F349827

General Info

Members Datasets Scaffolds Average Seq Length
237 173 231 209

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100277305|Ga0070696_1002773052
Length 226
Sequence LTRVSAHPFFNTEIKPAMTQSPQIATGTLKDLGEYVAAALPAEVTRWEIKNRELIVWVARPSIVKLLTYLRDDSHCLFKQLIDICGVDYPEREERFEVVYNLLSLKHNNRIRVKLSTTADEPVPSVVSLFNSANWFEREAWDLYGIFFSDHPDLRRLLTDYGFEGHPFRKDFPLTGYVEVRYDEEQKRVVYDKVKLVQDFRNFDFESPWEGILTRLPGDEKANKPS

Samples

Sample ID Description Type Environment
1 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
2 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
3 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
4 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
5 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
6 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
7 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
62 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300029276 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 Metatranscriptome Rhizosphere
80 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
81 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
95 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
113 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
168 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
169 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
170 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.03
Metatranscriptomes 8.44
Isolates 2.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 0.42
Rhizoplane 0.84
Rhizosphere 92.41
Stem 0
Stem Tuber 0
Unclassified 4.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006759J45824_1034139 3300003163 Bacteria 2715
2 JGI25406J46586_10075341 3300003203 Bacteria 1047
3 Ga0006770J48903_1020507 3300003305 Bacteria 1156
4 Ga0006777J48905_1028079 3300003308 Bacteria 2485
5 Ga0006777J48905_1043474 3300003308 Bacteria 783
6 Ga0007417J51691_1012896 3300003544 Bacteria 3379
7 Ga0007409J51694_1014868 3300003575 Bacteria 845
8 Ga0007416J51690_1016854 3300003577 Bacteria 3260
9 Ga0007416J51690_1041424 3300003577 Bacteria 1447
10 Ga0007429J51699_1044285 3300003579 Bacteria 3002
11 Ga0007429J51699_1051665 3300003579 Bacteria 1001
12 Ga0007415J51800_110894 3300003613 Bacteria 1494
13 Ga0032354_1011279 3300003693 Bacteria 2316
14 Ga0032354_1043440 3300003693 Bacteria 1278
15 Ga0006780_1003147 3300003735 Bacteria 832
16 Ga0070670_100182775 3300005331 Bacteria 1821
17 Ga0070680_100075038 3300005336 Bacteria 2783
18 Ga0070680_100200310 3300005336 Bacteria 1684
19 Ga0070680_100633067 3300005336 Bacteria 919
20 Ga0070668_100563661 3300005347 Bacteria 993
21 Ga0070675_100804057 3300005354 Bacteria 859
22 Ga0070671_100048823 3300005355 Bacteria 3521
23 Ga0070659_100146242 3300005366 Bacteria 1926
24 Ga0070714_100042242 3300005435 Bacteria 3851
25 Ga0070714_100414837 3300005435 Bacteria 1275
26 Ga0070705_100413796 3300005440 Bacteria 1002
27 Ga0070708_100653345 3300005445 Bacteria 991
28 Ga0070681_10001773 3300005458 Bacteria 19357
29 Ga0070681_10025009 3300005458 Bacteria 6008
30 Ga0070706_100547249 3300005467 Bacteria 1077
31 Ga0070698_100160552 3300005471 Bacteria 2191
32 Ga0070679_100000566 3300005530 Bacteria 31366
33 Ga0070679_100115633 3300005530 Bacteria 2668
34 Ga0070679_100193531 3300005530 Bacteria 2002
35 Ga0070686_100500642 3300005544 Bacteria 943
36 Ga0070695_100003892 3300005545 Bacteria 8711
37 Ga0070696_100277305 3300005546 Bacteria 1277
38 Ga0070696_100584430 3300005546 Bacteria 899
39 Ga0070704_100194752 3300005549 Bacteria 1632
40 Ga0070664_100103226 3300005564 Bacteria 2482
41 Ga0068857_100086211 3300005577 Bacteria 2807
