F349130

General Info

Members Datasets Scaffolds Average Seq Length
236 174 236 100

Family's Representative Sequence

Representative Sequence 3300022467|Ga0224712_10520293|Ga0224712_105202932
Length 98
Sequence MRPIHIARLDKVRPVLILTRELVRPHLTTVTIAPITTIRGLSTEVPVNAANGLAGPSVVSCDNVTTIPTTALGEQIGVLLGHQEQTLSDAISAAFDLD

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
96 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
97 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
98 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
99 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
170 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
171 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
172 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.88
Metatranscriptomes 2.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 5.51
Rhizosphere 87.29
Stem 0
Stem Tuber 0
Unclassified 5.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10032101 3300003911 Bacteria 1093
2 Ga0068869_100400346 3300005334 Bacteria 1129
3 Ga0070689_100747038 3300005340 Bacteria 857
4 Ga0070661_100518264 3300005344 Unclassified 956
5 Ga0070675_100186526 3300005354 Bacteria 1795
6 Ga0070674_100133692 3300005356 Bacteria 1853
7 Ga0070688_100250927 3300005365 Bacteria 1260
8 Ga0070709_10485443 3300005434 Unclassified 936
9 Ga0070714_100000171 3300005435 Bacteria 52666
10 Ga0070714_100113386 3300005435 Bacteria 2404
11 Ga0070714_100315320 3300005435 Bacteria 1461
12 Ga0070714_100823229 3300005435 Bacteria 900
13 Ga0070713_100447358 3300005436 Bacteria 1213
14 Ga0070710_10000003 3300005437 Bacteria 277772
15 Ga0070710_10062797 3300005437 Bacteria 2120
16 Ga0070711_100067076 3300005439 Bacteria 2516
17 Ga0070708_100008527 3300005445 Bacteria 8235
18 Ga0070708_100111882 3300005445 Bacteria 2510
19 Ga0068867_100456372 3300005459 Bacteria 1090
20 Ga0070685_10373618 3300005466 Bacteria 980
21 Ga0070706_100006823 3300005467 Bacteria 10779
22 Ga0070706_100184429 3300005467 Bacteria 1949
23 Ga0070707_100005629 3300005468 Bacteria 11708
24 Ga0070698_100047387 3300005471 Bacteria 4394
25 Ga0070684_100896337 3300005535 Bacteria 831
26 Ga0070684_100973393 3300005535 Unclassified 796
27 Ga0070704_100823054 3300005549 Bacteria 831
28 Ga0068857_100379379 3300005577 Unclassified 1313
29 Ga0068856_100334640 3300005614 Unclassified 1532
30 Ga0068856_101104696 3300005614 Bacteria 810
31 Ga0068852_102433288 3300005616 Bacteria 544
32 Ga0068859_100027844 3300005617 Bacteria 5668
33 Ga0068859_100577553 3300005617 Bacteria 1218
34 Ga0068864_100032601 3300005618 Bacteria 4427
35 Ga0068864_100890525 3300005618 Bacteria 878
36 Ga0068870_10931970 3300005840 Bacteria 615
37 Ga0068863_100156561 3300005841 Unclassified 2181
38 Ga0068863_101591126 3300005841 Bacteria 662
39 Ga0068860_101529004 3300005843 Bacteria 689
40 Ga0068862_100253947 3300005844 Bacteria 1603
41 Ga0081455_10000126 3300005937 Bacteria 88702
42 Ga0081540_1005923 3300005983 Bacteria 9023
43 Ga0081540_1103659 3300005983 Bacteria 1219
44 Ga0081540_1240923 3300005983 Bacteria 634
45 Ga0070717_10000005 3300006028 Bacteria 357819
46 Ga0075363_100489766 3300006048 Bacteria 729
47 Ga0075428_100005123 3300006844 Bacteria 14564
48 Ga0075428_100026194 3300006844 Bacteria 6457
49 Ga0075430_100001516 3300006846 Bacteria 18950
50 Ga0075430_100001738 3300006846 Bacteria 17797
51 Ga0075430_100002259 3300006846 Bacteria 15963
52 Ga0075431_100002814 3300006847 Bacteria 16835
53 Ga0075431_100050313 3300006847 Bacteria 4297
