_1000350 3300025304 Bacteria 95008
101 Ga0207656_10076251 3300025321 Bacteria 1499
102 Ga0207680_10019268 3300025903 Bacteria 3646
103 Ga0207684_10206664 3300025910 Bacteria 1694
104 Ga0207684_10538539 3300025910 Bacteria 999
105 Ga0207671_10069252 3300025914 Bacteria 2630
106 Ga0207671_10974482 3300025914 Bacteria 669
107 Ga0207649_10000387 3300025920 Bacteria 32995
108 Ga0207646_10137621 3300025922 Bacteria 2199
109 Ga0207646_10186236 3300025922 Bacteria 1875
110 Ga0207646_10235330 3300025922 Bacteria 1655
111 Ga0207646_10803044 3300025922 Bacteria 838
112 Ga0207694_10123642 3300025924 Bacteria 2068
113 Ga0207687_10004936 3300025927 Bacteria 8854
114 Ga0207686_10004960 3300025934 Bacteria 7163
115 Ga0207709_10649397 3300025935 Bacteria 840
116 Ga0207669_10758703 3300025937 Bacteria 802
117 Ga0207711_10097935 3300025941 Plasmid 2591
118 Ga0207667_10110751 3300025949 Bacteria 2832
119 Ga0207640_10044958 3300025981 Bacteria 2833
120 Ga0207677_10030548 3300026023 Bacteria 3440
121 Ga0207703_10043867 3300026035 Bacteria 3591
122 Ga0207639_10000375 3300026041 Bacteria 30929
123 Ga0207702_10030096 3300026078 Bacteria 4523
124 Ga0207641_10598978 3300026088 Bacteria 1079
125 Ga0207648_10596832 3300026089 Bacteria 1017
126 Ga0207676_10735876 3300026095 Bacteria 958
127 Ga0207676_11199030 3300026095 Bacteria 752
128 Ga0207674_10082401 3300026116 Bacteria 3218
129 Ga0209996_1049112 3300027395 Bacteria 637
130 Ga0210000_1006274 3300027462 Bacteria 1730
131 Ga0209974_10089300 3300027876 Bacteria 1067
132 Ga0268266_10007289 3300028379 Bacteria 10000
133 Ga0268265_10209392 3300028380 Unclassified 1698
134 Ga0265337_1003948 3300028556 Bacteria 6278
135 Ga0265334_10319798 3300028573 Unclassified 531
136 Ga0307515_10289553 3300028794 Bacteria 1335
137 Ga0307515_10843306 3300028794 Unclassified 542
138 Ga0307511_10328647 3300030521 Bacteria 671
139 Ga0265332_10044994 3300031238 Unclassified 1903
140 Ga0265320_10003391 3300031240 Bacteria 10736
141 Ga0307513_10362470 3300031456 Bacteria 1194
142 Ga0307408_100331628 3300031548 Bacteria 1285
143 Ga0265314_10443866 3300031711 Unclassified 692
144 Ga0373944_0278881 3300035089 Unclassified 623
145 Ga0373931_0334944 3300035691 Bacteria 943
146 Ga0373935_1061355 3300035692 Bacteria 602
147 Ga0373927_0635357 3300035695 Bacteria 706
148 Ga0451789_0821929 3300041443 Bacteria 523
149 Ga0451855_1108441 3300041511 Bacteria 742
150 Ga0451853_0214521 3300041512 Bacteria 623
151 Ga0439441_015997 3300042001 Bacteria 1333
152 Ga0439459_0085758 3300042438 Bacteria 750
153 Ga0451577_0026708 3300042876 Bacteria 5229
154 Ga0453684_0059099 3300044712 Bacteria 4947
155 Ga0451576_0043910 3300045051 Unclassified 4714
156 Ga0495627_000218 3300046453 Bacteria 62342
157 Ga0495638_0008483 3300046460 Bacteria 7282
158 Ga0495638_0019247 3300046460 Bacteria 4518
159 Ga0495650_0000007 3300046471 Bacteria 718072
160 Ga0495650_0096468 3300046471 Bacteria 1116
161 Ga0495607_0053993 3300046501 Bacteria 2317
162 Ga0495606_0001606 3300046507 Bacteria 29482
163 Ga0495610_0007365 3300046512 Bacteria 7346
164 Ga0495610_0032744 3300046512 Bacteria 2696
165 Ga0495616_0003953 3300046513 Bacteria 9441
166 Ga0495616_0189150 3300046513 Bacteria 911
167 Ga0495631_0247007 3300046518 Bacteria 761
168 Ga0495632_0002841 3300046519 Bacteria 12803
169 Ga0495632_0239273 3300046519 Bacteria 817
170 Ga0495637_0027128 3300046520 Bacteria 2565
171 Ga0495643_0154883 3300046522 Bacteria 1132