42 Ga0068854_100318256 3300005578 Bacteria 1264
43 Ga0068856_100359156 3300005614 Bacteria 1475
44 Ga0081455_10009619 3300005937 Bacteria 9927
45 Ga0081455_10124271 3300005937 Bacteria 2028
46 Ga0081538_10170289 3300005981 Bacteria 951
47 Ga0081539_10003043 3300005985 Bacteria 21704
48 Ga0070712_100756277 3300006175 Bacteria 832
49 Ga0075430_100196539 3300006846 Bacteria 1675
50 Ga0075436_100050798 3300006914 Bacteria 2862
51 Ga0099795_10016385 3300007788 Bacteria 2343
52 Ga0105240_10296061 3300009093 Bacteria 1853
53 Ga0105240_10650531 3300009093 Bacteria 1155
54 Ga0105240_11165309 3300009093 Bacteria 817
55 Ga0105245_10718529 3300009098 Bacteria 1033
56 Ga0105247_10161723 3300009101 Bacteria 1483
57 Ga0105238_10870962 3300009551 Bacteria 918
58 Ga0105238_10943191 3300009551 Bacteria 882
59 Ga0105246_10896089 3300011119 Bacteria 795
60 Ga0157373_10618489 3300013100 Bacteria 789
61 Ga0157370_10012903 3300013104 Bacteria 8636
62 Ga0157370_10653947 3300013104 Bacteria 961
63 Ga0157369_10014395 3300013105 Bacteria 8935
64 Ga0157369_10636700 3300013105 Bacteria 1100
65 Ga0157374_10559517 3300013296 Bacteria 1152
66 Ga0157372_11263792 3300013307 Bacteria 852
67 Ga0163163_10196708 3300014325 Bacteria 2064
68 Ga0182008_10017696 3300014497 Bacteria 3694
69 Ga0157377_10216450 3300014745 Bacteria 1224
70 Ga0157379_10400457 3300014968 Bacteria 1262
71 Ga0213872_10000438 3300021361 Bacteria 34149
72 Ga0213872_10024683 3300021361 Bacteria 2765
73 Ga0256744_121063 3300023309 Bacteria 1509
74 Ga0256720_119521 3300023438 Bacteria 1109
75 Ga0207684_10180136 3300025910 Bacteria 1822
76 Ga0207707_10005089 3300025912 Bacteria 11528
77 Ga0207707_10063182 3300025912 Bacteria 3222
78 Ga0207707_10089521 3300025912 Bacteria 2690
79 Ga0207707_10199001 3300025912 Bacteria 1747
80 Ga0207695_10043406 3300025913 Bacteria 4792
81 Ga0207695_10631854 3300025913 Bacteria 952
82 Ga0207695_10700389 3300025913 Bacteria 893
83 Ga0207660_10022695 3300025917 Bacteria 4230
84 Ga0207660_10142940 3300025917 Bacteria 1831
85 Ga0207657_10266626 3300025919 Bacteria 1362
86 Ga0207652_10034499 3300025921 Bacteria 4264
87 Ga0207652_10062231 3300025921 Bacteria 3225
88 Ga0207646_10515446 3300025922 Bacteria 1077
89 Ga0207646_10707165 3300025922 Bacteria 901
90 Ga0207694_10677027 3300025924 Bacteria 870
91 Ga0207700_10276085 3300025928 Bacteria 1444
92 Ga0207700_10582817 3300025928 Bacteria 995
93 Ga0207664_10012539 3300025929 Bacteria 6065
94 Ga0207644_10090563 3300025931 Bacteria 2279
95 Ga0207690_10087377 3300025932 Bacteria 2194
96 Ga0207679_10077698 3300025945 Bacteria 2526
97 Ga0207667_10062263 3300025949 Bacteria 3902
98 Ga0207702_10291438 3300026078 Bacteria 1546
99 Ga0207702_10669208 3300026078 Bacteria 1022
100 Ga0207674_10047735 3300026116 Bacteria 4387
101 Ga0311004_110740 3300029276 Bacteria 1078
102 Ga0311001_1036824 3300029277 Bacteria 1887
103 Ga0310981_1083745 3300029285 Bacteria 1730
104 Ga0265325_10031292 3300031241 Bacteria 2849
105 Ga0265331_10006009 3300031250 Bacteria 7243
106 Ga0265327_10000984 3300031251 Bacteria 40558
107 Ga0265327_10063791 3300031251 Bacteria 1869
108 Ga0316578_10223633 3300031728 Bacteria 1131
109 Ga0307413_10205203 3300031824 Bacteria 1427
110 Ga0307410_10427687 3300031852 Bacteria 1075
111 Ga0307406_10400022 3300031901 Bacteria 1088
112 Ga0307406_10654968 3300031901 Bacteria 872
113 Ga0307412_10199640 3300031911 Bacteria 1518
114 Ga0307409_100419210 3300031995 Bacteria 1284
115 Ga0307409_100478189 3300031995 Bacteria 1208
116 Ga0307416_100083924 3300032002 Bacteria 2705
117 Ga0307414_10374115 3300032004 Bacteria 1230
118 Ga0307415_100212607 3300032126 Bacteria 1544