54 Ga0075429_100003015 3300006880 Bacteria 14277
55 Ga0075429_100093586 3300006880 Bacteria 2621
56 Ga0097620_100027844 3300006931 Bacteria 5668
57 Ga0097620_100577481 3300006931 Bacteria 1218
58 Ga0105240_10128459 3300009093 Bacteria 3043
59 Ga0105247_10041315 3300009101 Bacteria 2822
60 Ga0114129_10005409 3300009147 Bacteria 18033
61 Ga0114129_10013849 3300009147 Bacteria 11489
62 Ga0114129_10294762 3300009147 Bacteria 2164
63 Ga0114129_12380967 3300009147 Bacteria 634
64 Ga0105248_10038713 3300009177 Bacteria 5338
65 Ga0105237_10420518 3300009545 Unclassified 1342
66 Ga0105249_10866870 3300009553 Bacteria 969
67 Ga0105239_10092118 3300010375 Bacteria 3345
68 Ga0105239_10303551 3300010375 Bacteria 1798
69 Ga0105239_13040338 3300010375 Bacteria 547
70 Ga0105246_10002524 3300011119 Bacteria 11065
71 Ga0163163_10003396 3300014325 Bacteria 13523
72 Ga0163163_10606191 3300014325 Bacteria 1158
73 Ga0163163_12682402 3300014325 Bacteria 555
74 Ga0157377_11031534 3300014745 Bacteria 625
75 Ga0157377_11469784 3300014745 Bacteria 540
76 Ga0157379_10491725 3300014968 Unclassified 1136
77 Ga0157376_10190226 3300014969 Bacteria 1882
78 Ga0206349_1373827 3300020075 Bacteria 1556
79 Ga0213876_10006054 3300021384 Bacteria 6612
80 Ga0224712_10317710 3300022467 Bacteria 731
81 Ga0224712_10520293 3300022467 Bacteria 576
82 Ga0207692_10000016 3300025898 Bacteria 86771
83 Ga0207710_10000072 3300025900 Bacteria 150638
84 Ga0207684_10171307 3300025910 Bacteria 1871
85 Ga0207695_10197560 3300025913 Bacteria 1927
86 Ga0207663_10058504 3300025916 Bacteria 2433
87 Ga0207646_10062362 3300025922 Bacteria 3328
88 Ga0207659_10246394 3300025926 Bacteria 1448
89 Ga0207700_10380105 3300025928 Bacteria 1235
90 Ga0207664_10000004 3300025929 Bacteria 493014
91 Ga0207664_10089636 3300025929 Bacteria 2519
92 Ga0207664_11036472 3300025929 Bacteria 735
93 Ga0207670_10054103 3300025936 Bacteria 2707
94 Ga0207711_10642386 3300025941 Unclassified 990
95 Ga0207661_10001766 3300025944 Bacteria 14792
96 Ga0207661_10216321 3300025944 Bacteria 1691
97 Ga0207712_10235024 3300025961 Bacteria 1473
98 Ga0207677_12169696 3300026023 Unclassified 517
99 Ga0207702_10841553 3300026078 Unclassified 908
100 Ga0207702_10898251 3300026078 Bacteria 878
101 Ga0207702_10948262 3300026078 Unclassified 853
102 Ga0207641_10896644 3300026088 Unclassified 880
103 Ga0207641_11515429 3300026088 Unclassified 672
104 Ga0207648_10302181 3300026089 Bacteria 1435
105 Ga0207676_10189540 3300026095 Bacteria 1808
106 Ga0207676_10684770 3300026095 Bacteria 992
107 Ga0207674_10112137 3300026116 Unclassified 2701
108 Ga0207675_101882813 3300026118 Bacteria 617
109 Ga0268265_10087510 3300028380 Bacteria 2479
110 Ga0265326_10000006 3300028558 Bacteria 233392
111 Ga0265326_10017048 3300028558 Bacteria 2098
112 Ga0265319_1000622 3300028563 Bacteria 23344
113 Ga0265334_10330324 3300028573 Bacteria 521
114 Ga0265318_10126234 3300028577 Bacteria 941
115 Ga0265338_10000961 3300028800 Bacteria 48623
116 Ga0265338_10042139 3300028800 Bacteria 4257
117 Ga0265338_10214977 3300028800 Bacteria 1440
118 Ga0265324_10002560 3300029957 Bacteria 9186
119 Ga0307511_10393303 3300030521 Bacteria 573
120 Ga0265327_10181770 3300031251 Bacteria 961
121 Ga0307408_102205459 3300031548 Bacteria 532
122 Ga0307508_10077552 3300031616 Bacteria 2902
123 Ga0307412_10696246 3300031911 Bacteria 872
124 Ga0307409_101148870 3300031995 Bacteria 799
125 Ga0307409_102319671 3300031995 Bacteria 566
126 Ga0307416_100835356 3300032002 Bacteria 1019