172 Ga0495643_0209740 3300046522 Bacteria 930
173 Ga0495643_0454127 3300046522 Bacteria 557
174 Ga0495648_0043601 3300046524 Bacteria 2810
175 Ga0495609_0168900 3300046538 Bacteria 924
176 Ga0495668_0014200 3300046616 Bacteria 4678
177 Ga0495668_0801650 3300046616 Bacteria 521
178 Ga0495625_0000080 3300046660 Bacteria 156895
179 Ga0495625_0004500 3300046660 Bacteria 13147
180 Ga0495625_0004973 3300046660 Bacteria 12351
181 Ga0495625_0014986 3300046660 Bacteria 6159
182 Ga0495670_0137671 3300046691 Bacteria 1275
183 Ga0495589_0007600 3300046794 Bacteria 5679
184 Ga0495660_0026333 3300046810 Bacteria 3297
185 Ga0495660_0133304 3300046810 Bacteria 1244
186 Ga0495660_0527168 3300046810 Bacteria 502
187 Ga0495672_0005746 3300047320 Bacteria 9769
188 Ga0495672_0265835 3300047320 Bacteria 826
189 Ga0495673_0000132 3300047469 Bacteria 138001
190 Ga0495681_0059145 3300047470 Bacteria 1773
191 Ga0495686_0003985 3300047472 Bacteria 12361
192 Ga0496101_0191661 3300048904 Unclassified 1578
193 Ga0496115_0032726 3300048918 Bacteria 4103
194 Ga0496115_0085933 3300048918 Bacteria 2566
195 Ga0496123_0210042 3300048926 Bacteria 990
196 Ga0501047_0070288 3300049581 Bacteria 3371
197 Ga0501067_0101519 3300049583 Bacteria 1599
198 Ga0501070_0758215 3300049586 Bacteria 764
199 Ga0501238_004692 3300049671 Bacteria 1715
200 Ga0501035_1308946 3300049822 Bacteria 558
201 nmdc:mga03683_92754_c1 3300050489 Bacteria 1318
202 nmdc:mga0k408_239461_c1 3300050493 Bacteria 1083
203 nmdc:mga0k408_504940_c1 3300050493 Bacteria 716
204 nmdc:mga09592_881726_c1 3300050508 Bacteria 753
205 nmdc:mga0qj67_1040126_c1 3300050509 Unclassified 641
206 nmdc:mga0qj67_285990_c1 3300050509 Bacteria 1336
207 nmdc:mga06r32_104166_c1 3300050510 Bacteria 2786
208 nmdc:mga06r32_125419_c1 3300050510 Bacteria 2535
209 nmdc:mga08y16_941232_c1 3300050511 Bacteria 847
210 nmdc:mga0n895_1356534_c1 3300050512 Bacteria 681
211 nmdc:mga0n895_1863669_c1 3300050512 Unclassified 561
212 nmdc:mga0rr50_390568_c1 3300050513 Bacteria 1174
213 nmdc:mga0rr50_936360_c1 3300050513 Bacteria 739
214 nmdc:mga08x19_677965_c1 3300050514 Unclassified 731
215 nmdc:mga0a205_1073113_c1 3300050515 Bacteria 653
216 nmdc:mga0a205_569118_c1 3300050515 Bacteria 987
217 nmdc:mga0a205_68295_c1 3300050515 Bacteria 3433
218 Ga0500578_0341052 3300053086 Bacteria 878
219 Ga0500556_0000273 3300053104 Bacteria 40555
220 Ga0500614_004320 3300053123 Bacteria 3012
221 Ga0500577_0000624 3300053142 Bacteria 9075
222 Ga0500616_0043630 3300053153 Bacteria 2396
223 Ga0500622_0056974 3300053156 Bacteria 2000
224 Ga0500627_0029606 3300053158 Bacteria 2285
225 Ga0500611_030699 3300053727 Bacteria 1110
226 Ga0500645_015740 3300053730 Bacteria 2391
227 Ga0500609_001668 3300053731 Bacteria 3244
228 2511122750 2510917020 Bacteria 5657507
229 2585153842 2582581280 Bacteria 5994497
230 2585198055 2582581293 Bacteria 5907401
231 2643747838 2643221545 Bacteria 5083237
232 2643778498 2643221552 Bacteria 5708754
233 2643924908 2643221583 Bacteria 5218014
234 2643931348 2643221584 Bacteria 5511711
235 2644511452 2643221691 Bacteria 5093099
236 2819537975 2818991435 Bacteria 5433759
237 2819648464 2818991454 Bacteria 5563326
238 Ga0075434_100080902
239 rootL2_10012959
240 rootL2_10222047
241 Ga0055537_1009870
242 Ga0055524_1004685
243 Ga0055524_1014411
244 Ga0055528_1005829
245 Ga0055531_10012008
246 Ga0065165_1015968
247 Ga0065165_1135143
248 Ga0068869_101227727
249 Ga0070666_10050923