119 Ga0373926_0019756 3300035083 Bacteria 2324
120 Ga0373945_0159271 3300035116 Bacteria 919
121 Ga0373954_0312586 3300035118 Bacteria 775
122 Ga0373956_0146533 3300035119 Bacteria 1110
123 Ga0373943_0192953 3300035170 Bacteria 1124
124 Ga0373931_0240204 3300035691 Bacteria 1098
125 Ga0373935_0033751 3300035692 Bacteria 3187
126 Ga0373937_0010201 3300036401 Bacteria 8198
127 Ga0316584_0053014 3300036712 Bacteria 3034
128 Ga0373925_0057365 3300037068 Bacteria 2917
129 Ga0373925_0542962 3300037068 Bacteria 956
130 Ga0395899_0151506 3300037312 Bacteria 1643
131 Ga0395900_0001631 3300037418 Eukaryota 26363
132 Ga0395905_0193821 3300037471 Bacteria 1906
133 Ga0395901_0023738 3300038443 Bacteria 6289
134 Ga0395901_0442212 3300038443 Bacteria 1331
135 Ga0400483_056608 3300039062 Bacteria 1793
136 Ga0400483_065873 3300039062 Bacteria 9918
137 Ga0400483_138571 3300039062 Bacteria 4272
138 Ga0400483_160141 3300039062 Bacteria 1749
139 Ga0400483_267183 3300039062 Bacteria 5073
140 Ga0436365_1229698 3300039437 Bacteria 4344
141 Ga0436365_1342417 3300039437 Bacteria 1208
142 Ga0436360_0437113 3300039438 Bacteria 1177
143 Ga0436360_0558802 3300039438 Bacteria 1150
144 Ga0436361_0039236 3300039447 Bacteria 6399
145 Ga0436361_0207410 3300039447 Bacteria 20395
146 Ga0436362_0363189 3300039453 Bacteria 4228
147 Ga0439447_031378 3300041407 Bacteria 1334
148 Ga0451577_0325834 3300042876 Bacteria 1393
149 Ga0453683_0409104 3300044673 Bacteria 875
150 Ga0466967_0722226 3300045976 Bacteria 987
151 Ga0495592_0001449 3300046454 Eukaryota 16483
152 Ga0495641_0001175 3300046461 Eukaryota 22534
153 Ga0495641_0004989 3300046461 Eukaryota 9158
154 Ga0495651_0253409 3300046462 Eukaryota 1201
155 Ga0495580_0025911 3300046472 Bacteria 4280
156 Ga0495580_0484343 3300046472 Bacteria 827
157 Ga0495594_0269698 3300046499 Bacteria 970
158 Ga0495618_0177079 3300046514 Eukaryota 1356
159 Ga0495630_0148157 3300046517 Bacteria 1785
160 Ga0495652_0510532 3300046529 Eukaryota 832
161 Ga0495665_0331088 3300046531 Bacteria 777
162 Ga0495640_0009975 3300046533 Eukaryota 7361
163 Ga0495586_0037974 3300046535 Bacteria 2585
164 Ga0495622_0090458 3300046557 Bacteria 1406
165 Ga0495667_0030275 3300046559 Bacteria 3639
166 Ga0495668_0247182 3300046616 Bacteria 977
167 Ga0495634_0000182 3300046642 Eukaryota 58130
168 Ga0495634_0114093 3300046642 Bacteria 1735
169 Ga0495657_0000198 3300046675 Eukaryota 53689
170 Ga0495646_0066202 3300046680 Eukaryota 2137
171 Ga0495613_0641365 3300046689 Eukaryota 703
172 Ga0495600_0089656 3300046809 Bacteria 2006
173 Ga0495676_0018864 3300047321 Eukaryota 6079
174 Ga0495676_0038503 3300047321 Eukaryota 3970
175 Ga0495676_0040131 3300047321 Eukaryota 3867
176 Ga0495680_0000164 3300047322 Eukaryota 68506
177 Ga0495602_0001725 3300048088 Eukaryota 21775
178 Ga0495602_0001853 3300048088 Eukaryota 21171
179 Ga0496104_0186637 3300048907 Bacteria 1984
180 Ga0496108_0407646 3300048911 Bacteria 1187
181 Ga0501318_010486 3300049534 Bacteria 1029
182 Ga0501034_0233237 3300049571 Bacteria 1788
183 Ga0501036_0098346 3300049572 Bacteria 2474
184 Ga0501038_0000129 3300049574 Bacteria 64365
185 Ga0501038_0343943 3300049574 Bacteria 1163
186 Ga0501039_0342081 3300049575 Bacteria 1176
187 Ga0501040_0014627 3300049576 Bacteria 5175
188 Ga0501040_0371787 3300049576 Bacteria 1025
189 Ga0501041_0025253 3300049577 Bacteria 3571
190 Ga0501041_0034487 3300049577 Bacteria 3064
191 Ga0501042_0024518 3300049578 Bacteria 4231
192 Ga0501042_0389848 3300049578 Bacteria 1009
193 Ga0501043_0264138 3300049579 Bacteria 1323
194 Ga0501048_0203124 3300049582 Bacteria 1405