127 Ga0307416_102351253 3300032002 Bacteria 633
128 Ga0307510_10164958 3300033180 Bacteria 1805
129 Ga0373935_0384985 3300035692 Bacteria 1005
130 Ga0372808_004315 3300036459 Bacteria 1807
131 Ga0395900_0119747 3300037418 Bacteria 2702
132 Ga0436364_1031756 3300037853 Bacteria 1056
133 Ga0395901_0157012 3300038443 Bacteria 2389
134 Ga0436365_1083994 3300039437 Bacteria 225582
135 Ga0436360_1115329 3300039438 Unclassified 785
136 Ga0451797_0180343 3300041453 Bacteria 660
137 Ga0451795_0867361 3300041456 Bacteria 658
138 Ga0451807_0450893 3300041486 Bacteria 612
139 Ga0451843_0871014 3300041509 Unclassified 901
140 Ga0466965_0646252 3300044683 Bacteria 604
141 Ga0466963_0021084 3300044694 Bacteria 4106
142 Ga0466963_1059660 3300044694 Bacteria 570
143 Ga0466963_1305070 3300044694 Bacteria 509
144 Ga0466960_0214997 3300044901 Bacteria 1056
145 Ga0466960_0273924 3300044901 Bacteria 944
146 Ga0466960_1008094 3300044901 Unclassified 512
147 Ga0466967_0013978 3300045976 Bacteria 6231
148 Ga0466967_0021069 3300045976 Bacteria 5282
149 Ga0466967_1960428 3300045976 Bacteria 582
150 Ga0495590_0364226 3300046457 Unclassified 551
151 Ga0495629_0075832 3300046459 Bacteria 2348
152 Ga0495639_0101647 3300046475 Bacteria 1358
153 Ga0495662_0028078 3300046476 Bacteria 2716
154 Ga0495583_0170565 3300046506 Bacteria 894
155 Ga0495608_0068063 3300046511 Bacteria 2329
156 Ga0495630_0200160 3300046517 Bacteria 1524
157 Ga0495665_0402043 3300046531 Bacteria 695
158 Ga0495587_0019811 3300046536 Bacteria 4159
159 Ga0495598_0001716 3300046537 Bacteria 4392
160 Ga0495645_0000159 3300046543 Bacteria 46648
161 Ga0495634_0000729 3300046642 Bacteria 31881
162 Ga0495588_0088945 3300046674 Bacteria 1617
163 Ga0495613_0003304 3300046689 Bacteria 12069
164 Ga0495649_0150266 3300046694 Bacteria 1224
165 Ga0495649_0399518 3300046694 Unclassified 690
166 Ga0495581_0286130 3300047315 Unclassified 964
167 Ga0495676_0392488 3300047321 Bacteria 922
168 Ga0495684_1001172 3300047471 Unclassified 531
169 Ga0495602_0109599 3300048088 Bacteria 2246
170 Ga0495626_0088288 3300048091 Bacteria 1367
171 Ga0496100_0547690 3300048903 Bacteria 895
172 Ga0496104_0071753 3300048907 Bacteria 3292
173 Ga0496105_0084548 3300048908 Unclassified 2621
174 Ga0496108_1128717 3300048911 Bacteria 665
175 Ga0496108_1392031 3300048911 Unclassified 587
176 Ga0496111_0227650 3300048914 Unclassified 1385
177 Ga0496112_0007863 3300048915 Bacteria 9495
178 Ga0496113_0021833 3300048916 Bacteria 4519
179 Ga0496113_0035771 3300048916 Bacteria 3634
180 Ga0496114_0001129 3300048917 Bacteria 20185
181 Ga0496117_0067631 3300048920 Bacteria 2416
182 Ga0496118_0134604 3300048921 Bacteria 1579
183 Ga0496119_0018348 3300048922 Bacteria 5215
184 Ga0496122_0001560 3300048925 Bacteria 36253
185 Ga0496125_0000066 3300048928 Bacteria 249043
186 Ga0496126_0111883 3300048929 Bacteria 2378
187 Ga0501032_0097049 3300049569 Bacteria 1953
188 Ga0501033_0214635 3300049570 Bacteria 1371
189 Ga0501034_0146027 3300049571 Bacteria 2342
190 Ga0501036_0169190 3300049572 Bacteria 1841
191 Ga0501037_1055388 3300049573 Bacteria 527
192 Ga0501038_0160922 3300049574 Bacteria 1824
193 Ga0501039_0252694 3300049575 Unclassified 1386
194 Ga0501042_0172241 3300049578 Bacteria 1562
195 Ga0501043_0296905 3300049579 Bacteria 1236
196 Ga0501046_0086574 3300049580 Bacteria 2415
197 Ga0501047_1073149 3300049581 Bacteria 618
198 Ga0501048_0339737 3300049582 Bacteria 1070
199 Ga0501067_0376858 3300049583 Bacteria 791
200 Ga0501068_0156753 3300049584 Bacteria 1434