250 Ga0068868_100030389
251 Ga0070660_100349424
252 Ga0070661_100017531
253 Ga0070705_100695382
254 Ga0070700_100544989
255 Ga0070708_100233879
256 Ga0068867_100934566
257 Ga0070706_100260824
258 Ga0070706_100654324
259 Ga0070706_100741685
260 Ga0070707_100132806
261 Ga0070707_100225493
262 Ga0070707_100337041
263 Ga0070707_100899222
264 Ga0070698_100012835
265 Ga0070698_100078249
266 Ga0070698_100109783
267 Ga0070699_101116953
268 Ga0070684_100125692
269 Ga0070697_100009639
270 Ga0070697_100282310
271 Ga0070697_101222744
272 Ga0068853_100086879
273 Ga0070695_101498816
274 Ga0070696_100964595
275 Ga0070665_100003650
276 Ga0068855_100077362
277 Ga0068854_100009225
278 Ga0068856_100062193
279 Ga0068852_100010925
280 Ga0068864_100099185
281 Ga0068864_101177946
282 Ga0068861_101395951
283 Ga0068861_102040252
284 Ga0068851_10006338
285 Ga0068858_100151327
286 Ga0070716_100547395
287 Ga0070716_101247689
288 Ga0075362_10187499
289 Ga0075366_10315568
290 Ga0097621_100225920
291 Ga0075370_10318184
292 Ga0068871_100165462
293 Ga0075428_100249317
294 Ga0075428_100359792
295 Ga0075430_101255978
296 Ga0075431_100097228
297 Ga0075431_100219714
298 Ga0075431_100332489
299 Ga0075433_10024895
300 Ga0075433_10061585
301 Ga0075433_10992004
302 Ga0075434_100046781
303 Ga0075434_101253972
304 Ga0075434_101285701
305 Ga0075434_101355178
306 Ga0075429_101431496
307 Ga0075436_100685004
308 Ga0075435_100586926
309 Ga0075435_101004526
310 Ga0099795_10100130
311 Ga0105240_10170133
312 Ga0111539_10844735
313 Ga0105245_10005017
314 Ga0114129_10103329
315 Ga0114129_12627300
316 Ga0105241_10009163
317 Ga0105242_10004605
318 Ga0105248_10236583
319 Ga0105237_10075415
320 Ga0105237_10295671
321 Ga0105238_10107666
322 Ga0105239_10030345
323 Ga0157374_10004332
324 Ga0163163_10463186
325 Ga0157379_10029584
326 Ga0209565_1002566
327 Ga0209673_1000941
328 Ga0209675_1031330
329 Ga0209564_1008652
330 Ga0209564_1013276
331 Ga0209758_1002304
332 Ga0209758_1011970
333 Ga0209050_1027808
334 Ga0209050_1107862
335 Ga0209256_1000641
336 Ga0209256_1003933
337 Ga0209257_1000350
338 Ga0207656_10076251
339 Ga0207680_10019268
340 Ga0207684_10206664
341 Ga0207684_10538539
342 Ga0207671_10069252
343 Ga0207671_10974482
344 Ga0207649_10000387
345 Ga0207646_10137621
346 Ga0207646_10186236
347 Ga0207646_10235330
348 Ga0207646_10803044
349 Ga0207694_10123642
350 Ga0207687_10004936
351 Ga0207686_10004960
352 Ga0207709_10649397
353 Ga0207669_10758703
354 Ga0207711_10097935
355 Ga0207667_10110751
356 Ga0207640_10044958
357 Ga0207677_10030548
358 Ga0207703_10043867
359 Ga0207639_10000375
360 Ga0207702_10030096
361 Ga0207641_10598978
362 Ga0207648_10596832
363 Ga0207676_10735876
364 Ga0207676_11199030
365 Ga0207674_10082401
366 Ga0209996_1049112
367 Ga0210000_1006274
368 Ga0209974_10089300
369 Ga0268266_10007289
370 Ga0268265_10209392
371 Ga0265337_1003948
372 Ga0265334_10319798
373 Ga0307515_10289553
374 Ga0307515_10843306
375 Ga0307511_10328647
376 Ga0265332_10044994
377 Ga0265320_10003391
378 Ga0307513_10362470
379 Ga0307408_100331628
380 Ga0265314_10443866
381 Ga0373944_0278881
382 Ga0373931_0334944
383 Ga0373935_1061355
384 Ga0373927_0635357
385 Ga0451789_0821929
386 Ga0451855_1108441
387 Ga0451853_0214521
388 Ga0439441_015997
389 Ga0439459_0085758
390 Ga0451577_0026708
391 Ga0453684_0059099
392 Ga0451576_0043910
393 Ga0495627_000218
394 Ga0495638_0008483
395 Ga0495638_0019247
396 Ga0495650_0000007
397 Ga0495650_0096468