195 Ga0501070_0133636 3300049586 Bacteria 2049
196 Ga0501071_0032082 3300049587 Bacteria 3728
197 Ga0501072_0006548 3300049588 Bacteria 8871
198 Ga0501072_0359469 3300049588 Bacteria 1156
199 Ga0501074_0348314 3300049590 Bacteria 1051
200 Ga0501075_0008891 3300049591 Bacteria 7006
201 Ga0501075_0048199 3300049591 Bacteria 3202
202 Ga0501076_0013404 3300049592 Bacteria 6147
203 Ga0501076_0018603 3300049592 Bacteria 5299
204 Ga0501076_0471838 3300049592 Bacteria 1034
205 Ga0501077_0013102 3300049593 Bacteria 5196
206 Ga0501083_0008097 3300049744 Bacteria 7433
207 Ga0501083_0229621 3300049744 Bacteria 1209
208 Ga0501035_0038795 3300049822 Bacteria 4312
209 Ga0501044_0274181 3300049823 Bacteria 1622
210 Ga0501044_0626090 3300049823 Bacteria 967
211 Ga0501045_0006993 3300049824 Bacteria 7824
212 Ga0501045_0376899 3300049824 Bacteria 1056
213 nmdc:mga03683_31457_c1 3300050489 Bacteria 2129
214 nmdc:mga0qj67_906864_c1 3300050509 Bacteria 694
215 nmdc:mga08x19_52143_c1 3300050514 Bacteria 2630
216 Ga0495601_0052111 3300053077 Bacteria 2583
217 Ga0495619_0079301 3300053085 Bacteria 2208
218 Ga0500647_0140216 3300053091 Bacteria 1135
219 Ga0500642_0005998 3300053130 Bacteria 3966
220 Ga0500588_0002135 3300053146 Bacteria 3953
221 Ga0500609_016111 3300053731 Bacteria 1014
222 Ga0501084_0040130 3300054114 Bacteria 3915
223 Ga0501084_0113818 3300054114 Bacteria 2274
224 Ga0501084_0167464 3300054114 Bacteria 1855
225 Ga0501084_0819351 3300054114 Bacteria 784
226 Ga0501082_0021320 3300060353 Bacteria 5590
227 Ga0501082_0079342 3300060353 Bacteria 2832
228 Ga0501082_0160391 3300060353 Bacteria 1954
229 Ga0501082_0738218 3300060353 Bacteria 862
230 Ga0530510_0310193 3300061734 Bacteria 1182
231 Ga0530510_0332876 3300061734 Bacteria 1139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_10515446 Ga0207646_105154462 177
2 3300046689 Ga0495613_0641365 Ga0495613_0641365_125_676 178
3 3300044673 Ga0453683_0409104 Ga0453683_0409104_302_865 184
4 3300046454 Ga0495592_0001449 Ga0495592_0001449_4469_5047 184
5 3300046461 Ga0495641_0004989 Ga0495641_0004989_1712_2290 184
6 3300046529 Ga0495652_0510532 Ga0495652_0510532_130_708 184
7 3300047321 Ga0495676_0038503 Ga0495676_0038503_2322_2900 184
8 3300048088 Ga0495602_0001725 Ga0495602_0001725_6783_7361 184
9 3300031824 Ga0307413_10205203 Ga0307413_102052032 185
10 3300031852 Ga0307410_10427687 Ga0307410_104276872 185
11 3300031901 Ga0307406_10400022 Ga0307406_104000222 185
12 3300031911 Ga0307412_10199640 Ga0307412_101996402 185
13 3300032002 Ga0307416_100083924 Ga0307416_1000839242 185
14 3300032126 Ga0307415_100212607 Ga0307415_1002126072 185
15 3300046616 Ga0495668_0247182 Ga0495668_0247182_23_580 185
16 3300053091 Ga0500647_0140216 Ga0500647_0140216_30_662 185
17 3300053731 Ga0500609_016111 Ga0500609_016111_137_784 185
18 3300039438 Ga0436360_0558802 Ga0436360_0558802_380_1048 187
19 3300053146 Ga0500588_0002135 Ga0500588_0002135_1049_1696 188
20 3300048911 Ga0496108_0407646 Ga0496108_0407646_13_591 190
21 3300046533 Ga0495640_0009975 Ga0495640_0009975_2302_2925 191
22 3300046642 Ga0495634_0000182 Ga0495634_0000182_13956_14579 191
23 3300046675 Ga0495657_0000198 Ga0495657_0000198_13982_14605 191
24 3300047322 Ga0495680_0000164 Ga0495680_0000164_13972_14595 191
25 3300037418 Ga0395900_0001631 Ga0395900_0001631_13188_13784 195
26 3300047321 Ga0495676_0040131 Ga0495676_0040131_2760_3416 196
27 3300003203 JGI25406J46586_10075341 JGI25406J46586_100753412 199
28 3300005564 Ga0070664_100103226 Ga0070664_1001032263 199
29 3300005578 Ga0068854_100318256 Ga0068854_1003182562 199
30 3300005985 Ga0081539_10003043 Ga0081539_1000304322 199