201 Ga0501069_0210547 3300049585 Bacteria 1128
202 Ga0501069_0627071 3300049585 Unclassified 646
203 Ga0501070_0288942 3300049586 Bacteria 1336
204 Ga0501072_0222923 3300049588 Bacteria 1503
205 Ga0501073_0065276 3300049589 Unclassified 2538
206 Ga0501074_0107185 3300049590 Bacteria 2000
207 Ga0501074_0995122 3300049590 Bacteria 589
208 Ga0501076_0003451 3300049592 Bacteria 11090
209 Ga0501079_0575338 3300049741 Bacteria 886
210 Ga0501080_0112668 3300049742 Bacteria 2522
211 Ga0501080_0539840 3300049742 Bacteria 1039
212 Ga0501080_1807328 3300049742 Unclassified 513
213 Ga0501083_0029112 3300049744 Bacteria 3802
214 Ga0501083_0771527 3300049744 Unclassified 625
215 Ga0501035_0236969 3300049822 Unclassified 1553
216 Ga0501044_0018280 3300049823 Bacteria 7513
217 Ga0501044_0589559 3300049823 Bacteria 1005
218 Ga0501045_0377878 3300049824 Unclassified 1055
219 Ga0501045_0938584 3300049824 Bacteria 635
220 nmdc:mga05p37_109029_c1 3300050507 Bacteria 3406
221 nmdc:mga05p37_5508_c1 3300050507 Bacteria 14870
222 nmdc:mga09592_20965_c1 3300050508 Bacteria 5381
223 nmdc:mga09592_233702_c1 3300050508 Bacteria 1593
224 nmdc:mga09592_38453_c1 3300050508 Bacteria 4017
225 nmdc:mga0qj67_25286_c1 3300050509 Bacteria 4587
226 nmdc:mga0qj67_27191_c1 3300050509 Bacteria 4431
227 nmdc:mga0qj67_797_c1 3300050509 Bacteria 21472
228 nmdc:mga06r32_2991_c1 3300050510 Bacteria 15132
229 nmdc:mga06r32_628100_c1 3300050510 Bacteria 1044
230 Ga0495601_0000028 3300053077 Bacteria 112630
231 Ga0495612_0092355 3300053078 Bacteria 1283
232 Ga0500556_0016725 3300053104 Bacteria 2286
233 Ga0500599_001020 3300053736 Bacteria 3150
234 Ga0587114_093859 3300059655 Bacteria 576
235 Ga0501082_0981647 3300060353 Bacteria 738
236 Ga0466962_0436207 3300061719 Bacteria 659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300020075 Ga0206349_1373827 Ga0206349_13738272 98
2 3300022467 Ga0224712_10520293 Ga0224712_105202932 98
3 3300028800 Ga0265338_10214977 Ga0265338_102149774 98
4 3300003911 JGI25405J52794_10032101 JGI25405J52794_100321012 99
5 3300005334 Ga0068869_100400346 Ga0068869_1004003462 99
6 3300005340 Ga0070689_100747038 Ga0070689_1007470382 99
7 3300005344 Ga0070661_100518264 Ga0070661_1005182641 99
8 3300005354 Ga0070675_100186526 Ga0070675_1001865263 99
9 3300005356 Ga0070674_100133692 Ga0070674_1001336923 99
10 3300005365 Ga0070688_100250927 Ga0070688_1002509273 99
11 3300005434 Ga0070709_10485443 Ga0070709_104854432 99
12 3300005435 Ga0070714_100000171 Ga0070714_10000017118 99
13 3300005435 Ga0070714_100113386 Ga0070714_1001133864 99
14 3300005435 Ga0070714_100315320 Ga0070714_1003153203 99
15 3300005435 Ga0070714_100823229 Ga0070714_1008232293 99
16 3300005436 Ga0070713_100447358 Ga0070713_1004473582 99
17 3300005437 Ga0070710_10000003 Ga0070710_10000003231 99
18 3300005437 Ga0070710_10062797 Ga0070710_100627973 99
19 3300005439 Ga0070711_100067076 Ga0070711_1000670764 99
20 3300005445 Ga0070708_100008527 Ga0070708_1000085279 99
21 3300005445 Ga0070708_100111882 Ga0070708_1001118823 99
22 3300005459 Ga0068867_100456372 Ga0068867_1004563722 99
23 3300005466 Ga0070685_10373618 Ga0070685_103736181 99
24 3300005467 Ga0070706_100006823 Ga0070706_10000682310 99
25 3300005467 Ga0070706_100184429 Ga0070706_1001844293 99
26 3300005468 Ga0070707_100005629 Ga0070707_1000056299 99
27 3300005471 Ga0070698_100047387 Ga0070698_1000473877 99
28 3300005535 Ga0070684_100896337 Ga0070684_1008963372 99
29 3300005535 Ga0070684_100973393 Ga0070684_1009733932 99