398 Ga0495607_0053993
399 Ga0495606_0001606
400 Ga0495610_0007365
401 Ga0495610_0032744
402 Ga0495616_0003953
403 Ga0495616_0189150
404 Ga0495631_0247007
405 Ga0495632_0002841
406 Ga0495632_0239273
407 Ga0495637_0027128
408 Ga0495643_0154883
409 Ga0495643_0209740
410 Ga0495643_0454127
411 Ga0495648_0043601
412 Ga0495609_0168900
413 Ga0495668_0014200
414 Ga0495668_0801650
415 Ga0495625_0000080
416 Ga0495625_0004500
417 Ga0495625_0004973
418 Ga0495625_0014986
419 Ga0495670_0137671
420 Ga0495589_0007600
421 Ga0495660_0026333
422 Ga0495660_0133304
423 Ga0495660_0527168
424 Ga0495672_0005746
425 Ga0495672_0265835
426 Ga0495673_0000132
427 Ga0495681_0059145
428 Ga0495686_0003985
429 Ga0496101_0191661
430 Ga0496115_0032726
431 Ga0496115_0085933
432 Ga0496123_0210042
433 Ga0501047_0070288
434 Ga0501067_0101519
435 Ga0501070_0758215
436 Ga0501238_004692
437 Ga0501035_1308946
438 nmdc:mga03683_92754_c1
439 nmdc:mga0k408_239461_c1
440 nmdc:mga0k408_504940_c1
441 nmdc:mga09592_881726_c1
442 nmdc:mga0qj67_1040126_c1
443 nmdc:mga0qj67_285990_c1
444 nmdc:mga06r32_104166_c1
445 nmdc:mga06r32_125419_c1
446 nmdc:mga08y16_941232_c1
447 nmdc:mga0n895_1356534_c1
448 nmdc:mga0n895_1863669_c1
449 nmdc:mga0rr50_390568_c1
450 nmdc:mga0rr50_936360_c1
451 nmdc:mga08x19_677965_c1
452 nmdc:mga0a205_1073113_c1
453 nmdc:mga0a205_569118_c1
454 nmdc:mga0a205_68295_c1
455 Ga0500578_0341052
456 Ga0500556_0000273
457 Ga0500614_004320
458 Ga0500577_0000624
459 Ga0500616_0043630
460 Ga0500622_0056974
461 Ga0500627_0029606
462 Ga0500611_030699
463 Ga0500645_015740
464 Ga0500609_001668
465 2511122750
466 2585153842
467 2585198055
468 2643747838
469 2643778498
470 2643924908
471 2643931348
472 2644511452
473 2819537975
474 2819648464

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

17

146

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gtg-assembly8.cif.gz_H crystal structure of onion lachrymatory factor synthase (lfs) containing 1,2-propanediol 0.868 1 129
3cnw-assembly1.cif.gz_A three-dimensional structure of the protein xoxi (q81ay6) from bacillus cereus. northeast structural genomics consortium target bcr196. 0.8672 1 126
3f08-assembly1.cif.gz_A crystal structure of the putative uncharacterized protein q6hg14 from bacilllus thuringiensis. northeast structural genomics consortium target bur153. 0.8594 2 129
5gtg-assembly8.cif.gz_H crystal structure of onion lachrymatory factor synthase (lfs) containing 1,2-propanediol 0.8558 1 129
5ygv-assembly1.cif.gz_B crystal structure of the abscisic acid receptor pyr1 in complex with an antagonist 0.8529 2 127
ID Description Score Start End Superfamily
af_Q8T2R4_3_145_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8935 2 126 3.30.530.20
af_I1J4K5_6_173_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8771 2 127 3.30.530.20
af_Q9M073_3_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.863 3 129 3.30.530.20
af_Q8T2R4_3_145_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.855 2 126 3.30.530.20
af_A0A1D6HQJ5_8_161_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8472 3 124 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A1I6EZ97-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 0.9535 1 129
AF-A0A259TEJ4-F1-model_v4 MxaD family protein 0.953 1 129
AF-A0A534U652-F1-model_v4 SRPBCC family protein 0.9527 1 129
AF-A0A1Q9S9Z3-F1-model_v4 Polyketide cyclase 0.9526 1 130
AF-A0A3S0G3G0-F1-model_v4 SRPBCC family protein 0.9513 1 129

Map