31 3300009551 Ga0105238_10870962 Ga0105238_108709622 199
32 3300025945 Ga0207679_10077698 Ga0207679_100776983 199
33 3300031250 Ga0265331_10006009 Ga0265331_100060094 199
34 3300046680 Ga0495646_0066202 Ga0495646_0066202_284_970 199
35 3300005435 Ga0070714_100042242 Ga0070714_1000422422 200
36 3300005937 Ga0081455_10124271 Ga0081455_101242712 200
37 3300025929 Ga0207664_10012539 Ga0207664_100125396 200
38 3300050489 nmdc:mga03683_31457_c1 nmdc:mga03683_31457_c1_407_1009 200
39 3300005336 Ga0070680_100633067 Ga0070680_1006330672 201
40 3300009098 Ga0105245_10718529 Ga0105245_107185292 201
41 3300025912 Ga0207707_10199001 Ga0207707_101990012 201
42 3300025922 Ga0207646_10707165 Ga0207646_107071652 201
43 3300025924 Ga0207694_10677027 Ga0207694_106770272 201
44 3300046461 Ga0495641_0001175 Ga0495641_0001175_20706_21368 201
45 3300046462 Ga0495651_0253409 Ga0495651_0253409_386_1048 201
46 3300046514 Ga0495618_0177079 Ga0495618_0177079_98_760 201
47 3300046517 Ga0495630_0148157 Ga0495630_0148157_507_1139 201
48 3300046531 Ga0495665_0331088 Ga0495665_0331088_98_703 201
49 3300047321 Ga0495676_0018864 Ga0495676_0018864_3164_3826 201
50 3300048088 Ga0495602_0001853 Ga0495602_0001853_7649_8311 201
51 3300005467 Ga0070706_100547249 Ga0070706_1005472492 202
52 3300009101 Ga0105247_10161723 Ga0105247_101617232 202
53 3300013307 Ga0157372_11263792 Ga0157372_112637921 202
54 3300014325 Ga0163163_10196708 Ga0163163_101967082 202
55 3300014968 Ga0157379_10400457 Ga0157379_104004572 202
56 3300021361 Ga0213872_10000438 Ga0213872_100004385 202
57 3300025910 Ga0207684_10180136 Ga0207684_101801363 202
58 3300039438 Ga0436360_0437113 Ga0436360_0437113_177_785 202
59 3300039447 Ga0436361_0207410 Ga0436361_0207410_15239_15856 202
60 3300049744 Ga0501083_0229621 Ga0501083_0229621_353_961 202
61 3300053130 Ga0500642_0005998 Ga0500642_0005998_311_928 202
62 3300005336 Ga0070680_100075038 Ga0070680_1000750382 203
63 3300005458 Ga0070681_10025009 Ga0070681_100250093 203
64 3300005471 Ga0070698_100160552 Ga0070698_1001605523 203
65 3300005530 Ga0070679_100000566 Ga0070679_10000056614 203
66 3300005546 Ga0070696_100277305 Ga0070696_1002773052 203
67 3300005546 Ga0070696_100584430 Ga0070696_1005844302 203
68 3300005981 Ga0081538_10170289 Ga0081538_101702891 203
69 3300009093 Ga0105240_11165309 Ga0105240_111653091 203
70 3300013100 Ga0157373_10618489 Ga0157373_106184891 203
71 3300013104 Ga0157370_10012903 Ga0157370_100129036 203
72 3300013105 Ga0157369_10636700 Ga0157369_106367002 203
73 3300025912 Ga0207707_10005089 Ga0207707_1000508914 203
74 3300025913 Ga0207695_10043406 Ga0207695_100434062 203
75 3300025917 Ga0207660_10022695 Ga0207660_100226952 203
76 3300025921 Ga0207652_10034499 Ga0207652_100344997 203
77 3300031241 Ga0265325_10031292 Ga0265325_100312922 203
78 3300037312 Ga0395899_0151506 Ga0395899_0151506_412_1038 203
79 3300037471 Ga0395905_0193821 Ga0395905_0193821_224_868 203
80 3300038443 Ga0395901_0442212 Ga0395901_0442212_251_862 203
81 3300049576 Ga0501040_0371787 Ga0501040_0371787_194_826 203
82 3300049578 Ga0501042_0389848 Ga0501042_0389848_216_848 203
83 3300049592 Ga0501076_0471838 Ga0501076_0471838_221_853 203
84 3300049744 Ga0501083_0008097 Ga0501083_0008097_5563_6192 203
85 3300060353 Ga0501082_0079342 Ga0501082_0079342_200_829 203
86 3300061734 Ga0530510_0310193 Ga0530510_0310193_143_775 203
87 iso_pu_bacteria 2883291878 2883294308 203
88 iso_pu_bacteria 2883354860 2883357168 203
89 3300005435 Ga0070714_100414837 Ga0070714_1004148372 204
90 3300005445 Ga0070708_100653345 Ga0070708_1006533452 204
91 3300005937 Ga0081455_10009619 Ga0081455_100096196 204