30 3300005549 Ga0070704_100823054 Ga0070704_1008230542 99
31 3300005577 Ga0068857_100379379 Ga0068857_1003793793 99
32 3300005614 Ga0068856_100334640 Ga0068856_1003346404 99
33 3300005614 Ga0068856_101104696 Ga0068856_1011046962 99
34 3300005616 Ga0068852_102433288 Ga0068852_1024332882 99
35 3300005617 Ga0068859_100027844 Ga0068859_1000278445 99
36 3300005617 Ga0068859_100577553 Ga0068859_1005775533 99
37 3300005618 Ga0068864_100032601 Ga0068864_1000326011 99
38 3300005618 Ga0068864_100890525 Ga0068864_1008905251 99
39 3300005840 Ga0068870_10931970 Ga0068870_109319701 99
40 3300005841 Ga0068863_100156561 Ga0068863_1001565613 99
41 3300005841 Ga0068863_101591126 Ga0068863_1015911262 99
42 3300005843 Ga0068860_101529004 Ga0068860_1015290042 99
43 3300005844 Ga0068862_100253947 Ga0068862_1002539472 99
44 3300005937 Ga0081455_10000126 Ga0081455_1000012615 99
45 3300005983 Ga0081540_1005923 Ga0081540_10059233 99
46 3300005983 Ga0081540_1103659 Ga0081540_11036594 99
47 3300005983 Ga0081540_1240923 Ga0081540_12409232 99
48 3300006028 Ga0070717_10000005 Ga0070717_10000005209 99
49 3300006048 Ga0075363_100489766 Ga0075363_1004897662 99
50 3300006844 Ga0075428_100005123 Ga0075428_1000051238 99
51 3300006844 Ga0075428_100026194 Ga0075428_1000261942 99
52 3300006846 Ga0075430_100001516 Ga0075430_10000151611 99
53 3300006846 Ga0075430_100001738 Ga0075430_10000173818 99
54 3300006846 Ga0075430_100002259 Ga0075430_10000225918 99
55 3300006847 Ga0075431_100002814 Ga0075431_10000281411 99
56 3300006847 Ga0075431_100050313 Ga0075431_1000503135 99
57 3300006880 Ga0075429_100003015 Ga0075429_1000030158 99
58 3300006880 Ga0075429_100093586 Ga0075429_1000935862 99
59 3300006931 Ga0097620_100027844 Ga0097620_1000278445 99
60 3300006931 Ga0097620_100577481 Ga0097620_1005774813 99
61 3300009093 Ga0105240_10128459 Ga0105240_101284595 99
62 3300009101 Ga0105247_10041315 Ga0105247_100413155 99
63 3300009147 Ga0114129_10005409 Ga0114129_1000540910 99
64 3300009147 Ga0114129_10013849 Ga0114129_1001384911 99
65 3300009147 Ga0114129_10294762 Ga0114129_102947622 99
66 3300009147 Ga0114129_12380967 Ga0114129_123809671 99
67 3300009177 Ga0105248_10038713 Ga0105248_100387135 99
68 3300009545 Ga0105237_10420518 Ga0105237_104205184 99
69 3300009553 Ga0105249_10866870 Ga0105249_108668703 99
70 3300010375 Ga0105239_10092118 Ga0105239_100921184 99
71 3300010375 Ga0105239_10303551 Ga0105239_103035513 99
72 3300010375 Ga0105239_13040338 Ga0105239_130403381 99
73 3300011119 Ga0105246_10002524 Ga0105246_1000252411 99
74 3300014325 Ga0163163_10003396 Ga0163163_1000339618 99
75 3300014325 Ga0163163_10606191 Ga0163163_106061912 99
76 3300014325 Ga0163163_12682402 Ga0163163_126824021 99
77 3300014745 Ga0157377_11031534 Ga0157377_110315341 99
78 3300014745 Ga0157377_11469784 Ga0157377_114697842 99
79 3300014968 Ga0157379_10491725 Ga0157379_104917252 99
80 3300014969 Ga0157376_10190226 Ga0157376_101902264 99
81 3300021384 Ga0213876_10006054 Ga0213876_100060542 99
82 3300022467 Ga0224712_10317710 Ga0224712_103177101 99
83 3300025898 Ga0207692_10000016 Ga0207692_1000001645 99
84 3300025900 Ga0207710_10000072 Ga0207710_10000072151 99
85 3300025910 Ga0207684_10171307 Ga0207684_101713073 99
86 3300025913 Ga0207695_10197560 Ga0207695_101975601 99
87 3300025916 Ga0207663_10058504 Ga0207663_100585044 99
88 3300025922 Ga0207646_10062362 Ga0207646_100623625 99
89 3300025926 Ga0207659_10246394 Ga0207659_102463942 99
90 3300025928 Ga0207700_10380105 Ga0207700_103801052 99
91 3300025929 Ga0207664_10000004 Ga0207664_1000000419 99