92 3300006914 Ga0075436_100050798 Ga0075436_1000507982 204
93 3300009093 Ga0105240_10296061 Ga0105240_102960612 204
94 3300009551 Ga0105238_10943191 Ga0105238_109431912 204
95 3300025913 Ga0207695_10631854 Ga0207695_106318542 204
96 3300025949 Ga0207667_10062263 Ga0207667_100622633 204
97 3300026078 Ga0207702_10669208 Ga0207702_106692082 204
98 3300031728 Ga0316578_10223633 Ga0316578_102236332 204
99 3300036712 Ga0316584_0053014 Ga0316584_0053014_979_1629 204
100 3300037068 Ga0373925_0542962 Ga0373925_0542962_174_788 204
101 3300039062 Ga0400483_056608 Ga0400483_056608_685_1326 204
102 3300039062 Ga0400483_065873 Ga0400483_065873_7891_8532 204
103 3300039062 Ga0400483_138571 Ga0400483_138571_1878_2519 204
104 3300039062 Ga0400483_160141 Ga0400483_160141_776_1417 204
105 3300039062 Ga0400483_267183 Ga0400483_267183_2594_3235 204
106 3300046472 Ga0495580_0484343 Ga0495580_0484343_18_632 204
107 3300049572 Ga0501036_0098346 Ga0501036_0098346_1729_2352 204
108 3300049574 Ga0501038_0343943 Ga0501038_0343943_151_774 204
109 3300049577 Ga0501041_0034487 Ga0501041_0034487_1334_1957 204
110 3300049591 Ga0501075_0048199 Ga0501075_0048199_843_1466 204
111 3300049592 Ga0501076_0013404 Ga0501076_0013404_1319_1942 204
112 3300049824 Ga0501045_0376899 Ga0501045_0376899_67_690 204
113 3300050514 nmdc:mga08x19_52143_c1 nmdc:mga08x19_52143_c1_1138_1752 204
114 3300054114 Ga0501084_0113818 Ga0501084_0113818_511_1134 204
115 3300060353 Ga0501082_0160391 Ga0501082_0160391_359_982 204
116 3300061734 Ga0530510_0332876 Ga0530510_0332876_104_727 204
117 3300031251 Ga0265327_10000984 Ga0265327_1000098423 205
118 3300035691 Ga0373931_0240204 Ga0373931_0240204_375_1007 205
119 3300049586 Ga0501070_0133636 Ga0501070_0133636_213_869 205
120 3300049823 Ga0501044_0274181 Ga0501044_0274181_835_1491 205
121 iso_pu_bacteria 2597490356 2599101445 205
122 iso_pu_bacteria 2846952575 2846953831 205
123 iso_pu_bacteria 2848858292 2848859985 205
124 3300021361 Ga0213872_10024683 Ga0213872_100246834 206
125 3300039447 Ga0436361_0039236 Ga0436361_0039236_1917_2540 206
126 3300049571 Ga0501034_0233237 Ga0501034_0233237_439_1062 206
127 3300035119 Ga0373956_0146533 Ga0373956_0146533_123_767 207
128 3300046499 Ga0495594_0269698 Ga0495594_0269698_316_945 207
129 3300049588 Ga0501072_0359469 Ga0501072_0359469_100_729 207
130 3300005336 Ga0070680_100200310 Ga0070680_1002003102 208
131 3300005366 Ga0070659_100146242 Ga0070659_1001462422 208
132 3300005530 Ga0070679_100193531 Ga0070679_1001935312 208
133 3300005577 Ga0068857_100086211 Ga0068857_1000862116 208
134 3300006175 Ga0070712_100756277 Ga0070712_1007562771 208
135 3300009093 Ga0105240_10650531 Ga0105240_106505312 208
136 3300013104 Ga0157370_10653947 Ga0157370_106539472 208
137 3300013105 Ga0157369_10014395 Ga0157369_100143958 208
138 3300013296 Ga0157374_10559517 Ga0157374_105595172 208
139 3300014497 Ga0182008_10017696 Ga0182008_100176967 208
140 3300025912 Ga0207707_10063182 Ga0207707_100631822 208
141 3300025913 Ga0207695_10700389 Ga0207695_107003892 208
142 3300025917 Ga0207660_10142940 Ga0207660_101429404 208
143 3300025919 Ga0207657_10266626 Ga0207657_102666262 208
144 3300025921 Ga0207652_10062231 Ga0207652_100622313 208
145 3300025928 Ga0207700_10276085 Ga0207700_102760852 208
146 3300025932 Ga0207690_10087377 Ga0207690_100873772 208
147 3300026116 Ga0207674_10047735 Ga0207674_100477352 208
148 3300035118 Ga0373954_0312586 Ga0373954_0312586_87_734 208
149 3300036401 Ga0373937_0010201 Ga0373937_0010201_2861_3508 208
150 3300038443 Ga0395901_0023738 Ga0395901_0023738_5409_6050 208
151 3300039437 Ga0436365_1342417 Ga0436365_1342417_452_1114 208
152 3300045976 Ga0466967_0722226 Ga0466967_0722226_58_714 208
153 3300046535 Ga0495586_0037974 Ga0495586_0037974_685_1317 208
154 3300046557 Ga0495622_0090458 Ga0495622_0090458_215_853 208
155 3300046559 Ga0495667_0030275 Ga0495667_0030275_1870_2502 208
156 3300046642 Ga0495634_0114093 Ga0495634_0114093_649_1281 208
157 3300046809 Ga0495600_0089656 Ga0495600_0089656_719_1351 208
158 3300049574 Ga0501038_0000129 Ga0501038_0000129_35513_36154 208
159 3300049575 Ga0501039_0342081 Ga0501039_0342081_377_1030 208
160 3300049576 Ga0501040_0014627 Ga0501040_0014627_3753_4406 208
161 3300049577 Ga0501041_0025253 Ga0501041_0025253_12_665 208
162 3300049578 Ga0501042_0024518 Ga0501042_0024518_3451_4104 208
163 3300049579 Ga0501043_0264138 Ga0501043_0264138_304_957 208
164 3300049582 Ga0501048_0203124 Ga0501048_0203124_417_1070 208
165 3300049587 Ga0501071_0032082 Ga0501071_0032082_1036_1689 208
166 3300049588 Ga0501072_0006548 Ga0501072_0006548_4580_5233 208
167 3300049590 Ga0501074_0348314 Ga0501074_0348314_276_929 208
168 3300049591 Ga0501075_0008891 Ga0501075_0008891_4511_5164 208
169 3300049592 Ga0501076_0018603 Ga0501076_0018603_4423_5076 208
170 3300049593 Ga0501077_0013102 Ga0501077_0013102_4390_5043 208
171 3300049822 Ga0501035_0038795 Ga0501035_0038795_3615_4268 208
172 3300049823 Ga0501044_0626090 Ga0501044_0626090_277_930 208
173 3300049824 Ga0501045_0006993 Ga0501045_0006993_4517_5170 208
174 3300053077 Ga0495601_0052111 Ga0495601_0052111_224_856 208
175 3300053085 Ga0495619_0079301 Ga0495619_0079301_1480_2112 208
176 3300054114 Ga0501084_0040130 Ga0501084_0040130_249_902 208
177 3300054114 Ga0501084_0819351 Ga0501084_0819351_44_697 208
178 3300060353 Ga0501082_0021320 Ga0501082_0021320_1423_2076 208
179 3300060353 Ga0501082_0738218 Ga0501082_0738218_64_717 208
180 3300005355 Ga0070671_100048823 Ga0070671_1000488233 209
181 3300005458 Ga0070681_10001773 Ga0070681_1000177314 209
182 3300005530 Ga0070679_100115633 Ga0070679_1001156333 209
183 3300005614 Ga0068856_100359156 Ga0068856_1003591562 209
184 3300007788 Ga0099795_10016385 Ga0099795_100163852 209
185 3300025912 Ga0207707_10089521 Ga0207707_100895213 209
186 3300025928 Ga0207700_10582817 Ga0207700_105828172 209
187 3300025931 Ga0207644_10090563 Ga0207644_100905632 209
188 3300026078 Ga0207702_10291438 Ga0207702_102914383 209
189 3300031251 Ga0265327_10063791 Ga0265327_100637912 209
190 3300035083 Ga0373926_0019756 Ga0373926_0019756_536_1171 209
191 3300035116 Ga0373945_0159271 Ga0373945_0159271_273_908 209
192 3300035692 Ga0373935_0033751 Ga0373935_0033751_2047_2682 209
193 3300037068 Ga0373925_0057365 Ga0373925_0057365_67_702 209
194 3300039437 Ga0436365_1229698 Ga0436365_1229698_564_1217 209
195 3300039453 Ga0436362_0363189 Ga0436362_0363189_2338_2991 209
196 3300046472 Ga0495580_0025911 Ga0495580_0025911_576_1211 209
197 3300048907 Ga0496104_0186637 Ga0496104_0186637_553_1188 209
198 iso_pu_bacteria 2842333319 2842334887 209
199 3300005331 Ga0070670_100182775 Ga0070670_1001827752 210
200 3300005347 Ga0070668_100563661 Ga0070668_1005636612 210
201 3300005354 Ga0070675_100804057 Ga0070675_1008040571 210
202 3300005544 Ga0070686_100500642 Ga0070686_1005006421 210
203 3300011119 Ga0105246_10896089 Ga0105246_108960891 210
204 3300014745 Ga0157377_10216450 Ga0157377_102164502 210
205 3300035170 Ga0373943_0192953 Ga0373943_0192953_242_898 210
206 3300005440 Ga0070705_100413796 Ga0070705_1004137961 211
207 3300005545 Ga0070695_100003892 Ga0070695_1000038928 211
208 3300005549 Ga0070704_100194752 Ga0070704_1001947521 211
209 3300042876 Ga0451577_0325834 Ga0451577_0325834_592_1245 211