92 3300025929 Ga0207664_10089636 Ga0207664_100896364 99
93 3300025929 Ga0207664_11036472 Ga0207664_110364722 99
94 3300025936 Ga0207670_10054103 Ga0207670_100541034 99
95 3300025941 Ga0207711_10642386 Ga0207711_106423863 99
96 3300025944 Ga0207661_10001766 Ga0207661_100017668 99
97 3300025944 Ga0207661_10216321 Ga0207661_102163212 99
98 3300025961 Ga0207712_10235024 Ga0207712_102350243 99
99 3300026023 Ga0207677_12169696 Ga0207677_121696962 99
100 3300026078 Ga0207702_10841553 Ga0207702_108415532 99
101 3300026078 Ga0207702_10898251 Ga0207702_108982512 99
102 3300026078 Ga0207702_10948262 Ga0207702_109482622 99
103 3300026088 Ga0207641_10896644 Ga0207641_108966442 99
104 3300026088 Ga0207641_11515429 Ga0207641_115154292 99
105 3300026089 Ga0207648_10302181 Ga0207648_103021813 99
106 3300026095 Ga0207676_10189540 Ga0207676_101895403 99
107 3300026095 Ga0207676_10684770 Ga0207676_106847702 99
108 3300026116 Ga0207674_10112137 Ga0207674_101121374 99
109 3300026118 Ga0207675_101882813 Ga0207675_1018828132 99
110 3300028380 Ga0268265_10087510 Ga0268265_100875102 99
111 3300028558 Ga0265326_10000006 Ga0265326_10000006132 99
112 3300028558 Ga0265326_10017048 Ga0265326_100170483 99
113 3300028563 Ga0265319_1000622 Ga0265319_100062226 99
114 3300028573 Ga0265334_10330324 Ga0265334_103303242 99
115 3300028577 Ga0265318_10126234 Ga0265318_101262342 99
116 3300028800 Ga0265338_10000961 Ga0265338_1000096127 99
117 3300028800 Ga0265338_10042139 Ga0265338_100421394 99
118 3300029957 Ga0265324_10002560 Ga0265324_1000256010 99
119 3300030521 Ga0307511_10393303 Ga0307511_103933032 99
120 3300031251 Ga0265327_10181770 Ga0265327_101817703 99
121 3300031548 Ga0307408_102205459 Ga0307408_1022054591 99
122 3300031616 Ga0307508_10077552 Ga0307508_100775522 99
123 3300031911 Ga0307412_10696246 Ga0307412_106962462 99
124 3300031995 Ga0307409_101148870 Ga0307409_1011488703 99
125 3300031995 Ga0307409_102319671 Ga0307409_1023196711 99
126 3300032002 Ga0307416_100835356 Ga0307416_1008353562 99
127 3300032002 Ga0307416_102351253 Ga0307416_1023512532 99
128 3300033180 Ga0307510_10164958 Ga0307510_101649582 99
129 3300035692 Ga0373935_0384985 Ga0373935_0384985_200_502 99
130 3300036459 Ga0372808_004315 Ga0372808_004315_1247_1546 99
131 3300037418 Ga0395900_0119747 Ga0395900_0119747_414_716 99
132 3300037853 Ga0436364_1031756 Ga0436364_1031756_160_459 99
133 3300038443 Ga0395901_0157012 Ga0395901_0157012_743_1045 99
134 3300039437 Ga0436365_1083994 Ga0436365_1083994_77619_77927 99
135 3300039438 Ga0436360_1115329 Ga0436360_1115329_223_522 99
136 3300041453 Ga0451797_0180343 Ga0451797_0180343_347_649 99
137 3300041456 Ga0451795_0867361 Ga0451795_0867361_256_558 99
138 3300041486 Ga0451807_0450893 Ga0451807_0450893_253_555 99
139 3300041509 Ga0451843_0871014 Ga0451843_0871014_312_614 99
140 3300044683 Ga0466965_0646252 Ga0466965_0646252_241_558 99
141 3300044694 Ga0466963_0021084 Ga0466963_0021084_110_409 99
142 3300044694 Ga0466963_1059660 Ga0466963_1059660_116_415 99
143 3300044694 Ga0466963_1305070 Ga0466963_1305070_127_444 99
144 3300044901 Ga0466960_0214997 Ga0466960_0214997_703_1020 99
145 3300044901 Ga0466960_0273924 Ga0466960_0273924_555_872 99
146 3300044901 Ga0466960_1008094 Ga0466960_1008094_62_361 99
147 3300045976 Ga0466967_0013978 Ga0466967_0013978_5789_6088 99
148 3300045976 Ga0466967_0021069 Ga0466967_0021069_4111_4416 99
149 3300045976 Ga0466967_1960428 Ga0466967_1960428_240_557 99
150 3300046457 Ga0495590_0364226 Ga0495590_0364226_131_430 99