210 3300054114 Ga0501084_0167464 Ga0501084_0167464_117_770 211
211 3300003163 Ga0006759J45824_1034139 Ga0006759J45824_10341391 213
212 3300003305 Ga0006770J48903_1020507 Ga0006770J48903_10205071 213
213 3300003308 Ga0006777J48905_1028079 Ga0006777J48905_10280791 213
214 3300003308 Ga0006777J48905_1043474 Ga0006777J48905_10434741 213
215 3300003544 Ga0007417J51691_1012896 Ga0007417J51691_10128961 213
216 3300003575 Ga0007409J51694_1014868 Ga0007409J51694_10148681 213
217 3300003577 Ga0007416J51690_1016854 Ga0007416J51690_10168541 213
218 3300003577 Ga0007416J51690_1041424 Ga0007416J51690_10414242 213
219 3300003579 Ga0007429J51699_1044285 Ga0007429J51699_10442851 213
220 3300003579 Ga0007429J51699_1051665 Ga0007429J51699_10516652 213
221 3300003613 Ga0007415J51800_110894 Ga0007415J51800_1108941 213
222 3300003693 Ga0032354_1011279 Ga0032354_10112791 213
223 3300003693 Ga0032354_1043440 Ga0032354_10434402 213
224 3300003735 Ga0006780_1003147 Ga0006780_10031471 213
225 3300006846 Ga0075430_100196539 Ga0075430_1001965392 213
226 3300023309 Ga0256744_121063 Ga0256744_1210632 213
227 3300023438 Ga0256720_119521 Ga0256720_1195212 213
228 3300029276 Ga0311004_110740 Ga0311004_1107402 213
229 3300029277 Ga0311001_1036824 Ga0311001_10368242 213
230 3300029285 Ga0310981_1083745 Ga0310981_10837452 213
231 3300031901 Ga0307406_10654968 Ga0307406_106549682 213
232 3300031995 Ga0307409_100419210 Ga0307409_1004192102 213
233 3300031995 Ga0307409_100478189 Ga0307409_1004781892 213
234 3300032004 Ga0307414_10374115 Ga0307414_103741152 213
235 3300041407 Ga0439447_031378 Ga0439447_031378_198_851 213
236 3300049534 Ga0501318_010486 Ga0501318_010486_125_766 213
237 3300050509 nmdc:mga0qj67_906864_c1 nmdc:mga0qj67_906864_c1_40_681 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00329

Complex1_30kDa

Respiratory-chain NADH dehydrogenase, 30 Kd subunit

56

178

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mcr-assembly1.cif.gz_A crystal structure of nadh dehydrogenase subunit c (tfu_2693) from thermobifida fusca yx-er1 at 2.65 a resolution 0.9202 3 132
7z0t-assembly1.cif.gz_E structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) 0.8231 7 150
7p7l-assembly1.cif.gz_C complex i from e. coli, ddm/lmng-purified, with nadh and fmn, open state 0.818 9 150
7z83-assembly1.cif.gz_C complex i from e. coli, ddm/lmng-purified, under turnover at ph 8, open state 0.8103 8 150
7p7e-assembly1.cif.gz_C complex i from e. coli, ddm/lmng-purified, apo, resting state 0.8054 11 150
ID Description Score Start End Superfamily
af_Q9VZU4_36_188_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9941 4 133 3.30.460.80
af_A0A1D8PJ73_47_194_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9851 4 133 3.30.460.80
af_A0A2P2CLF6_6_131_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9677 11 133 3.30.460.80
af_P22237_2_142_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9552 4 133 3.30.460.80
af_A0A2P2CLF6_6_131_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9379 11 133 3.30.460.80
ID Description Score Start End GO Terms
AF-A0A7R9MNB3-F1-model_v4 NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial 0.9963 4 100 GO:0008137
AF-A0A5N7YEC3-F1-model_v4 deleted 0.9953 2 94
AF-A0A161MLK0-F1-model_v4 NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial 0.9939 4 121 GO:0008137
AF-A0A1B6KPT8-F1-model_v4 NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial 0.9935 4 127 GO:0008137
AF-A0A527FMD3-F1-model_v4 NADH-quinone oxidoreductase subunit C (EC 1.6.5.11) 0.9933 55 126 GO:0008137

Feature Viewer

pLDDT pTM Quality
77.16 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map