151 3300046459 Ga0495629_0075832 Ga0495629_0075832_1574_1876 99
152 3300046475 Ga0495639_0101647 Ga0495639_0101647_355_654 99
153 3300046476 Ga0495662_0028078 Ga0495662_0028078_363_662 99
154 3300046506 Ga0495583_0170565 Ga0495583_0170565_91_390 99
155 3300046511 Ga0495608_0068063 Ga0495608_0068063_1421_1720 99
156 3300046517 Ga0495630_0200160 Ga0495630_0200160_146_448 99
157 3300046531 Ga0495665_0402043 Ga0495665_0402043_277_594 99
158 3300046536 Ga0495587_0019811 Ga0495587_0019811_251_550 99
159 3300046537 Ga0495598_0001716 Ga0495598_0001716_860_1159 99
160 3300046543 Ga0495645_0000159 Ga0495645_0000159_2950_3249 99
161 3300046642 Ga0495634_0000729 Ga0495634_0000729_21517_21816 99
162 3300046674 Ga0495588_0088945 Ga0495588_0088945_205_504 99
163 3300046689 Ga0495613_0003304 Ga0495613_0003304_9308_9607 99
164 3300046694 Ga0495649_0150266 Ga0495649_0150266_680_979 99
165 3300046694 Ga0495649_0399518 Ga0495649_0399518_71_370 99
166 3300047315 Ga0495581_0286130 Ga0495581_0286130_318_620 99
167 3300047321 Ga0495676_0392488 Ga0495676_0392488_453_752 99
168 3300047471 Ga0495684_1001172 Ga0495684_1001172_83_382 99
169 3300048088 Ga0495602_0109599 Ga0495602_0109599_168_467 99
170 3300048091 Ga0495626_0088288 Ga0495626_0088288_369_668 99
171 3300048903 Ga0496100_0547690 Ga0496100_0547690_563_865 99
172 3300048907 Ga0496104_0071753 Ga0496104_0071753_572_874 99
173 3300048908 Ga0496105_0084548 Ga0496105_0084548_1692_2027 99
174 3300048911 Ga0496108_1128717 Ga0496108_1128717_267_566 99
175 3300048911 Ga0496108_1392031 Ga0496108_1392031_265_576 99
176 3300048914 Ga0496111_0227650 Ga0496111_0227650_671_1006 99
177 3300048915 Ga0496112_0007863 Ga0496112_0007863_8911_9210 99
178 3300048916 Ga0496113_0021833 Ga0496113_0021833_2120_2422 99
179 3300048916 Ga0496113_0035771 Ga0496113_0035771_1530_1829 99
180 3300048917 Ga0496114_0001129 Ga0496114_0001129_2126_2425 99
181 3300048920 Ga0496117_0067631 Ga0496117_0067631_2067_2369 99
182 3300048921 Ga0496118_0134604 Ga0496118_0134604_392_694 99
183 3300048922 Ga0496119_0018348 Ga0496119_0018348_4711_5013 99
184 3300048925 Ga0496122_0001560 Ga0496122_0001560_7558_7860 99
185 3300048928 Ga0496125_0000066 Ga0496125_0000066_213752_214054 99
186 3300048929 Ga0496126_0111883 Ga0496126_0111883_29_328 99
187 3300049569 Ga0501032_0097049 Ga0501032_0097049_633_938 99
188 3300049570 Ga0501033_0214635 Ga0501033_0214635_284_589 99
189 3300049571 Ga0501034_0146027 Ga0501034_0146027_1029_1334 99
190 3300049572 Ga0501036_0169190 Ga0501036_0169190_125_430 99
191 3300049573 Ga0501037_1055388 Ga0501037_1055388_202_507 99
192 3300049574 Ga0501038_0160922 Ga0501038_0160922_1493_1798 99
193 3300049575 Ga0501039_0252694 Ga0501039_0252694_428_733 99
194 3300049578 Ga0501042_0172241 Ga0501042_0172241_902_1207 99
195 3300049579 Ga0501043_0296905 Ga0501043_0296905_354_653 99
196 3300049580 Ga0501046_0086574 Ga0501046_0086574_1449_1754 99
197 3300049581 Ga0501047_1073149 Ga0501047_1073149_47_352 99
198 3300049582 Ga0501048_0339737 Ga0501048_0339737_266_571 99
199 3300049583 Ga0501067_0376858 Ga0501067_0376858_337_642 99
200 3300049584 Ga0501068_0156753 Ga0501068_0156753_1075_1380 99
201 3300049585 Ga0501069_0210547 Ga0501069_0210547_437_736 99
202 3300049585 Ga0501069_0627071 Ga0501069_0627071_99_404 99
203 3300049586 Ga0501070_0288942 Ga0501070_0288942_284_589 99
204 3300049588 Ga0501072_0222923 Ga0501072_0222923_69_374 99
205 3300049589 Ga0501073_0065276 Ga0501073_0065276_237_542 99
206 3300049590 Ga0501074_0107185 Ga0501074_0107185_1397_1696 99
207 3300049590 Ga0501074_0995122 Ga0501074_0995122_248_553 99
208 3300049592 Ga0501076_0003451 Ga0501076_0003451_241_540 99
209 3300049741 Ga0501079_0575338 Ga0501079_0575338_99_404 99
210 3300049742 Ga0501080_0112668 Ga0501080_0112668_1873_2172 99
211 3300049742 Ga0501080_0539840 Ga0501080_0539840_711_1016 99
212 3300049742 Ga0501080_1807328 Ga0501080_1807328_80_379 99
213 3300049744 Ga0501083_0029112 Ga0501083_0029112_3419_3718 99
214 3300049744 Ga0501083_0771527 Ga0501083_0771527_144_449 99
215 3300049822 Ga0501035_0236969 Ga0501035_0236969_639_944 99
216 3300049823 Ga0501044_0018280 Ga0501044_0018280_5254_5553 99
217 3300049823 Ga0501044_0589559 Ga0501044_0589559_449_754 99
218 3300049824 Ga0501045_0377878 Ga0501045_0377878_635_940 99
219 3300049824 Ga0501045_0938584 Ga0501045_0938584_326_625 99
220 3300050507 nmdc:mga05p37_109029_c1 nmdc:mga05p37_109029_c1_1784_2086 99
221 3300050507 nmdc:mga05p37_5508_c1 nmdc:mga05p37_5508_c1_10426_10725 99
222 3300050508 nmdc:mga09592_20965_c1 nmdc:mga09592_20965_c1_1524_1823 99
223 3300050508 nmdc:mga09592_233702_c1 nmdc:mga09592_233702_c1_311_610 99
224 3300050508 nmdc:mga09592_38453_c1 nmdc:mga09592_38453_c1_3392_3694 99
225 3300050509 nmdc:mga0qj67_25286_c1 nmdc:mga0qj67_25286_c1_571_870 99
226 3300050509 nmdc:mga0qj67_27191_c1 nmdc:mga0qj67_27191_c1_359_661 99
227 3300050509 nmdc:mga0qj67_797_c1 nmdc:mga0qj67_797_c1_8838_9140 99
228 3300050510 nmdc:mga06r32_2991_c1 nmdc:mga06r32_2991_c1_5588_5887 99
229 3300050510 nmdc:mga06r32_628100_c1 nmdc:mga06r32_628100_c1_233_535 99
230 3300053077 Ga0495601_0000028 Ga0495601_0000028_5267_5566 99
231 3300053078 Ga0495612_0092355 Ga0495612_0092355_535_834 99
232 3300053104 Ga0500556_0016725 Ga0500556_0016725_711_1010 99
233 3300053736 Ga0500599_001020 Ga0500599_001020_472_771 99
234 3300059655 Ga0587114_093859 Ga0587114_093859_195_494 99
235 3300060353 Ga0501082_0981647 Ga0501082_0981647_409_714 99
236 3300061719 Ga0466962_0436207 Ga0466962_0436207_151_468 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

5

95

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uct-assembly1.cif.gz_A-2 mycobacterium tuberculosis toxin mazf-mt6 0.9642 2 99
6l29-assembly1.cif.gz_B the structure of the mazf-mt1 mutant 0.93 3 99
5cca-assembly1.cif.gz_B crystal structure of mtb toxin 0.9279 2 96
5cca-assembly1.cif.gz_B crystal structure of mtb toxin 0.9182 2 96
5hjz-assembly1.cif.gz_A structure of m. tuberculosis mazf-mt1 (rv2801c) in complex with rna 0.9151 3 98
ID Description Score Start End Superfamily
5ccaB00 Mainly Beta;Roll;SH3 type barrels.; 0.9279 2 96 2.30.30.110
5ccaB00 Mainly Beta;Roll;SH3 type barrels.; 0.9182 2 96 2.30.30.110
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9177 3 99 2.30.30.110
4hkeA00 Mainly Beta;Roll;SH3 type barrels.; 0.9121 3 99 2.30.30.110
af_P71650_1_116_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9105 3 98 2.30.30.110
ID Description Score Start End GO Terms
AF-A0A0A0JHH2-F1-model_v4 mRNA interferase MazF3 1.006 27 99 GO:0003677
AF-A0A5C4M684-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 1.004 31 99 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A3S4VDA3-F1-model_v4 mRNA interferase MazF3 (EC 3.1.-.-) 0.9861 27 99 GO:0003677
GO:0016787
AF-A0A1F2WCU9-F1-model_v4 Uncharacterized protein 0.9832 31 99
AF-A0A1F4DUI1-F1-model_v4 MazF family transcriptional regulator 0.9816 33 99 GO:0003677

Feature Viewer

pLDDT pTM Quality
93.52 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map